F472392
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 648 | 377 | 607 | 292 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0438419|Ga0451577_0438419_207_1154 |
| Length | 315 |
| Sequence | MSNDTRTLDAATLAHLQSWVGQTETVSDVITAAPVRALGATLDRDDALPVTGTPLAPLWHWLYFLPQHRQSEIGPDGHARRGGFLPPVPLPRRMWAGGRLQWRSDNPLRVGDAVQRSSRIASVTHKAGRSGDLLFVLVQHEVHNAQGLALTEAHDIVYRAAAQAPTLGTGVSSLPPEGALASRGGPSMLAQPGDPVPSPIAAEAGAPWQREIVPDAVLLFRYSALTFNGHRIHYDRQYVTEVEGYPGLIVHGPLIATLLVDLVRRHAPDAFIQSFNFKALRPTFDLHPFRLNGQPSADGKRVRLWAQDHEGWLTM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 3 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 4 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 5 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 6 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 7 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 8 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 9 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 10 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 11 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 12 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 13 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 14 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 15 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 16 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 17 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 18 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 19 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 20 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 21 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 22 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 23 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 24 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 25 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 26 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 27 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 28 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 29 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 30 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 31 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 32 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 33 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 34 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 35 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 36 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 37 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 38 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 39 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 40 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 41 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 42 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 43 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 44 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 45 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 46 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 47 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 48 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 49 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 50 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 51 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 52 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 53 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 54 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 55 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 56 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 57 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 58 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 59 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 61 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 62 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 63 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 64 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 65 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 66 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 