F472579

General Info

Members Datasets Scaffolds Average Seq Length
651 468 1302 70

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_101152894|Ga0070713_1011528942
Length 83
Sequence VLDLGLKNREVTMSAIAEVLSTVARSRDPRCSELPTCPVCADSMVAAEASAYVSDQLISYLWTCDTCGYGFVTKHSVKRFTCN

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
87 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
88 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
89 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300019176 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
120 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
121 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
122 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
125 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
126 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
186 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
187 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
188 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
189 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
196 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
198 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
204 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
205 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
206 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
219 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
220 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
221 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
222 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
223 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
224 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
227 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
228 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
229 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
230 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
233 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
237 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
238 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
239 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
240 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
241 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
242 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
246 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
247 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
248 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
252 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
253 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
254 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
255 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
270 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
271 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
272 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
273 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
276 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
283 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
290 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
291 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
292 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
293 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
296 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
297 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
298 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
299 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
300 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
301 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
302 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
303 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
304 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
305 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
306 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
307 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
308 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
309 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
310 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
311 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
312 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
313 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
314 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
315 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
316 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
317 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
318 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
319 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
321 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
322 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
323 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
324 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
325 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
326 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
327 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
328 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
329 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
330 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
331 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
332 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
333 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
334 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
335 2643221651 Afipia sp. Root123D2 Isolate Unclassified
336 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
337 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
338 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
339 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
340 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
341 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
342 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
343 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
344 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
345 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
346 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
347 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
348 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
349 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
350 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
351 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
352 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
353 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
354 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
355 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
356 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
357 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
358 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
359 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
360 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
361 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
362 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
363 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
364 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
365 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
366 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
367 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
368 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
369 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
370 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
371 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
372 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
373 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
374 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
375 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
376 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
377 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
378 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
379 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
380 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
381 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
382 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
383 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
384 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
385 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
386 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
387 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
388 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
389 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
390 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
391 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
392 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
393 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
394 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
395 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
396 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
397 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
398 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
399 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
400 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
401 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
402 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
403 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
404 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
405 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
406 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
407 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
408 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
409 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
410 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
411 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
412 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
413 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
414 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
415 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
416 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
417 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
418 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
419 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
420 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
421 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
422 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
423 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
424 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
425 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
426 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
427 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
428 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
429 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
430 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
431 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
432 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
433 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
434 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
435 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
436 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
437 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
438 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
439 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
440 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
441 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
442 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
443 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
444 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
445 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
446 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
447 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
448 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
449 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
450 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
451 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
452 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
453 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
454 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
455 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
456 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
457 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
458 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
459 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
460 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
461 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
462 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
463 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
464 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
465 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
466 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
467 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
468 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.88
Metatranscriptomes 1.23
Isolates 22.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.75
Nodule 18.13
Rhizoplane 5.99
Rhizosphere 55.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_101152894 3300005436 Bacteria 750
2 JGI25153J46596_10003349 3300003215 Bacteria 8998
3 JGI25153J46596_10127219 3300003215 Bacteria 568
4 JGI25404J52841_10027385 3300003659 Bacteria 1226
5 Ga0055526_1094512 3300003771 Bacteria 558
6 Ga0055524_1076530 3300003775 Bacteria 624
7 Ga0055531_10008136 3300003794 Bacteria 5586
8 Ga0065165_1009218 3300005262 Bacteria 4464
9 Ga0065704_10164822 3300005289 Bacteria 1330
10 Ga0065707_10172441 3300005295 Bacteria 1470
11 Ga0070658_10641289 3300005327 Bacteria 921
12 Ga0070658_10769022 3300005327 Bacteria 836
13 Ga0070683_100835537 3300005329 Bacteria 883
14 Ga0068869_100107903 3300005334 Bacteria 2114
15 Ga0068869_100186544 3300005334 Bacteria 1628
16 Ga0068869_101125618 3300005334 Bacteria 688
17 Ga0070666_10414728 3300005335 Bacteria 969
18 Ga0070680_100225526 3300005336 Bacteria 1582
19 Ga0068868_100007491 3300005338 Bacteria 7775
20 Ga0068868_100286531 3300005338 Bacteria 1395
21 Ga0068868_102007777 3300005338 Bacteria 549
22 Ga0070660_100408676 3300005339 Bacteria 1123
23 Ga0070660_100452694 3300005339 Bacteria 1065
24 Ga0070660_101958178 3300005339 Bacteria 500
25 Ga0070689_100773735 3300005340 Bacteria 843
26 Ga0070691_10529908 3300005341 Bacteria 685
27 Ga0070661_100296309 3300005344 Bacteria 1258
28 Ga0070668_100075587 3300005347 Bacteria 2630
29 Ga0070668_100229951 3300005347 Bacteria 1532