72 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 75 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 94 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 97 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 98 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 100 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 102 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 107 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 109 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 110 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 111 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 113 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 114 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 115 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 116 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 117 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 118 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 119 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 120 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 121 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 122 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 123 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 124 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 125 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 126 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 127 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 128 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 130 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 131 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 132 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 133 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 134 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 136 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 160 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 164 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 165 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 167 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 236 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 237 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 238 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 239 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 240 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 241 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 243 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 244 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 245 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 246 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 247 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 249 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 252 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 253 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 254 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 255 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 256 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 257 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 258 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 259 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 260 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 261 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 262 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 263 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 264 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 265 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 266 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 267 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 268 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 269 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 270 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 271 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 272 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 273 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 274 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 275 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 276 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 277 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 278 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 279 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 280 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 281 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 282 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 283 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 284 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 285 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 317 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 318 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 320 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 321 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 322 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 323 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 324 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 325 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 326 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 327 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 328 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 329 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 330 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 344 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 349 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 350 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 351 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 352 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 353 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 354 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 355 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 359 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 360 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 361 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 362 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 363 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 364 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 365 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 366 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 367 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 368 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 369 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 372 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 373 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 374 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 375 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 376 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.52 |
| Metatranscriptomes | 0.15 |
| Isolates | 6.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.23 |
| Nodule | 0.31 |
| Rhizoplane | 1.39 |
| Rhizosphere | 66.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24745J21846_1000195 | 3300002073 | Bacteria | 4920 |
| 2 | JGI25158J39367_1007490 | 3300002739 | Bacteria | 1538 |
| 3 | JGI25150J39212_1001112 | 3300002774 | Bacteria | 8094 |
| 4 | JGI25159J45721_1001424 | 3300002987 | Bacteria | 9921 |
| 5 | JGI25151J46595_10002864 | 3300003187 | Bacteria | 9918 |
| 6 | JGI25151J46595_10003442 | 3300003187 | Bacteria | 8753 |
| 7 | JGI25153J46596_10000620 | 3300003215 | Bacteria | 21703 |
| 8 | JGI25153J46596_10003509 | 3300003215 | Bacteria | 8753 |
| 9 | JGI25153J46596_10024776 | 3300003215 | Bacteria | 2156 |
| 10 | JGI25160J50197_1001928 | 3300003354 | Bacteria | 9921 |
| 11 | JGI25161J50226_1001375 | 3300003374 | Bacteria | 7410 |
| 12 | JGI25161J50226_1002423 | 3300003374 | Bacteria | 4790 |
| 13 | Ga0006562J51391_1083753 | 3300003578 | Bacteria | 2160 |
| 14 | Ga0055527_1004559 | 3300003760 | Bacteria | 1890 |
| 15 | Ga0055535_1001422 | 3300003761 | Bacteria | 12268 |
| 16 | Ga0055542_1000109 | 3300003762 | Bacteria | 111107 |
| 17 | Ga0055526_1005481 | 3300003771 | Bacteria | 7282 |
| 18 | Ga0055526_1005616 | 3300003771 | Bacteria | 7142 |