30 Ga0070669_100183667 3300005353 Bacteria 1637
31 Ga0070669_100434357 3300005353 Bacteria 1080
32 Ga0070675_100540561 3300005354 Bacteria 1053
33 Ga0070671_100472535 3300005355 Bacteria 1077
34 Ga0070671_100561591 3300005355 Bacteria 985
35 Ga0070674_100994441 3300005356 Bacteria 736
36 Ga0070659_100089178 3300005366 Bacteria 2470
37 Ga0070659_100560695 3300005366 Bacteria 979
38 Ga0070667_100422734 3300005367 Bacteria 1215
39 Ga0070667_100836448 3300005367 Bacteria 855
40 Ga0070703_10241343 3300005406 Bacteria 729
41 Ga0070709_10024785 3300005434 Bacteria 3536
42 Ga0070709_10111598 3300005434 Bacteria 1839
43 Ga0070714_100071314 3300005435 Bacteria 3003
44 Ga0070714_100232488 3300005435 Bacteria 1699
45 Ga0070713_100041301 3300005436 Bacteria 3757
46 Ga0070713_100063065 3300005436 Bacteria 3105
47 Ga0070710_10013018 3300005437 Bacteria 4149
48 Ga0070710_10680304 3300005437 Bacteria 724
49 Ga0070701_10728308 3300005438 Bacteria 670
50 Ga0070711_100038266 3300005439 Bacteria 3224
51 Ga0070711_101182964 3300005439 Bacteria 661
52 Ga0070711_101713523 3300005439 Bacteria 551
53 Ga0070705_100634708 3300005440 Bacteria 831
54 Ga0070700_100324972 3300005441 Bacteria 1132
55 Ga0070694_100387979 3300005444 Bacteria 1091
56 Ga0070708_100119235 3300005445 Bacteria 2432
57 Ga0070663_100097375 3300005455 Bacteria 2190
58 Ga0070663_100369047 3300005455 Bacteria 1166
59 Ga0070663_100707819 3300005455 Bacteria 856
60 Ga0070663_101185173 3300005455 Bacteria 671
61 Ga0070678_100152619 3300005456 Bacteria 1862
62 Ga0070662_100020359 3300005457 Bacteria 4517
63 Ga0070662_100244683 3300005457 Bacteria 1440
64 Ga0070662_101093444 3300005457 Bacteria 684
65 Ga0070681_10186465 3300005458 Bacteria 1995
66 Ga0070681_10482358 3300005458 Bacteria 1153
67 Ga0068867_101124891 3300005459 Bacteria 718
68 Ga0070707_100324614 3300005468 Bacteria 1496
69 Ga0070698_100969567 3300005471 Bacteria 797
70 Ga0070699_100051348 3300005518 Bacteria 3569
71 Ga0070679_100135353 3300005530 Bacteria 2445
72 Ga0070679_100142902 3300005530 Bacteria 2372
73 Ga0070679_100733144 3300005530 Bacteria 931
74 Ga0070684_100371349 3300005535 Bacteria 1317
75 Ga0070684_100741109 3300005535 Bacteria 917
76 Ga0070697_100131947 3300005536 Bacteria 2096
77 Ga0070697_100525854 3300005536 Bacteria 1036
78 Ga0068853_100042919 3300005539 Bacteria 3868
79 Ga0068853_100057653 3300005539 Bacteria 3352
80 Ga0068853_100556588 3300005539 Bacteria 1087
81 Ga0068853_100788104 3300005539 Bacteria 910
82 Ga0070672_100335921 3300005543 Bacteria 1286
83 Ga0070696_101428093 3300005546 Bacteria 591
84 Ga0070693_100219953 3300005547 Bacteria 1244
85 Ga0070665_100284752 3300005548 Bacteria 1655
86 Ga0070665_100514235 3300005548 Bacteria 1209
87 Ga0070704_101887342 3300005549 Bacteria 554
88 Ga0070664_100309663 3300005564 Bacteria 1429
89 Ga0070664_100839693 3300005564 Bacteria 860
90 Ga0068857_100446418 3300005577 Bacteria 1209
91 Ga0068857_101883758 3300005577 Bacteria 586
92 Ga0068854_100682796 3300005578 Bacteria 885
93 Ga0068854_100719955 3300005578 Bacteria 863
94 Ga0068854_100917460 3300005578 Bacteria 771
95 Ga0068856_100000919 3300005614 Bacteria 31534
96 Ga0068856_100191221 3300005614 Bacteria 2060
97 Ga0068856_102030974 3300005614 Bacteria 585
98 Ga0070702_100284891 3300005615 Bacteria 1136
99 Ga0070702_101541991 3300005615 Bacteria 548
100 Ga0068852_100602987 3300005616 Bacteria 1102
101 Ga0068864_100235160 3300005618 Bacteria 1696
102 Ga0068861_100065931 3300005719 Bacteria 2790
103 Ga0068861_101502647 3300005719 Bacteria 661
104 Ga0068851_10535959 3300005834 Bacteria 706
105 Ga0068863_101599884 3300005841 Bacteria 661
106 Ga0068858_100725208 3300005842 Bacteria 968
107 Ga0068860_100340556 3300005843 Bacteria 1474
108 Ga0068860_101041739 3300005843 Bacteria 837
109 Ga0068860_102315113 3300005843 Bacteria 558
110 Ga0068862_100268904 3300005844 Bacteria 1558
111 Ga0081538_10134916 3300005981 Bacteria 1151
112 Ga0081538_10209372 3300005981 Bacteria 788
113 Ga0081540_1010647 3300005983 Bacteria 6205
114 Ga0081540_1010931 3300005983 Bacteria 6097
115 Ga0081540_1044061 3300005983 Bacteria 2281
116 Ga0081540_1135599 3300005983 Bacteria 997
117 Ga0081540_1250047 3300005983 Bacteria 619
118 Ga0081539_10000737 3300005985 Bacteria 65468
119 Ga0070717_10005326 3300006028 Bacteria 9376
120 Ga0070717_10131332 3300006028 Bacteria 2154
121 Ga0070717_10796621 3300006028 Bacteria 860
122 Ga0075368_10104260 3300006042 Bacteria 1166
123 Ga0075363_100443780 3300006048 Bacteria 766
124 Ga0075364_10264313 3300006051 Bacteria 1170
125 Ga0070715_10248438 3300006163 Bacteria 929
126 Ga0070716_100175925 3300006173 Bacteria 1401
127 Ga0070716_100502076 3300006173 Bacteria 895
128 Ga0070716_101550679 3300006173 Bacteria 543
129 Ga0070712_100030785 3300006175 Bacteria 3611
130 Ga0070712_100220946 3300006175 Bacteria 1500
131 Ga0070712_101802902 3300006175 Bacteria 536
132 Ga0075362_10398552 3300006177 Bacteria 694
133 Ga0075367_10085949 3300006178 Bacteria 1908
134 Ga0075367_10329366 3300006178 Bacteria 963
135 Ga0075369_10038900 3300006186 Bacteria 2030
136 Ga0075369_10120885 3300006186 Bacteria 1185
137 Ga0075369_10488583 3300006186 Bacteria 585
138 Ga0075366_10046896 3300006195 Bacteria 2560
139 Ga0075366_10468673 3300006195 Bacteria 778
140 Ga0075366_10548546 3300006195 Bacteria 716
141 Ga0075366_10747966 3300006195 Bacteria 607
142 Ga0075370_10018364 3300006353 Bacteria 3795
143 Ga0075370_10080748 3300006353 Bacteria 1869
144 Ga0075370_10128181 3300006353 Bacteria 1480
145 Ga0075370_10211987 3300006353 Bacteria 1144
146 Ga0075370_10612664 3300006353 Bacteria 660
147 Ga0068871_100029699 3300006358 Bacteria 4296
148 Ga0068871_101419925 3300006358 Bacteria 655
149 Ga0075428_102066526 3300006844 Bacteria 590
150 Ga0075434_100011702 3300006871 Bacteria 8285
151 Ga0068865_100058758 3300006881 Bacteria 2687
152 Ga0099825_1058887 3300006941 Bacteria 684
153 Ga0099824_1014235 3300006942 Bacteria 7974
154 Ga0099822_1079452 3300006943 Bacteria 819
155 Ga0099823_1068020 3300006944 Bacteria 1653
156 Ga0075435_101956973 3300007076 Bacteria 515
157 Ga0099795_10024953 3300007788 Bacteria 1999
158 Ga0099795_10049021 3300007788 Bacteria 1531
159 Ga0099795_10177983 3300007788 Bacteria 887
160 Ga0105251_10344174 3300009011 Bacteria 680
161 Ga0105240_10016366 3300009093 Bacteria 10041
162 Ga0105240_10657793 3300009093 Bacteria 1148
163 Ga0105245_10092768 3300009098 Bacteria 2781
164 Ga0105245_11059064 3300009098 Bacteria 856
165 Ga0105245_11941884 3300009098 Bacteria 642
166 Ga0105248_11705841 3300009177 Bacteria 714
167 Ga0105237_10005222 3300009545 Bacteria 14690
168 Ga0105237_11406417 3300009545 Bacteria 704
169 Ga0105238_10080231 3300009551 Bacteria 3253
170 Ga0105238_11455399 3300009551 Bacteria 713
171 Ga0105238_11882604 3300009551 Bacteria 631
172 Ga0105249_10544573 3300009553 Bacteria 1210
173 Ga0099796_10093561 3300010159 Bacteria 1121
174 Ga0105239_10026158 3300010375 Bacteria 6423
175 Ga0105239_10254931 3300010375 Bacteria 1971
176 Ga0105239_10861808 3300010375 Bacteria 1039
177 Ga0105239_10959988 3300010375 Bacteria 982
178 Ga0105239_11269762 3300010375 Bacteria 849
179 Ga0105246_10029536 3300011119 Bacteria 3612
180 Ga0105246_10855949 3300011119 Bacteria 811
181 Ga0105246_12060005 3300011119 Bacteria 552
182 Ga0157316_1075514 3300012510 Bacteria 517
183 Ga0157373_10203000 3300013100 Bacteria 1398
184 Ga0157371_10046637 3300013102 Bacteria 3082
185 Ga0157370_11150482 3300013104 Bacteria 701