| 19 | Ga0055537_1000195 | 3300003773 | Bacteria | 45368 |
| 20 | Ga0055537_1001992 | 3300003773 | Bacteria | 7282 |
| 21 | Ga0055524_1003731 | 3300003775 | Bacteria | 7282 |
| 22 | Ga0055524_1009153 | 3300003775 | Bacteria | 4052 |
| 23 | Ga0055536_1002896 | 3300003781 | Bacteria | 9426 |
| 24 | Ga0055536_1003710 | 3300003781 | Bacteria | 8101 |
| 25 | Ga0055536_1008623 | 3300003781 | Bacteria | 4348 |
| 26 | Ga0055534_1000285 | 3300003784 | Bacteria | 34241 |
| 27 | Ga0055534_1001560 | 3300003784 | Bacteria | 8929 |
| 28 | Ga0055528_1002453 | 3300003790 | Bacteria | 9921 |
| 29 | Ga0055528_1002896 | 3300003790 | Bacteria | 8921 |
| 30 | Ga0055530_10000495 | 3300003791 | Bacteria | 34154 |
| 31 | Ga0055530_10005626 | 3300003791 | Bacteria | 5873 |
| 32 | Ga0055540_1002205 | 3300003792 | Bacteria | 10582 |
| 33 | Ga0055540_1003089 | 3300003792 | Bacteria | 8278 |
| 34 | Ga0055540_1004833 | 3300003792 | Bacteria | 5915 |
| 35 | Ga0055540_1005512 | 3300003792 | Bacteria | 5294 |
| 36 | Ga0055531_10002052 | 3300003794 | Bacteria | 13898 |
| 37 | Ga0055531_10002338 | 3300003794 | Bacteria | 12771 |
| 38 | Ga0055531_10003743 | 3300003794 | Bacteria | 9554 |
| 39 | Ga0055543_1001345 | 3300004625 | Bacteria | 9959 |
| 40 | Ga0055543_1015707 | 3300004625 | Bacteria | 1452 |
| 41 | Ga0065165_1003856 | 3300005262 | Bacteria | 9959 |
| 42 | Ga0065165_1030924 | 3300005262 | Bacteria | 1698 |
| 43 | Ga0065714_10007224 | 3300005288 | Bacteria | 4179 |
| 44 | Ga0065715_10120017 | 3300005293 | Bacteria | 2270 |
| 45 | Ga0070658_10007478 | 3300005327 | Bacteria | 8814 |
| 46 | Ga0070676_10214323 | 3300005328 | Bacteria | 1269 |
| 47 | Ga0070676_10251039 | 3300005328 | Bacteria | 1180 |
| 48 | Ga0070683_100026879 | 3300005329 | Bacteria | 5187 |
| 49 | Ga0070683_100302770 | 3300005329 | Bacteria | 1521 |
| 50 | Ga0070670_100027478 | 3300005331 | Bacteria | 4894 |
| 51 | Ga0070677_10001855 | 3300005333 | Bacteria | 6681 |
| 52 | Ga0070677_10009884 | 3300005333 | Bacteria | 3249 |
| 53 | Ga0068869_100022542 | 3300005334 | Bacteria | 4340 |
| 54 | Ga0070666_10056480 | 3300005335 | Bacteria | 2651 |
| 55 | Ga0070682_100205776 | 3300005337 | Bacteria | 1391 |
| 56 | Ga0068868_100065308 | 3300005338 | Bacteria | 2891 |
| 57 | Ga0068868_100280567 | 3300005338 | Bacteria | 1410 |
| 58 | Ga0070691_10071370 | 3300005341 | Bacteria | 1686 |
| 59 | Ga0070687_100007469 | 3300005343 | Bacteria | 4559 |
| 60 | Ga0070661_100070055 | 3300005344 | Bacteria | 2579 |
| 61 | Ga0070661_100371929 | 3300005344 | Bacteria | 1125 |
| 62 | Ga0070692_10077287 | 3300005345 | Bacteria | 1786 |
| 63 | Ga0070668_100021390 | 3300005347 | Bacteria | 4886 |
| 64 | Ga0070668_100068787 | 3300005347 | Bacteria | 2753 |
| 65 | Ga0070669_100002821 | 3300005353 | Bacteria | 12552 |
| 66 | Ga0070675_100003763 | 3300005354 | Bacteria | 11518 |
| 67 | Ga0070675_100085483 | 3300005354 | Bacteria | 2636 |
| 68 | Ga0070671_100022052 | 3300005355 | Bacteria | 5202 |
| 69 | Ga0070674_100010570 | 3300005356 | Bacteria | 5585 |
| 70 | Ga0070674_100016462 | 3300005356 | Bacteria | 4635 |
| 71 | Ga0070674_100023029 | 3300005356 | Bacteria | 4024 |
| 72 | Ga0070674_100140718 | 3300005356 | Bacteria | 1810 |
| 73 | Ga0070673_100234349 | 3300005364 | Bacteria | 1593 |
| 74 | Ga0070659_100085977 | 3300005366 | Bacteria | 2516 |
| 75 | Ga0070667_100021693 | 3300005367 | Bacteria | 5329 |
| 76 | Ga0070667_100024167 | 3300005367 | Bacteria | 5047 |
| 77 | Ga0070667_100224437 | 3300005367 | Bacteria | 1673 |
| 78 | Ga0070667_100320199 | 3300005367 | Bacteria | 1399 |
| 79 | Ga0070667_100556290 | 3300005367 | Bacteria | 1055 |
| 80 | Ga0070714_100076498 | 3300005435 | Bacteria | 2906 |
| 81 | Ga0070713_100000140 | 3300005436 | Bacteria | 47882 |
| 82 | Ga0070700_100034382 | 3300005441 | Bacteria | 3061 |
| 83 | Ga0070663_100028606 | 3300005455 | Bacteria | 3797 |
| 84 | Ga0070678_100008716 | 3300005456 | Bacteria | 6091 |
| 85 | Ga0070678_100031542 | 3300005456 | Bacteria | 3658 |
| 86 | Ga0070678_100070954 | 3300005456 | Bacteria | 2606 |
| 87 | Ga0070678_100278919 | 3300005456 | Bacteria | 1412 |
| 88 | Ga0070662_100033873 | 3300005457 | Bacteria | 3599 |
| 89 | Ga0070662_100049967 | 3300005457 | Bacteria | 3016 |
| 90 | Ga0070662_100224053 | 3300005457 | Bacteria | 1502 |
| 91 | Ga0070662_100252724 | 3300005457 | Bacteria | 1418 |
| 92 | Ga0068867_100000447 | 3300005459 | Bacteria | 27402 |
| 93 | Ga0068867_100018445 | 3300005459 | Bacteria | 4960 |
| 94 | Ga0068867_100060005 | 3300005459 | Bacteria | 2820 |
| 95 | Ga0068867_100213875 | 3300005459 | Bacteria | 1550 |
| 96 | Ga0070685_10005666 | 3300005466 | Bacteria | 6338 |
| 97 | Ga0070685_10065935 | 3300005466 | Bacteria | 2132 |
| 98 | Ga0070698_100086842 | 3300005471 | Bacteria | 3114 |
| 99 | Ga0070698_100293278 | 3300005471 | Bacteria | 1557 |
| 100 | Ga0070679_100124053 | 3300005530 | Bacteria | 2566 |
| 101 | Ga0070679_100125205 | 3300005530 | Bacteria | 2552 |
| 102 | Ga0070684_100113405 | 3300005535 | Bacteria | 2433 |
| 103 | Ga0070697_100036413 | 3300005536 | Bacteria | 3975 |
| 104 | Ga0068853_100013928 | 3300005539 | Bacteria | 6577 |
| 105 | Ga0068853_100117921 | 3300005539 | Bacteria | 2365 |
| 106 | Ga0068853_100453151 | 3300005539 | Bacteria | 1207 |
| 107 | Ga0070672_100011724 | 3300005543 | Bacteria | 6123 |
| 108 | Ga0070672_100251457 | 3300005543 | Bacteria | 1489 |
| 109 | Ga0070686_100053105 | 3300005544 | Bacteria | 2586 |
| 110 | Ga0070695_100031388 | 3300005545 | Bacteria | 3314 |
| 111 | Ga0070696_100490378 | 3300005546 | Bacteria | 976 |
| 112 | Ga0070665_100011810 | 3300005548 | Bacteria | 8820 |
| 113 | Ga0070665_100051370 | 3300005548 | Bacteria | 4134 |
| 114 | Ga0070665_100306480 | 3300005548 | Bacteria | 1591 |
| 115 | Ga0070665_100552469 | 3300005548 | Bacteria | 1164 |
| 116 | Ga0070704_100003685 | 3300005549 | Bacteria | 8814 |
| 117 | Ga0068855_100015898 | 3300005563 | Bacteria | 9053 |
| 118 | Ga0070664_100011902 | 3300005564 | Bacteria | 7061 |
| 119 | Ga0070664_100029999 | 3300005564 | Bacteria | 4535 |
| 120 | Ga0068857_100088667 | 3300005577 | Bacteria | 2767 |
| 121 | Ga0068854_100005659 | 3300005578 | Bacteria | 7895 |
| 122 | Ga0068854_100373794 | 3300005578 | Bacteria | 1173 |
| 123 | Ga0068856_100013123 | 3300005614 | Bacteria | 8027 |
| 124 | Ga0068856_100070422 | 3300005614 | Bacteria | 3459 |
| 125 | Ga0068856_100141167 | 3300005614 | Bacteria | 2416 |
| 126 | Ga0070702_100307981 | 3300005615 | Bacteria | 1098 |
| 127 | Ga0068852_100011309 | 3300005616 | Bacteria | 6714 |
| 128 | Ga0068852_100046536 | 3300005616 | Bacteria | 3697 |
| 129 | Ga0068852_100115168 | 3300005616 | Bacteria | 2451 |
| 130 | Ga0068852_100186786 | 3300005616 | Bacteria | 1952 |
| 131 | Ga0068852_100261099 | 3300005616 | Bacteria | 1663 |
| 132 | Ga0068859_100320694 | 3300005617 | Bacteria | 1643 |
| 133 | Ga0068859_100350372 | 3300005617 | Bacteria | 1571 |
| 134 | Ga0068859_100529108 | 3300005617 | Bacteria | 1274 |
| 135 | Ga0068864_100061606 | 3300005618 | Bacteria | 3250 |
| 136 | Ga0068864_100192046 | 3300005618 | Bacteria | 1872 |
| 137 | Ga0068864_100227702 | 3300005618 | Bacteria | 1723 |
| 138 | Ga0068866_10047798 | 3300005718 | Bacteria | 2159 |
| 139 | Ga0068851_10075785 | 3300005834 | Bacteria | 1749 |
| 140 | Ga0068870_10136544 | 3300005840 | Bacteria | 1430 |
| 141 | Ga0068863_100088314 | 3300005841 | Bacteria | 2938 |
| 142 | Ga0068863_100126211 | 3300005841 | Bacteria | 2441 |
| 143 | Ga0068858_100021427 | 3300005842 | Bacteria | 6038 |
| 144 | Ga0068858_100212283 | 3300005842 | Bacteria | 1832 |
| 145 | Ga0068860_100011430 | 3300005843 | Bacteria | 8745 |
| 146 | Ga0068860_100160380 | 3300005843 | Bacteria | 2168 |
| 147 | Ga0068862_100034751 | 3300005844 | Bacteria | 4266 |
| 148 | Ga0068862_100065534 | 3300005844 | Bacteria | 3129 |
| 149 | Ga0068862_100086701 | 3300005844 | Bacteria | 2722 |
| 150 | Ga0068862_100347884 | 3300005844 | Bacteria | 1374 |
| 151 | Ga0068862_100487504 | 3300005844 | Bacteria | 1168 |
| 152 | Ga0075365_10023759 | 3300006038 | Bacteria | 3859 |
| 153 | Ga0075365_10024549 | 3300006038 | Bacteria | 3805 |
| 154 | Ga0075363_100011081 | 3300006048 | Bacteria | 4307 |
| 155 | Ga0075363_100019974 | 3300006048 | Bacteria | 3355 |
| 156 | Ga0075363_100082350 | 3300006048 | Bacteria | 1761 |