186 Ga0157374_10118140 3300013296 Bacteria 2557
187 Ga0157374_10526235 3300013296 Bacteria 1189
188 Ga0157378_10301070 3300013297 Bacteria 1552
189 Ga0163162_10018448 3300013306 Bacteria 6837
190 Ga0163162_10510206 3300013306 Bacteria 1332
191 Ga0163162_12705652 3300013306 Bacteria 571
192 Ga0157372_10025324 3300013307 Bacteria 6448
193 Ga0157372_11696584 3300013307 Bacteria 727
194 Ga0157375_10032821 3300013308 Bacteria 4927
195 Ga0157375_12285882 3300013308 Bacteria 645
196 Ga0163163_10073315 3300014325 Bacteria 3414
197 Ga0163163_10744488 3300014325 Bacteria 1043
198 Ga0163163_12327935 3300014325 Bacteria 594
199 Ga0157377_10042226 3300014745 Bacteria 2532
200 Ga0157377_10583573 3300014745 Bacteria 795
201 Ga0157379_10192607 3300014968 Bacteria 1842
202 Ga0157379_10548407 3300014968 Bacteria 1075
203 Ga0157379_10635162 3300014968 Bacteria 999
204 Ga0157376_10024069 3300014969 Bacteria 4776
205 Ga0157376_10252600 3300014969 Bacteria 1648
206 Ga0163161_10420182 3300017792 Bacteria 1075
207 Ga0184596_110157 3300019176 Bacteria 638
208 Ga0184596_123107 3300019176 Bacteria 520
209 Ga0206356_11416121 3300020070 Bacteria 810
210 Ga0154015_1057556 3300020610 Bacteria 1290
211 Ga0214544_1000051 3300021320 Bacteria 134645
212 Ga0214544_1054321 3300021320 Bacteria 611
213 Ga0214542_1005406 3300021321 Bacteria 24265
214 Ga0214545_1000126 3300021324 Bacteria 91489
215 Ga0214543_1003794 3300021327 Bacteria 29103
216 Ga0224712_10633348 3300022467 Bacteria 523
217 Ga0207425_1075197 3300025245 Bacteria 572
218 Ga0209233_1034384 3300025261 Bacteria 1154
219 Ga0209455_1005472 3300025272 Bacteria 3917
220 Ga0209564_1011017 3300025295 Bacteria 4095
221 Ga0209758_1000021 3300025297 Bacteria 697691
222 Ga0209758_1001783 3300025297 Bacteria 23819
223 Ga0209758_1020076 3300025297 Bacteria 3182
224 Ga0209256_1009096 3300025299 Bacteria 4428
225 Ga0207426_1068044 3300025302 Bacteria 1002
226 Ga0207426_1111988 3300025302 Bacteria 686
227 Ga0209051_1030434 3300025303 Bacteria 2094
228 Ga0209257_1001917 3300025304 Bacteria 22464
229 Ga0209257_1093322 3300025304 Bacteria 747
230 Ga0207696_1116105 3300025711 Bacteria 723
231 Ga0207642_11017697 3300025899 Bacteria 534
232 Ga0207688_10203395 3300025901 Bacteria 1188
233 Ga0207647_10094039 3300025904 Bacteria 1786
234 Ga0207685_10414894 3300025905 Bacteria 693
235 Ga0207699_10019941 3300025906 Bacteria 3585
236 Ga0207699_10051413 3300025906 Bacteria 2435
237 Ga0207699_10303315 3300025906 Bacteria 1116
238 Ga0207643_10592827 3300025908 Bacteria 713
239 Ga0207705_10566332 3300025909 Bacteria 883
240 Ga0207684_10771097 3300025910 Bacteria 814
241 Ga0207707_10286868 3300025912 Bacteria 1425
242 Ga0207695_10000015 3300025913 Bacteria 803205
243 Ga0207671_10004241 3300025914 Bacteria 13810
244 Ga0207671_10329379 3300025914 Bacteria 1209
245 Ga0207693_10086011 3300025915 Bacteria 2463
246 Ga0207693_10120591 3300025915 Bacteria 2059
247 Ga0207663_10069296 3300025916 Bacteria 2268
248 Ga0207663_10473657 3300025916 Bacteria 969
249 Ga0207663_10762504 3300025916 Bacteria 769
250 Ga0207660_10206202 3300025917 Bacteria 1537
251 Ga0207662_10393858 3300025918 Bacteria 938
252 Ga0207657_10011925 3300025919 Bacteria 8601
253 Ga0207657_10315125 3300025919 Bacteria 1238
254 Ga0207649_10194362 3300025920 Bacteria 1429
255 Ga0207652_10285617 3300025921 Bacteria 1489
256 Ga0207652_10404761 3300025921 Bacteria 1231
257 Ga0207652_10992318 3300025921 Bacteria 738
258 Ga0207646_10865634 3300025922 Bacteria 803
259 Ga0207694_10084517 3300025924 Bacteria 2497
260 Ga0207659_10525398 3300025926 Bacteria 1004
261 Ga0207687_10194370 3300025927 Bacteria 1581
262 Ga0207687_10928467 3300025927 Bacteria 745
263 Ga0207700_10389311 3300025928 Bacteria 1220
264 Ga0207700_10709348 3300025928 Bacteria 898
265 Ga0207700_10955076 3300025928 Bacteria 767
266 Ga0207664_10062017 3300025929 Bacteria 2985
267 Ga0207690_10798124 3300025932 Bacteria 780
268 Ga0207690_11007365 3300025932 Bacteria 693
269 Ga0207706_10137498 3300025933 Bacteria 2149
270 Ga0207706_10451102 3300025933 Bacteria 1112
271 Ga0207706_10607810 3300025933 Bacteria 939
272 Ga0207709_10428045 3300025935 Bacteria 1018
273 Ga0207709_10925253 3300025935 Bacteria 710
274 Ga0207704_10079438 3300025938 Bacteria 2114
275 Ga0207665_10217348 3300025939 Bacteria 1399
276 Ga0207691_10120646 3300025940 Bacteria 2324
277 Ga0207689_10038686 3300025942 Bacteria 3950
278 Ga0207689_10647396 3300025942 Bacteria 890
279 Ga0207689_11683267 3300025942 Bacteria 526
280 Ga0207661_10495770 3300025944 Bacteria 1116
281 Ga0207661_10874156 3300025944 Bacteria 828
282 Ga0207679_10037065 3300025945 Bacteria 3464
283 Ga0207679_10744696 3300025945 Bacteria 891
284 Ga0207667_10327950 3300025949 Bacteria 1563
285 Ga0207667_11368327 3300025949 Bacteria 682
286 Ga0207712_10200344 3300025961 Bacteria 1583
287 Ga0207668_10005217 3300025972 Bacteria 7645
288 Ga0207640_10412402 3300025981 Bacteria 1103
289 Ga0207640_11059694 3300025981 Bacteria 716
290 Ga0207640_11426619 3300025981 Bacteria 621
291 Ga0207658_10352758 3300025986 Bacteria 1281
292 Ga0207677_10178871 3300026023 Bacteria 1667
293 Ga0207703_10482732 3300026035 Bacteria 1161
294 Ga0207639_10091995 3300026041 Bacteria 2430
295 Ga0207639_10278042 3300026041 Bacteria 1471
296 Ga0207639_10337878 3300026041 Bacteria 1342
297 Ga0207639_10450425 3300026041 Bacteria 1168
298 Ga0207639_10459858 3300026041 Bacteria 1157
299 Ga0207678_10036322 3300026067 Bacteria 4289
300 Ga0207678_10115821 3300026067 Bacteria 2287
301 Ga0207678_10410714 3300026067 Bacteria 1173
302 Ga0207678_11145153 3300026067 Bacteria 689
303 Ga0207708_10288168 3300026075 Bacteria 1332
304 Ga0207702_10000257 3300026078 Bacteria 61235
305 Ga0207641_11972386 3300026088 Bacteria 585
306 Ga0207648_11952568 3300026089 Bacteria 548
307 Ga0207676_10118271 3300026095 Bacteria 2230
308 Ga0207676_11484644 3300026095 Bacteria 675
309 Ga0207674_10353601 3300026116 Bacteria 1420
310 Ga0207675_100106684 3300026118 Bacteria 2641
311 Ga0207675_101848503 3300026118 Bacteria 623
312 Ga0207683_10111907 3300026121 Bacteria 2445
313 Ga0207698_10150783 3300026142 Bacteria 2017
314 Ga0207698_10420521 3300026142 Bacteria 1282
315 Ga0209389_1000041 3300027296 Bacteria 123983
316 Ga0209389_1000174 3300027296 Bacteria 51376
317 Ga0209589_1000621 3300027357 Bacteria 51376
318 Ga0209489_100178 3300027361 Bacteria 99953
319 Ga0209489_103497 3300027361 Bacteria 30474
320 Ga0209700_100010 3300027363 Bacteria 395269
321 Ga0209179_1020836 3300027512 Bacteria 1275
322 Ga0209588_1009276 3300027671 Bacteria 2938
323 Ga0209813_10113583 3300027866 Bacteria 936
324 Ga0268266_10276133 3300028379 Bacteria 1561
325 Ga0268266_12004782 3300028379 Bacteria 552
326 Ga0268265_10144459 3300028380 Bacteria 1996
327 Ga0268265_10363768 3300028380 Bacteria 1325
328 Ga0268265_10510358 3300028380 Bacteria 1134
329 Ga0268264_10195718 3300028381 Bacteria 1845
330 Ga0268264_10674749 3300028381 Bacteria 1025
331 Ga0307515_10487685 3300028794 Bacteria 844
332 Ga0265760_10163856 3300031090 Bacteria 735
333 Ga0307513_10913004 3300031456 Bacteria 586
334 Ga0307509_10123782 3300031507 Bacteria 2557
335 Ga0307408_101527434 3300031548 Bacteria 632
336 Ga0307405_10221667 3300031731 Bacteria 1388
337 Ga0316053_103937 3300032120 Bacteria 898
338 Ga0307415_100069125 3300032126 Bacteria 2475
339 Ga0307510_10009854 3300033180 Bacteria 11367
340 Ga0316215_1005557 3300033544 Bacteria 1218
341 Ga0373939_0069361 3300035114 Bacteria 1144