| 157 | Ga0075363_100103566 | 3300006048 | Bacteria | 1577 |
| 158 | Ga0075364_10015537 | 3300006051 | Bacteria | 4723 |
| 159 | Ga0075364_10047864 | 3300006051 | Bacteria | 2786 |
| 160 | Ga0075364_10058901 | 3300006051 | Bacteria | 2517 |
| 161 | Ga0075362_10037146 | 3300006177 | Bacteria | 2134 |
| 162 | Ga0075362_10082346 | 3300006177 | Bacteria | 1485 |
| 163 | Ga0075367_10008687 | 3300006178 | Bacteria | 5274 |
| 164 | Ga0075366_10012633 | 3300006195 | Bacteria | 4795 |
| 165 | Ga0075366_10013726 | 3300006195 | Bacteria | 4616 |
| 166 | Ga0075366_10015053 | 3300006195 | Bacteria | 4424 |
| 167 | Ga0075366_10048998 | 3300006195 | Bacteria | 2506 |
| 168 | Ga0097621_100025706 | 3300006237 | Bacteria | 4609 |
| 169 | Ga0097621_100575132 | 3300006237 | Bacteria | 1027 |
| 170 | Ga0075370_10006104 | 3300006353 | Bacteria | 6041 |
| 171 | Ga0075370_10020735 | 3300006353 | Bacteria | 3595 |
| 172 | Ga0075370_10039862 | 3300006353 | Bacteria | 2648 |
| 173 | Ga0075370_10101600 | 3300006353 | Bacteria | 1664 |
| 174 | Ga0075370_10190614 | 3300006353 | Bacteria | 1208 |
| 175 | Ga0068871_100038278 | 3300006358 | Bacteria | 3829 |
| 176 | Ga0075428_100221658 | 3300006844 | Bacteria | 2042 |
| 177 | Ga0068865_100062333 | 3300006881 | Bacteria | 2617 |
| 178 | Ga0068865_100104083 | 3300006881 | Bacteria | 2083 |
| 179 | Ga0075436_100040806 | 3300006914 | Bacteria | 3203 |
| 180 | Ga0097620_100320697 | 3300006931 | Bacteria | 1643 |
| 181 | Ga0097620_100350339 | 3300006931 | Bacteria | 1571 |
| 182 | Ga0097620_100529058 | 3300006931 | Bacteria | 1274 |
| 183 | Ga0099826_10001304 | 3300006948 | Bacteria | 14708 |
| 184 | Ga0105244_10005148 | 3300009036 | Bacteria | 8766 |
| 185 | Ga0105244_10079444 | 3300009036 | Bacteria | 1626 |
| 186 | Ga0105240_10000945 | 3300009093 | Bacteria | 51693 |
| 187 | Ga0105240_10012575 | 3300009093 | Bacteria | 11676 |
| 188 | Ga0111539_10334450 | 3300009094 | Bacteria | 1763 |
| 189 | Ga0111539_10733500 | 3300009094 | Bacteria | 1150 |
| 190 | Ga0111539_11085566 | 3300009094 | Bacteria | 930 |
| 191 | Ga0105245_10015361 | 3300009098 | Bacteria | 6674 |
| 192 | Ga0105245_10212076 | 3300009098 | Bacteria | 1864 |
| 193 | Ga0105245_10213971 | 3300009098 | Bacteria | 1856 |
| 194 | Ga0105247_10100109 | 3300009101 | Bacteria | 1852 |
| 195 | Ga0105247_10183688 | 3300009101 | Bacteria | 1397 |
| 196 | Ga0105243_10000200 | 3300009148 | Bacteria | 69918 |
| 197 | Ga0105243_10000702 | 3300009148 | Bacteria | 32284 |
| 198 | Ga0105243_10004089 | 3300009148 | Bacteria | 11616 |
| 199 | Ga0105243_10078507 | 3300009148 | Bacteria | 2688 |
| 200 | Ga0105243_10485563 | 3300009148 | Bacteria | 1167 |
| 201 | Ga0105241_10048073 | 3300009174 | Bacteria | 3245 |
| 202 | Ga0105242_10003462 | 3300009176 | Bacteria | 12272 |
| 203 | Ga0105248_10322262 | 3300009177 | Bacteria | 1741 |
| 204 | Ga0105237_10000823 | 3300009545 | Bacteria | 42469 |
| 205 | Ga0105237_10317923 | 3300009545 | Bacteria | 1560 |
| 206 | Ga0105237_10402978 | 3300009545 | Bacteria | 1372 |
| 207 | Ga0105238_10020717 | 3300009551 | Bacteria | 6696 |
| 208 | Ga0105238_10121177 | 3300009551 | Bacteria | 2595 |
| 209 | Ga0105238_10539978 | 3300009551 | Bacteria | 1170 |
| 210 | Ga0105249_10072561 | 3300009553 | Bacteria | 3182 |
| 211 | Ga0105249_10073716 | 3300009553 | Bacteria | 3158 |
| 212 | Ga0105239_10010731 | 3300010375 | Bacteria | 10233 |
| 213 | Ga0105239_10013330 | 3300010375 | Bacteria | 9135 |
| 214 | Ga0105239_10022210 | 3300010375 | Bacteria | 6993 |
| 215 | Ga0105239_10098604 | 3300010375 | Bacteria | 3230 |
| 216 | Ga0105246_10051231 | 3300011119 | Bacteria | 2834 |
| 217 | Ga0157373_10129396 | 3300013100 | Bacteria | 1775 |
| 218 | Ga0157373_10264740 | 3300013100 | Bacteria | 1217 |
| 219 | Ga0157371_10098047 | 3300013102 | Bacteria | 2078 |
| 220 | Ga0157370_10212098 | 3300013104 | Bacteria | 1795 |
| 221 | Ga0157369_10015892 | 3300013105 | Bacteria | 8475 |
| 222 | Ga0157374_10406134 | 3300013296 | Bacteria | 1359 |
| 223 | Ga0157378_10059591 | 3300013297 | Bacteria | 3406 |
| 224 | Ga0157378_10115984 | 3300013297 | Bacteria | 2462 |
| 225 | Ga0163162_10028368 | 3300013306 | Bacteria | 5538 |
| 226 | Ga0163162_10274017 | 3300013306 | Bacteria | 1819 |
| 227 | Ga0157375_10083529 | 3300013308 | Bacteria | 3239 |
| 228 | Ga0157375_10092205 | 3300013308 | Bacteria | 3093 |
| 229 | Ga0157375_10131121 | 3300013308 | Bacteria | 2626 |
| 230 | Ga0157375_10239652 | 3300013308 | Bacteria | 1973 |
| 231 | Ga0157375_10283178 | 3300013308 | Bacteria | 1821 |
| 232 | Ga0157380_10292758 | 3300014326 | Bacteria | 1496 |
| 233 | Ga0157380_10706717 | 3300014326 | Bacteria | 1014 |
| 234 | Ga0182008_10006481 | 3300014497 | Bacteria | 6537 |
| 235 | Ga0157377_10000027 | 3300014745 | Bacteria | 135472 |
| 236 | Ga0157379_10205326 | 3300014968 | Bacteria | 1782 |
| 237 | Ga0157376_10008387 | 3300014969 | Bacteria | 7453 |
| 238 | Ga0157376_10091198 | 3300014969 | Bacteria | 2639 |
| 239 | Ga0157376_10208506 | 3300014969 | Bacteria | 1803 |
| 240 | Ga0182006_1012639 | 3300015261 | Bacteria | 3689 |
| 241 | Ga0182007_10002662 | 3300015262 | Bacteria | 8769 |
| 242 | Ga0163161_10000079 | 3300017792 | Bacteria | 97522 |
| 243 | Ga0163161_10005521 | 3300017792 | Bacteria | 8762 |
| 244 | Ga0163161_10077868 | 3300017792 | Bacteria | 2436 |
| 245 | Ga0163161_10313581 | 3300017792 | Bacteria | 1238 |
| 246 | Ga0213872_10005591 | 3300021361 | Bacteria | 6420 |
| 247 | Ga0209436_108606 | 3300025208 | Bacteria | 2015 |
| 248 | Ga0209672_100979 | 3300025228 | Bacteria | 12626 |
| 249 | Ga0209147_102886 | 3300025229 | Bacteria | 3782 |
| 250 | Ga0209258_100048 | 3300025242 | Bacteria | 365881 |
| 251 | Ga0207425_1000107 | 3300025245 | Bacteria | 77829 |
| 252 | Ga0207425_1007836 | 3300025245 | Bacteria | 2783 |
| 253 | Ga0209148_1000040 | 3300025254 | Bacteria | 473531 |
| 254 | Ga0209129_1000007 | 3300025258 | Bacteria | 771325 |
| 255 | Ga0209129_1002316 | 3300025258 | Bacteria | 9447 |
| 256 | Ga0209129_1008679 | 3300025258 | Bacteria | 2792 |
| 257 | Ga0209565_1000087 | 3300025263 | Bacteria | 152027 |
| 258 | Ga0209565_1001141 | 3300025263 | Bacteria | 12785 |
| 259 | Ga0209565_1006544 | 3300025263 | Bacteria | 3255 |
| 260 | Ga0209673_1000145 | 3300025273 | Bacteria | 152027 |
| 261 | Ga0209673_1000559 | 3300025273 | Bacteria | 59593 |
| 262 | Ga0209673_1000636 | 3300025273 | Bacteria | 53032 |
| 263 | Ga0209673_1003414 | 3300025273 | Bacteria | 9412 |
| 264 | Ga0209673_1020967 | 3300025273 | Bacteria | 2298 |
| 265 | Ga0209130_1000215 | 3300025284 | Bacteria | 75723 |
| 266 | Ga0209130_1000341 | 3300025284 | Bacteria | 53640 |
| 267 | Ga0209675_1000085 | 3300025291 | Bacteria | 152027 |
| 268 | Ga0209675_1001865 | 3300025291 | Bacteria | 11408 |
| 269 | Ga0209675_1003199 | 3300025291 | Bacteria | 7936 |
| 270 | Ga0209676_1000004 | 3300025292 | Bacteria | 1138360 |
| 271 | Ga0209676_1000071 | 3300025292 | Bacteria | 309464 |
| 272 | Ga0209676_1000172 | 3300025292 | Bacteria | 153664 |
| 273 | Ga0209676_1005241 | 3300025292 | Bacteria | 6862 |
| 274 | Ga0209025_1000230 | 3300025294 | Bacteria | 131131 |
| 275 | Ga0209025_1000507 | 3300025294 | Bacteria | 74783 |
| 276 | Ga0209564_1000200 | 3300025295 | Bacteria | 137503 |
| 277 | Ga0209564_1000318 | 3300025295 | Bacteria | 93851 |
| 278 | Ga0209758_1000025 | 3300025297 | Bacteria | 586687 |
| 279 | Ga0209758_1000057 | 3300025297 | Bacteria | 333111 |
| 280 | Ga0209758_1046212 | 3300025297 | Bacteria | 1572 |
| 281 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 282 | Ga0209050_1000509 | 3300025298 | Bacteria | 65792 |
| 283 | Ga0209050_1006208 | 3300025298 | Bacteria | 7169 |
| 284 | Ga0209050_1019262 | 3300025298 | Bacteria | 2602 |
| 285 | Ga0209256_1000067 | 3300025299 | Bacteria | 246812 |
| 286 | Ga0209256_1000198 | 3300025299 | Bacteria | 113429 |
| 287 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 288 | Ga0207426_1000178 | 3300025302 | Bacteria | 159291 |
| 289 | Ga0207426_1000264 | 3300025302 | Bacteria | 110747 |
| 290 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 291 | Ga0209051_1000096 | 3300025303 | Bacteria | 167399 |
| 292 | Ga0209051_1000169 | 3300025303 | Bacteria | 119220 |
| 293 | Ga0209051_1000278 | 3300025303 | Bacteria | 83769 |
| 294 | Ga0209051_1000342 | 3300025303 | Bacteria | 70022 |
| 295 | Ga0209051_1000397 | 3300025303 | Bacteria | 60597 |