342 Ga0373957_0492956 3300035120 Bacteria 533
343 Ga0373931_0038676 3300035691 Bacteria 2497
344 Ga0373935_0198269 3300035692 Bacteria 1386
345 Ga0373947_0044907 3300035725 Bacteria 2643
346 Ga0373937_0402147 3300036401 Bacteria 1299
347 Ga0373925_0154878 3300037068 Bacteria 1801
348 Ga0395900_0001892 3300037418 Bacteria 23803
349 Ga0395900_0190796 3300037418 Bacteria 2078
350 Ga0395898_0026183 3300037466 Bacteria 5871
351 Ga0395898_0159880 3300037466 Bacteria 2155
352 Ga0395898_0849288 3300037466 Bacteria 852
353 Ga0395898_1112587 3300037466 Bacteria 723
354 Ga0395905_0001630 3300037471 Bacteria 26623
355 Ga0395901_0120829 3300038443 Bacteria 2753
356 Ga0436365_1905570 3300039437 Bacteria 3047
357 Ga0436363_0834682 3300039450 Bacteria 677
358 Ga0439465_0076422 3300041413 Bacteria 1129
359 Ga0451802_0683192 3300041460 Bacteria 829
360 Ga0451807_0351921 3300041486 Bacteria 716
361 Ga0451853_1002524 3300041512 Bacteria 1413
362 Ga0466969_0370416 3300044656 Bacteria 649
363 Ga0466972_0001268 3300044658 Bacteria 12189
364 Ga0466965_0199216 3300044683 Bacteria 1061
365 Ga0466965_0611050 3300044683 Bacteria 620
366 Ga0466966_0001011 3300044684 Bacteria 17949
367 Ga0466961_0000007 3300044693 Bacteria 146374
368 Ga0466964_0033246 3300044706 Bacteria 2054
369 Ga0466964_0075636 3300044706 Bacteria 1434
370 Ga0466964_0371928 3300044706 Bacteria 739
371 Ga0466968_0007838 3300044735 Bacteria 4074
372 Ga0466968_0106386 3300044735 Bacteria 1257
373 Ga0466960_0001066 3300044901 Bacteria 9822
374 Ga0466959_0003081 3300045049 Bacteria 10797
375 Ga0466967_0167646 3300045976 Bacteria 2064
376 Ga0495603_0015673 3300046455 Bacteria 4585
377 Ga0495603_0046680 3300046455 Bacteria 2580
378 Ga0495590_0116129 3300046457 Bacteria 957
379 Ga0495590_0286713 3300046457 Bacteria 617
380 Ga0495580_0104432 3300046472 Bacteria 1969
381 Ga0495639_0146479 3300046475 Bacteria 1137
382 Ga0495594_0189329 3300046499 Bacteria 1172
383 Ga0495583_0222407 3300046506 Bacteria 763
384 Ga0495606_0000903 3300046507 Bacteria 44130
385 Ga0495606_0098832 3300046507 Bacteria 1780
386 Ga0495606_0438613 3300046507 Bacteria 671
387 Ga0495616_0172519 3300046513 Bacteria 966
388 Ga0495631_0145704 3300046518 Bacteria 1016
389 Ga0495643_0183012 3300046522 Bacteria 1017
390 Ga0495648_0018480 3300046524 Bacteria 4931
391 Ga0495665_0482680 3300046531 Bacteria 625
392 Ga0495645_0035102 3300046543 Bacteria 3656
393 Ga0495622_0083403 3300046557 Bacteria 1471
394 Ga0495668_0369511 3300046616 Bacteria 787
395 Ga0495611_0127610 3300046648 Bacteria 1186
396 Ga0495669_0138742 3300046684 Bacteria 1147
397 Ga0495669_0325585 3300046684 Bacteria 742
398 Ga0495624_0121695 3300046690 Bacteria 1602
399 Ga0495600_0573081 3300046809 Bacteria 688
400 Ga0495674_0721546 3300047319 Bacteria 781
401 Ga0495672_0385720 3300047320 Bacteria 643
402 Ga0495676_0165906 3300047321 Bacteria 1558
403 Ga0495683_0421762 3300047323 Bacteria 551
404 Ga0495673_0122400 3300047469 Bacteria 1029
405 Ga0495673_0311469 3300047469 Bacteria 562
406 Ga0496100_0022830 3300048903 Bacteria 3791
407 Ga0496101_0007819 3300048904 Bacteria 6953
408 Ga0496101_0072208 3300048904 Bacteria 2533
409 Ga0496101_1078336 3300048904 Bacteria 631
410 Ga0496102_0013272 3300048905 Bacteria 7132
411 Ga0496102_0255172 3300048905 Bacteria 1653
412 Ga0496102_0541674 3300048905 Bacteria 1087
413 Ga0496102_0551113 3300048905 Bacteria 1076
414 Ga0496102_1092212 3300048905 Bacteria 718
415 Ga0496103_0012417 3300048906 Bacteria 5051
416 Ga0496103_0630811 3300048906 Bacteria 682
417 Ga0496104_0208219 3300048907 Bacteria 1867
418 Ga0496104_0385242 3300048907 Bacteria 1314
419 Ga0496104_0488916 3300048907 Bacteria 1142
420 Ga0496105_0011858 3300048908 Bacteria 6902
421 Ga0496106_0010712 3300048909 Bacteria 6777
422 Ga0496106_0044749 3300048909 Bacteria 3324
423 Ga0496106_0680404 3300048909 Bacteria 821
424 Ga0496107_0022683 3300048910 Bacteria 4437
425 Ga0496107_0153850 3300048910 Bacteria 1702
426 Ga0496107_0431640 3300048910 Bacteria 979
427 Ga0496107_0455890 3300048910 Bacteria 950
428 Ga0496108_0039551 3300048911 Bacteria 3930
429 Ga0496108_0415994 3300048911 Bacteria 1174
430 Ga0496108_0486534 3300048911 Bacteria 1078
431 Ga0496109_0052360 3300048912 Bacteria 3720
432 Ga0496109_0163213 3300048912 Bacteria 2088
433 Ga0496110_0144869 3300048913 Bacteria 2148
434 Ga0496111_0116768 3300048914 Bacteria 1968
435 Ga0496112_0299548 3300048915 Bacteria 1553
436 Ga0496112_0971165 3300048915 Bacteria 770
437 Ga0496113_0168608 3300048916 Bacteria 1733
438 Ga0496113_0297127 3300048916 Bacteria 1293
439 Ga0496114_0008591 3300048917 Bacteria 8096
440 Ga0496115_0029200 3300048918 Bacteria 4329
441 Ga0496115_0081324 3300048918 Bacteria 2639
442 Ga0496115_1367722 3300048918 Bacteria 524
443 Ga0496116_0318010 3300048919 Bacteria 731
444 Ga0496118_0286645 3300048921 Bacteria 913
445 Ga0496118_0376301 3300048921 Bacteria 747
446 Ga0496121_0145841 3300048924 Bacteria 1749
447 Ga0496125_0278129 3300048928 Bacteria 1039
448 Ga0496125_0367789 3300048928 Bacteria 852
449 Ga0496125_0640660 3300048928 Bacteria 574
450 Ga0496126_0087539 3300048929 Bacteria 2744
451 Ga0496126_0397735 3300048929 Bacteria 1118
452 Ga0496126_0726882 3300048929 Bacteria 769
453 Ga0496126_0800533 3300048929 Bacteria 723
454 Ga0501032_0410187 3300049569 Bacteria 870
455 Ga0501036_0640259 3300049572 Bacteria 880
456 Ga0501036_1283023 3300049572 Bacteria 595
457 Ga0501038_0412148 3300049574 Bacteria 1044
458 Ga0501042_0284716 3300049578 Bacteria 1194
459 Ga0501043_0654928 3300049579 Bacteria 771
460 Ga0501067_0188901 3300049583 Bacteria 1147
461 Ga0501069_0132837 3300049585 Bacteria 1426
462 Ga0501070_0008210 3300049586 Bacteria 8831
463 Ga0501071_0310914 3300049587 Bacteria 1196
464 Ga0501072_0015822 3300049588 Bacteria 5784
465 Ga0501076_0790290 3300049592 Bacteria 783
466 Ga0501035_0508473 3300049822 Bacteria 991
467 nmdc:mga00v17_694226_c1 3300050491 Bacteria 653
468 nmdc:mga0yw44_915114_c1 3300050492 Bacteria 595
469 nmdc:mga0k408_233388_c1 3300050493 Bacteria 1098
470 nmdc:mga0k408_424311_c1 3300050493 Bacteria 791
471 nmdc:mga0k408_756855_c1 3300050493 Bacteria 567
472 nmdc:mga06z11_466180_c1 3300050494 Bacteria 764
473 nmdc:mga07m45_231715_c1 3300050496 Bacteria 1075
474 nmdc:mga07m45_246119_c1 3300050496 Bacteria 1040
475 nmdc:mga07m45_314120_c1 3300050496 Bacteria 911
476 nmdc:mga0n895_1819730_c1 3300050512 Bacteria 569
477 nmdc:mga08x19_170930_c1 3300050514 Bacteria 1480
478 nmdc:mga0sz30_60604_c2 3300050516 Bacteria 927
479 Ga0495655_0087117 3300053083 Bacteria 903
480 Ga0500646_0146469 3300053090 Bacteria 779
481 Ga0500646_0369485 3300053090 Bacteria 525
482 Ga0500647_0039506 3300053091 Bacteria 2262
483 Ga0500651_0162221 3300053093 Bacteria 1336
484 Ga0500555_170255 3300053103 Bacteria 529
485 Ga0500557_000042 3300053105 Bacteria 64422
486 Ga0500562_059340 3300053108 Bacteria 1027
487 Ga0500597_154215 3300053120 Bacteria 985
488 Ga0500626_224127 3300053128 Bacteria 722
489 Ga0500642_0000204 3300053130 Bacteria 24152
490 Ga0500658_0185477 3300053134 Bacteria 948
491 Ga0500561_0039688 3300053137 Bacteria 1237
492 Ga0500577_0133337 3300053142 Bacteria 1043
493 Ga0500589_236656 3300053147 Bacteria 678
494 Ga0500590_173791 3300053148 Bacteria 944
495 Ga0500604_0147167 3300053151 Bacteria 798
496 Ga0500616_0000045 3300053153 Bacteria 339292
497 Ga0500622_0257193 3300053156 Bacteria 763
498 Ga0500633_0034272 3300053160 Bacteria 1664
499 Ga0500634_0135924 3300053161 Bacteria 1172
500 Ga0500625_027184 3300053729 Bacteria 2713
501 Ga0500661_060770 3300055283 Bacteria 682
502 Ga0587106_145747 3300059605 Bacteria 523
503 2507509141 2507262055 Bacteria 8048963
504 2508543206 2508501009 Bacteria 7784016
505 2508691049 2508501042 Bacteria 8719808
506 2511394131 2511231028 Bacteria 8046582
507 2513626889 2513237092 Bacteria 8341956
508 2513643715 2513237094 Bacteria 8789602
509 2513646899 2513237095 Bacteria 8976980
510 2513704136 2513237102 Bacteria 7703324
511 2513872304 2513237139 Bacteria 8737671
512 2514014032 2513237161 Bacteria 8871253
513 2515626547 2515154112 Bacteria 8294334
514 2517101765 2517093001 Bacteria 9002274
515 2524436812 2524023205 Bacteria 8918781
516 2617351348 2617270735 Bacteria 9163226
517 2617376239 2617270741 Bacteria 8201522
518 2644288478 2643221651 Bacteria 4798932
519 2745080252 2744054633 Bacteria 8678936
520 2793063831 2791355196 Bacteria 7323613
521 2805918092 2802429603 Bacteria 8777136
522 2818242737 2816332527 Bacteria 8933356
523 2824605051 2824600985 Bacteria 8488197
524 2824613927 2824609381 Bacteria 8672835
525 2824623473 2824617872 Bacteria 8814715
526 2824631378 2824626560 Bacteria 8813858
527 2824639664 2824635225 Bacteria 8785348
528 2824646646 2824644064 Bacteria 8743947
529 2824657086 2824653114 Bacteria 8493680
530 2824679043 2824671348 Bacteria 8369588
531 2824681255 2824679649 Bacteria 8248951
532 2824695645 2824687955 Bacteria 8360029
533 2824701640 2824696289 Bacteria 8335049
534 2824709570 2824704595 Bacteria 9667483
535 2824719668 2824714736 Bacteria 8717648
536 2824726453 2824723954 Bacteria 8758240
537 2824735439 2824732956 Bacteria 7810675
538 2824750043 2824746037 Bacteria 7911610
539 2824760069 2824753945 Bacteria 9787441
540 2824770496 2824763712 Bacteria 9792355
541 2838126294 2838122688 Bacteria 8803140
542 2841943630 2841941048 Bacteria 8688029
543 2841950423 2841949485 Bacteria 8680857
544 2841958216 2841957949 Bacteria 8652217
545 2841966736 2841966195 Bacteria 8673214
546 2841975492 2841974524 Bacteria 8931498
547 2841988368 2841983080 Bacteria 8395090
548 2842039543 2842038055 Bacteria 8002051
549 2842047511 2842045827 Bacteria 8006841
550 2844318587 2844315083 Bacteria 8138177
551 2847935533 2847930680 Bacteria 9342022
552 2847946086 2847939898 Bacteria 8606328
553 2849079796 2849076700 Bacteria 7039503
554 2857513811 2857509624 Bacteria 7472071
555 2874597255 2874590934 Bacteria 8299676
556 2874616290 2874612657 Bacteria 8252029
557 2874626853 2874620515 Bacteria 8290088
558 2874631268 2874628541 Bacteria 8630250
559 2874649412 2874645413 Bacteria 8214782
560 2876770488 2876761206 Bacteria 10111113
561 2876777948 2876771140 Bacteria 8287509
562 2876823031 2876818435 Bacteria 8274608
563 2879078705 2879074833 Bacteria 8279565
564 2879090739 2879083081 Bacteria 8587928
565 2879108218 2879099564 Bacteria 10442239
566 2879132817 2879127579 Bacteria 8294491
567 2879148617 2879142872 Bacteria 8267021
568 2881366900 2881364244 Bacteria 7710352
569 2881666309 2881665667 Bacteria 8175609
570 2885372019 2885366525 Bacteria 8326213
571 2885382115 2885374607 Bacteria 8927485
572 2888383567 2888378607 Bacteria 9652610
573 2888423989 2888419890 Bacteria 7857137
574 2893066399 2893066018 Bacteria 6158120
575 2903730046 2903727486 Bacteria 8281579
576 2903759039 2903748898 Bacteria 9972761
577 2904668431 2904666416 Bacteria 8226587
578 2904717399 2904711408 Bacteria 9771557
579 2906603432 2906602504 Bacteria 8295279
580 2906632173 2906626472 Bacteria 8826946
581 2906644756 2906643746 Bacteria 8722424
582 2908742972 2908739725 Bacteria 8628932
583 2908779637 2908775508 Bacteria 8092255
584 2922395864 2922393267 Bacteria 8285685
585 2929617495 2929615660 Bacteria 9193770
586 2929627200 2929624759 Bacteria 9339455
587 2932787461 2932784394 Bacteria 9704911
588 2932815083 2932809354 Bacteria 9135765
589 2932820720 2932818245 Bacteria 9955613
590 2932831768 2932828146 Bacteria 9745859
591 2933579451 2933577622 Bacteria 9116884
592 2935611976 2935608549 Bacteria 8203142
593 2935649599 2935648319 Bacteria 8801166
594 2935658886 2935656913 Bacteria 8965014
595 2935696020 2935694250 Bacteria 9291695
596 2935763116 2935760218 Bacteria 9817913
597 2935772550 2935769743 Bacteria 7878163
598 2935783102 2935777560 Bacteria 8077691
599 2935793366 2935785616 Bacteria 7962367
600 2935799457 2935793552 Bacteria 8012592
601 2935821456 2935819856 Bacteria 8261050
602 2935850285 2935847175 Bacteria 8228321
603 2935914331 2935908558 Bacteria 8568796
604 2935921045 2935916978 Bacteria 9113783
605 2935931987 2935926038 Bacteria 8601059
606 2935940584 2935934488 Bacteria 8602579
607 2935948527 2935942939 Bacteria 8599779
608 2935957002 2935951376 Bacteria 8602333
609 2935960220 2935959822 Bacteria 7869783
610 2935973600 2935967501 Bacteria 8603075
611 2935977450 2935975950 Bacteria 8347125
612 2935989947 2935984226 Bacteria 8302647
613 2936012919 2936011229 Bacteria 8801034
614 2936021483 2936019824 Bacteria 8804134
615 2936030212 2936028420 Bacteria 8965941
616 2936047677 2936046547 Bacteria 8903709
617 2936057165 2936055302 Bacteria 8785755
618 2941534341 2941531003 Bacteria 7653939
619 3005489670 3005483717 Bacteria 7877331
620 3005509889 3005506211 Bacteria 6943378
621 3005589999 3005587118 Bacteria 7794411
622 3005598708 3005594810 Bacteria 8716512
623 3005714361 3005710791 Bacteria 7622528
624 3005721868 3005718088 Bacteria 8283608
625 8016513901 8016511872 Bacteria 9921665
626 8016530149 8016522445 Bacteria 8156687
627 8016535396 8016530956 Bacteria 8155261
628 8016548599 8016539877 Bacteria 8155419
629 8016553530 8016548790 Bacteria 8155074
630 8016561913 8016557553 Bacteria 8154380
631 8016573730 8016566248 Bacteria 8158151
632 8016577855 8016575299 Bacteria 8154085
633 8016592499 8016583857 Bacteria 10421953
634 8016599740 8016595262 Bacteria 8149947
635 8016611101 8016603502 Bacteria 8731218
636 8016622533 8016613128 Bacteria 8794220
637 8016627255 8016622563 Bacteria 7999408
638 8016631543 8016630954 Bacteria 9217207
639 8017062574 8017057580 Bacteria 10023680
640 8019535138 8019530166 Bacteria 8155624
641 8019544347 8019538911 Bacteria 7872763
642 8019554355 8019547302 Bacteria 7996444
643 8019627571 8019619141 Bacteria 9218857
644 8019635004 8019629233 Bacteria 8687553
645 8019644723 8019638758 Bacteria 9062356
646 8019657766 8019648815 Bacteria 10014479
647 8019662837 8019659431 Bacteria 8577854
648 8019672446 8019668869 Bacteria 8791617
649 8019683711 8019678201 Bacteria 8863603
650 8055746890 8055742211 Bacteria 9226248
651 8056972956 8056967851 Bacteria 9038162
652 Ga0070713_101152894
653 JGI25153J46596_10003349
654 JGI25153J46596_10127219
655 JGI25404J52841_10027385
656 Ga0055526_1094512
657 Ga0055524_1076530
658 Ga0055531_10008136
659 Ga0065165_1009218
660 Ga0065704_10164822
661 Ga0065707_10172441
662 Ga0070658_10641289
663 Ga0070658_10769022
664 Ga0070683_100835537
665 Ga0068869_100107903
666 Ga0068869_100186544
667 Ga0068869_101125618
668 Ga0070666_10414728
669 Ga0070680_100225526
670 Ga0068868_100007491
671 Ga0068868_100286531
672 Ga0068868_102007777
673 Ga0070660_100408676
674 Ga0070660_100452694
675 Ga0070660_101958178
676 Ga0070689_100773735
677 Ga0070691_10529908
678 Ga0070661_100296309
679 Ga0070668_100075587
680 Ga0070668_100229951
681 Ga0070669_100183667
682 Ga0070669_100434357
683 Ga0070675_100540561
684 Ga0070671_100472535
685 Ga0070671_100561591
686 Ga0070674_100994441
687 Ga0070659_100089178
688 Ga0070659_100560695
689 Ga0070667_100422734
690 Ga0070667_100836448
691 Ga0070703_10241343
692 Ga0070709_10024785
693 Ga0070709_10111598
694 Ga0070714_100071314
695 Ga0070714_100232488
696 Ga0070713_100041301
697 Ga0070713_100063065
698 Ga0070710_10013018
699 Ga0070710_10680304
700 Ga0070701_10728308
701 Ga0070711_100038266
702 Ga0070711_101182964
703 Ga0070711_101713523
704 Ga0070705_100634708
705 Ga0070700_100324972
706 Ga0070694_100387979
707 Ga0070708_100119235
708 Ga0070663_100097375
709 Ga0070663_100369047
710 Ga0070663_100707819
711 Ga0070663_101185173
712 Ga0070678_100152619
713 Ga0070662_100020359
714 Ga0070662_100244683
715 Ga0070662_101093444
716 Ga0070681_10186465
717 Ga0070681_10482358
718 Ga0068867_101124891
719 Ga0070707_100324614
720 Ga0070698_100969567
721 Ga0070699_100051348
722 Ga0070679_100135353
723 Ga0070679_100142902
724 Ga0070679_100733144
725 Ga0070684_100371349
726 Ga0070684_100741109
727 Ga0070697_100131947
728 Ga0070697_100525854
729 Ga0068853_100042919
730 Ga0068853_100057653
731 Ga0068853_100556588
732 Ga0068853_100788104
733 Ga0070672_100335921
734 Ga0070696_101428093
735 Ga0070693_100219953
736 Ga0070665_100284752
737 Ga0070665_100514235
738 Ga0070704_101887342
739 Ga0070664_100309663
740 Ga0070664_100839693
741 Ga0068857_100446418
742 Ga0068857_101883758
743 Ga0068854_100682796
744 Ga0068854_100719955
745 Ga0068854_100917460
746 Ga0068856_100000919
747 Ga0068856_100191221
748 Ga0068856_102030974
749 Ga0070702_100284891
750 Ga0070702_101541991
751 Ga0068852_100602987
752 Ga0068864_100235160
753 Ga0068861_100065931
754 Ga0068861_101502647
755 Ga0068851_10535959
756 Ga0068863_101599884
757 Ga0068858_100725208
758 Ga0068860_100340556
759 Ga0068860_101041739
760 Ga0068860_102315113
761 Ga0068862_100268904
762 Ga0081538_10134916
763 Ga0081538_10209372
764 Ga0081540_1010647
765 Ga0081540_1010931
766 Ga0081540_1044061
767 Ga0081540_1135599
768 Ga0081540_1250047
769 Ga0081539_10000737
770 Ga0070717_10005326
771 Ga0070717_10131332
772 Ga0070717_10796621
773 Ga0075368_10104260
774 Ga0075363_100443780
775 Ga0075364_10264313
776 Ga0070715_10248438
777 Ga0070716_100175925
778 Ga0070716_100502076
779 Ga0070716_101550679
780 Ga0070712_100030785
781 Ga0070712_100220946
782 Ga0070712_101802902
783 Ga0075362_10398552
784 Ga0075367_10085949
785 Ga0075367_10329366
786 Ga0075369_10038900
787 Ga0075369_10120885
788 Ga0075369_10488583
789 Ga0075366_10046896
790 Ga0075366_10468673
791 Ga0075366_10548546
792 Ga0075366_10747966
793 Ga0075370_10018364
794 Ga0075370_10080748
795 Ga0075370_10128181
796 Ga0075370_10211987
797 Ga0075370_10612664
798 Ga0068871_100029699
799 Ga0068871_101419925
800 Ga0075428_102066526
801 Ga0075434_100011702
802 Ga0068865_100058758
803 Ga0099825_1058887
804 Ga0099824_1014235
805 Ga0099822_1079452
806 Ga0099823_1068020
807 Ga0075435_101956973
808 Ga0099795_10024953
809 Ga0099795_10049021
810 Ga0099795_10177983
811 Ga0105251_10344174
812 Ga0105240_10016366
813 Ga0105240_10657793
814 Ga0105245_10092768
815 Ga0105245_11059064
816 Ga0105245_11941884
817 Ga0105248_11705841
818 Ga0105237_10005222
819 Ga0105237_11406417
820 Ga0105238_10080231
821 Ga0105238_11455399
822 Ga0105238_11882604
823 Ga0105249_10544573
824 Ga0099796_10093561
825 Ga0105239_10026158
826 Ga0105239_10254931
827 Ga0105239_10861808
828 Ga0105239_10959988
829 Ga0105239_11269762
830 Ga0105246_10029536
831 Ga0105246_10855949
832 Ga0105246_12060005
833 Ga0157316_1075514
834 Ga0157373_10203000
835 Ga0157371_10046637
836 Ga0157370_11150482
837 Ga0157374_10118140
838 Ga0157374_10526235
839 Ga0157378_10301070
840 Ga0163162_10018448
841 Ga0163162_10510206
842 Ga0163162_12705652
843 Ga0157372_10025324
844 Ga0157372_11696584
845 Ga0157375_10032821
846 Ga0157375_12285882
847 Ga0163163_10073315
848 Ga0163163_10744488
849 Ga0163163_12327935
850 Ga0157377_10042226
851 Ga0157377_10583573
852 Ga0157379_10192607
853 Ga0157379_10548407
854 Ga0157379_10635162
855 Ga0157376_10024069
856 Ga0157376_10252600
857 Ga0163161_10420182
858 Ga0184596_110157
859 Ga0184596_123107
860 Ga0206356_11416121
861 Ga0154015_1057556
862 Ga0214544_1000051
863 Ga0214544_1054321
864 Ga0214542_1005406
865 Ga0214545_1000126
866 Ga0214543_1003794
867 Ga0224712_10633348
868 Ga0207425_1075197
869 Ga0209233_1034384
870 Ga0209455_1005472
871 Ga0209564_1011017
872 Ga0209758_1000021
873 Ga0209758_1001783
874 Ga0209758_1020076
875 Ga0209256_1009096
876 Ga0207426_1068044
877 Ga0207426_1111988
878 Ga0209051_1030434
879 Ga0209257_1001917
880 Ga0209257_1093322
881 Ga0207696_1116105
882 Ga0207642_11017697
883 Ga0207688_10203395
884 Ga0207647_10094039
885 Ga0207685_10414894
886 Ga0207699_10019941
887 Ga0207699_10051413
888 Ga0207699_10303315
889 Ga0207643_10592827
890 Ga0207705_10566332
891 Ga0207684_10771097
892 Ga0207707_10286868
893 Ga0207695_10000015
894 Ga0207671_10004241
895 Ga0207671_10329379
896 Ga0207693_10086011
897 Ga0207693_10120591
898 Ga0207663_10069296
899 Ga0207663_10473657
900 Ga0207663_10762504
901 Ga0207660_10206202
902 Ga0207662_10393858
903 Ga0207657_10011925
904 Ga0207657_10315125
905 Ga0207649_10194362
906 Ga0207652_10285617
907 Ga0207652_10404761
908 Ga0207652_10992318
909 Ga0207646_10865634
910 Ga0207694_10084517
911 Ga0207659_10525398
912 Ga0207687_10194370
913 Ga0207687_10928467
914 Ga0207700_10389311
915 Ga0207700_10709348
916 Ga0207700_10955076
917 Ga0207664_10062017
918 Ga0207690_10798124
919 Ga0207690_11007365
920 Ga0207706_10137498
921 Ga0207706_10451102
922 Ga0207706_10607810
923 Ga0207709_10428045
924 Ga0207709_10925253
925 Ga0207704_10079438
926 Ga0207665_10217348
927 Ga0207691_10120646
928 Ga0207689_10038686
929 Ga0207689_10647396
930 Ga0207689_11683267
931 Ga0207661_10495770
932 Ga0207661_10874156
933 Ga0207679_10037065
934 Ga0207679_10744696
935 Ga0207667_10327950
936 Ga0207667_11368327
937 Ga0207712_10200344
938 Ga0207668_10005217
939 Ga0207640_10412402
940 Ga0207640_11059694
941 Ga0207640_11426619
942 Ga0207658_10352758
943 Ga0207677_10178871
944 Ga0207703_10482732
945 Ga0207639_10091995
946 Ga0207639_10278042
947 Ga0207639_10337878
948 Ga0207639_10450425
949 Ga0207639_10459858
950 Ga0207678_10036322
951 Ga0207678_10115821
952 Ga0207678_10410714
953 Ga0207678_11145153
954 Ga0207708_10288168
955 Ga0207702_10000257
956 Ga0207641_11972386
957 Ga0207648_11952568
958 Ga0207676_10118271
959 Ga0207676_11484644
960 Ga0207674_10353601
961 Ga0207675_100106684
962 Ga0207675_101848503
963 Ga0207683_10111907
964 Ga0207698_10150783
965 Ga0207698_10420521
966 Ga0209389_1000041
967 Ga0209389_1000174
968 Ga0209589_1000621
969 Ga0209489_100178
970 Ga0209489_103497
971 Ga0209700_100010
972 Ga0209179_1020836
973 Ga0209588_1009276
974 Ga0209813_10113583
975 Ga0268266_10276133
976 Ga0268266_12004782
977 Ga0268265_10144459
978 Ga0268265_10363768
979 Ga0268265_10510358
980 Ga0268264_10195718
981 Ga0268264_10674749
982 Ga0307515_10487685
983 Ga0265760_10163856
984 Ga0307513_10913004
985 Ga0307509_10123782
986 Ga0307408_101527434
987 Ga0307405_10221667
988 Ga0316053_103937
989 Ga0307415_100069125
990 Ga0307510_10009854
991 Ga0316215_1005557
992 Ga0373939_0069361
993 Ga0373957_0492956
994 Ga0373931_0038676
995 Ga0373935_0198269
996 Ga0373947_0044907
997 Ga0373937_0402147
998 Ga0373925_0154878
999 Ga0395900_0001892
1000 Ga0395900_0190796
1001 Ga0395898_0026183
1002 Ga0395898_0159880
1003 Ga0395898_0849288
1004 Ga0395898_1112587
1005 Ga0395905_0001630
1006 Ga0395901_0120829
1007 Ga0436365_1905570
1008 Ga0436363_0834682
1009 Ga0439465_0076422
1010 Ga0451802_0683192
1011 Ga0451807_0351921
1012 Ga0451853_1002524
1013 Ga0466969_0370416
1014 Ga0466972_0001268
1015 Ga0466965_0199216
1016 Ga0466965_0611050
1017 Ga0466966_0001011
1018 Ga0466961_0000007
1019 Ga0466964_0033246
1020 Ga0466964_0075636
1021 Ga0466964_0371928
1022 Ga0466968_0007838
1023 Ga0466968_0106386
1024 Ga0466960_0001066
1025 Ga0466959_0003081
1026 Ga0466967_0167646
1027 Ga0495603_0015673
1028 Ga0495603_0046680
1029 Ga0495590_0116129
1030 Ga0495590_0286713
1031 Ga0495580_0104432
1032 Ga0495639_0146479
1033 Ga0495594_0189329
1034 Ga0495583_0222407
1035 Ga0495606_0000903
1036 Ga0495606_0098832
1037 Ga0495606_0438613
1038 Ga0495616_0172519
1039 Ga0495631_0145704
1040 Ga0495643_0183012
1041 Ga0495648_0018480
1042 Ga0495665_0482680
1043 Ga0495645_0035102
1044 Ga0495622_0083403
1045 Ga0495668_0369511
1046 Ga0495611_0127610
1047 Ga0495669_0138742
1048 Ga0495669_0325585
1049 Ga0495624_0121695
1050 Ga0495600_0573081
1051 Ga0495674_0721546
1052 Ga0495672_0385720
1053 Ga0495676_0165906
1054 Ga0495683_0421762
1055 Ga0495673_0122400
1056 Ga0495673_0311469
1057 Ga0496100_0022830
1058 Ga0496101_0007819
1059 Ga0496101_0072208
1060 Ga0496101_1078336
1061 Ga0496102_0013272
1062 Ga0496102_0255172
1063 Ga0496102_0541674
1064 Ga0496102_0551113
1065 Ga0496102_1092212
1066 Ga0496103_0012417
1067 Ga0496103_0630811
1068 Ga0496104_0208219
1069 Ga0496104_0385242
1070 Ga0496104_0488916
1071 Ga0496105_0011858
1072 Ga0496106_0010712
1073 Ga0496106_0044749
1074 Ga0496106_0680404
1075 Ga0496107_0022683
1076 Ga0496107_0153850
1077 Ga0496107_0431640
1078 Ga0496107_0455890
1079 Ga0496108_0039551
1080 Ga0496108_0415994
1081 Ga0496108_0486534
1082 Ga0496109_0052360
1083 Ga0496109_0163213
1084 Ga0496110_0144869
1085 Ga0496111_0116768
1086 Ga0496112_0299548
1087 Ga0496112_0971165
1088 Ga0496113_0168608
1089 Ga0496113_0297127
1090 Ga0496114_0008591
1091 Ga0496115_0029200
1092 Ga0496115_0081324
1093 Ga0496115_1367722
1094 Ga0496116_0318010
1095 Ga0496118_0286645
1096 Ga0496118_0376301
1097 Ga0496121_0145841
1098 Ga0496125_0278129
1099 Ga0496125_0367789
1100 Ga0496125_0640660
1101 Ga0496126_0087539
1102 Ga0496126_0397735
1103 Ga0496126_0726882
1104 Ga0496126_0800533
1105 Ga0501032_0410187
1106 Ga0501036_0640259
1107 Ga0501036_1283023
1108 Ga0501038_0412148
1109 Ga0501042_0284716
1110 Ga0501043_0654928
1111 Ga0501067_0188901
1112 Ga0501069_0132837
1113 Ga0501070_0008210
1114 Ga0501071_0310914
1115 Ga0501072_0015822
1116 Ga0501076_0790290
1117 Ga0501035_0508473
1118 nmdc:mga00v17_694226_c1
1119 nmdc:mga0yw44_915114_c1
1120 nmdc:mga0k408_233388_c1
1121 nmdc:mga0k408_424311_c1
1122 nmdc:mga0k408_756855_c1
1123 nmdc:mga06z11_466180_c1
1124 nmdc:mga07m45_231715_c1
1125 nmdc:mga07m45_246119_c1
1126 nmdc:mga07m45_314120_c1
1127 nmdc:mga0n895_1819730_c1
1128 nmdc:mga08x19_170930_c1
1129 nmdc:mga0sz30_60604_c2
1130 Ga0495655_0087117
1131 Ga0500646_0146469
1132 Ga0500646_0369485
1133 Ga0500647_0039506
1134 Ga0500651_0162221
1135 Ga0500555_170255
1136 Ga0500557_000042
1137 Ga0500562_059340
1138 Ga0500597_154215
1139 Ga0500626_224127
1140 Ga0500642_0000204
1141 Ga0500658_0185477
1142 Ga0500561_0039688
1143 Ga0500577_0133337
1144 Ga0500589_236656
1145 Ga0500590_173791
1146 Ga0500604_0147167
1147 Ga0500616_0000045
1148 Ga0500622_0257193
1149 Ga0500633_0034272
1150 Ga0500634_0135924
1151 Ga0500625_027184
1152 Ga0500661_060770
1153 Ga0587106_145747
1154 2507509141
1155 2508543206
1156 2508691049
1157 2511394131
1158 2513626889
1159 2513643715
1160 2513646899
1161 2513704136
1162 2513872304
1163 2514014032
1164 2515626547
1165 2517101765
1166 2524436812
1167 2617351348
1168 2617376239
1169 2644288478
1170 2745080252
1171 2793063831
1172 2805918092
1173 2818242737
1174 2824605051
1175 2824613927
1176 2824623473
1177 2824631378
1178 2824639664
1179 2824646646
1180 2824657086
1181 2824679043
1182 2824681255
1183 2824695645
1184 2824701640
1185 2824709570
1186 2824719668
1187 2824726453
1188 2824735439
1189 2824750043
1190 2824760069
1191 2824770496
1192 2838126294
1193 2841943630
1194 2841950423
1195 2841958216
1196 2841966736
1197 2841975492
1198 2841988368
1199 2842039543
1200 2842047511
1201 2844318587
1202 2847935533
1203 2847946086
1204 2849079796
1205 2857513811
1206 2874597255
1207 2874616290
1208 2874626853
1209 2874631268
1210 2874649412
1211 2876770488
1212 2876777948
1213 2876823031
1214 2879078705
1215 2879090739
1216 2879108218
1217 2879132817
1218 2879148617
1219 2881366900
1220 2881666309
1221 2885372019
1222 2885382115
1223 2888383567
1224 2888423989
1225 2893066399
1226 2903730046
1227 2903759039
1228 2904668431
1229 2904717399
1230 2906603432
1231 2906632173
1232 2906644756
1233 2908742972
1234 2908779637
1235 2922395864
1236 2929617495
1237 2929627200
1238 2932787461
1239 2932815083
1240 2932820720
1241 2932831768
1242 2933579451
1243 2935611976
1244 2935649599
1245 2935658886
1246 2935696020
1247 2935763116
1248 2935772550
1249 2935783102
1250 2935793366
1251 2935799457
1252 2935821456
1253 2935850285
1254 2935914331
1255 2935921045
1256 2935931987
1257 2935940584
1258 2935948527
1259 2935957002
1260 2935960220
1261 2935973600
1262 2935977450
1263 2935989947
1264 2936012919
1265 2936021483
1266 2936030212
1267 2936047677
1268 2936057165
1269 2941534341
1270 3005489670
1271 3005509889
1272 3005589999
1273 3005598708
1274 3005714361
1275 3005721868
1276 8016513901
1277 8016530149
1278 8016535396
1279 8016548599
1280 8016553530
1281 8016561913
1282 8016573730
1283 8016577855
1284 8016592499
1285 8016599740
1286 8016611101
1287 8016622533
1288 8016627255
1289 8016631543
1290 8017062574
1291 8019535138
1292 8019544347
1293 8019554355
1294 8019627571
1295 8019635004
1296 8019644723
1297 8019657766
1298 8019662837
1299 8019672446
1300 8019683711
1301 8055746890
1302 8056972956

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vpe-assembly1.cif.gz_A falcilysin in complex with a1 0.8684 32 62
7dij-assembly1.cif.gz_A falcilysin in complex with mk-4815 0.8657 32 62
5fkt-assembly1.cif.gz_A unraveling the first step of xyloglucan degradation by the soil saprophyte cellvibrio japonicus through the functional and structural characterization of a potent gh74 endo-xyloglucanase 0.8456 30 51
5fkq-assembly2.cif.gz_B unraveling the first step of xyloglucan degradation by the soil saprophyte cellvibrio japonicus through the functional and structural characterization of a potent gh74 endo-xyloglucanase 0.8423 30 51
2p25-assembly1.cif.gz_A-2 the crystal structure of the glyoxalase family protein from enterococcus faecalis 0.8402 32 66
ID Description Score Start End Superfamily
af_Q4DU56_19_275_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.8642 32 62 3.30.830.10
4eipB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8465 32 64 3.50.50.60
af_B8JJX2_81_394_2.130.10.120 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Prolyl oligopeptidase, N-terminal domain 0.8449 31 67 2.130.10.120
af_D3ZYU1_95_563_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8428 31 66 2.130.10.10
af_F1RAC4_229_469_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8424 30 51 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A3M1GKQ7-F1-model_v4 Uncharacterized protein 0.9455 22 66
AF-A0A3Q9GMS1-F1-model_v4 Uncharacterized protein 0.9402 31 67
AF-A0A497F604-F1-model_v4 C2H2-type domain-containing protein 0.9271 22 62
AF-A0A2E0KVF0-F1-model_v4 Uncharacterized protein 0.9227 23 64
AF-A0A059G8R6-F1-model_v4 Uncharacterized protein 0.9222 32 67

Map