| 296 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 297 | Ga0209257_1000072 | 3300025304 | Bacteria | 332791 |
| 298 | Ga0209257_1000497 | 3300025304 | Bacteria | 70185 |
| 299 | Ga0209257_1001087 | 3300025304 | Bacteria | 35572 |
| 300 | Ga0209257_1005665 | 3300025304 | Bacteria | 8623 |
| 301 | Ga0209257_1006992 | 3300025304 | Bacteria | 7014 |
| 302 | Ga0207697_10017578 | 3300025315 | Bacteria | 2938 |
| 303 | Ga0207655_1001662 | 3300025728 | Bacteria | 19671 |
| 304 | Ga0207682_10029380 | 3300025893 | Bacteria | 2198 |
| 305 | Ga0207682_10032517 | 3300025893 | Bacteria | 2097 |
| 306 | Ga0207688_10020321 | 3300025901 | Bacteria | 3625 |
| 307 | Ga0207645_10011003 | 3300025907 | Bacteria | 6191 |
| 308 | Ga0207645_10233992 | 3300025907 | Bacteria | 1213 |
| 309 | Ga0207643_10002167 | 3300025908 | Bacteria | 10767 |
| 310 | Ga0207643_10017684 | 3300025908 | Bacteria | 3901 |
| 311 | Ga0207705_10335496 | 3300025909 | Bacteria | 1163 |
| 312 | Ga0207695_10052257 | 3300025913 | Bacteria | 4282 |
| 313 | Ga0207695_10128363 | 3300025913 | Bacteria | 2495 |
| 314 | Ga0207671_10004092 | 3300025914 | Bacteria | 14115 |
| 315 | Ga0207693_10073887 | 3300025915 | Bacteria | 2669 |
| 316 | Ga0207657_10024037 | 3300025919 | Bacteria | 5658 |
| 317 | Ga0207657_10032138 | 3300025919 | Bacteria | 4745 |
| 318 | Ga0207649_10208424 | 3300025920 | Bacteria | 1385 |
| 319 | Ga0207652_10159249 | 3300025921 | Bacteria | 2023 |
| 320 | Ga0207646_10222534 | 3300025922 | Bacteria | 1705 |
| 321 | Ga0207681_10014220 | 3300025923 | Bacteria | 4940 |
| 322 | Ga0207681_10441542 | 3300025923 | Bacteria | 1057 |
| 323 | Ga0207694_10007400 | 3300025924 | Bacteria | 8327 |
| 324 | Ga0207694_10108642 | 3300025924 | Bacteria | 2204 |
| 325 | Ga0207650_10003059 | 3300025925 | Bacteria | 11524 |
| 326 | Ga0207650_10221477 | 3300025925 | Bacteria | 1523 |
| 327 | Ga0207659_10001323 | 3300025926 | Bacteria | 14807 |
| 328 | Ga0207659_10239654 | 3300025926 | Bacteria | 1467 |
| 329 | Ga0207687_10013419 | 3300025927 | Bacteria | 5349 |
| 330 | Ga0207644_10014009 | 3300025931 | Bacteria | 5359 |
| 331 | Ga0207706_10121038 | 3300025933 | Bacteria | 2301 |
| 332 | Ga0207706_10141781 | 3300025933 | Bacteria | 2114 |
| 333 | Ga0207686_10057835 | 3300025934 | Bacteria | 2442 |
| 334 | Ga0207709_10000038 | 3300025935 | Bacteria | 266638 |
| 335 | Ga0207709_10000526 | 3300025935 | Bacteria | 33311 |
| 336 | Ga0207709_10001681 | 3300025935 | Bacteria | 14906 |
| 337 | Ga0207709_10006910 | 3300025935 | Bacteria | 6350 |
| 338 | Ga0207709_10147595 | 3300025935 | Bacteria | 1625 |
| 339 | Ga0207669_10012633 | 3300025937 | Bacteria | 4160 |
| 340 | Ga0207704_10007994 | 3300025938 | Bacteria | 5030 |
| 341 | Ga0207704_10140604 | 3300025938 | Bacteria | 1688 |
| 342 | Ga0207704_10155045 | 3300025938 | Bacteria | 1622 |
| 343 | Ga0207691_10014001 | 3300025940 | Bacteria | 7651 |
| 344 | Ga0207691_10162622 | 3300025940 | Bacteria | 1958 |
| 345 | Ga0207691_10256012 | 3300025940 | Bacteria | 1510 |
| 346 | Ga0207711_10253687 | 3300025941 | Bacteria | 1616 |
| 347 | Ga0207689_10010022 | 3300025942 | Bacteria | 8169 |
| 348 | Ga0207689_10104271 | 3300025942 | Bacteria | 2330 |
| 349 | Ga0207689_10674292 | 3300025942 | Bacteria | 871 |
| 350 | Ga0207679_10062927 | 3300025945 | Bacteria | 2767 |
| 351 | Ga0207679_10072446 | 3300025945 | Bacteria | 2602 |
| 352 | Ga0207667_10060380 | 3300025949 | Bacteria | 3969 |
| 353 | Ga0207667_10094776 | 3300025949 | Bacteria | 3082 |
| 354 | Ga0207668_10098739 | 3300025972 | Bacteria | 2164 |
| 355 | Ga0207668_10265206 | 3300025972 | Bacteria | 1401 |
| 356 | Ga0207640_10019380 | 3300025981 | Bacteria | 4019 |
| 357 | Ga0207640_10130551 | 3300025981 | Bacteria | 1816 |
| 358 | Ga0207658_10005361 | 3300025986 | Bacteria | 8808 |
| 359 | Ga0207658_10008898 | 3300025986 | Bacteria | 6810 |
| 360 | Ga0207658_10174344 | 3300025986 | Bacteria | 1775 |
| 361 | Ga0207658_10190111 | 3300025986 | Bacteria | 1706 |
| 362 | Ga0207658_10277283 | 3300025986 | Bacteria | 1436 |
| 363 | Ga0207677_10058187 | 3300026023 | Bacteria | 2659 |
| 364 | Ga0207677_10169562 | 3300026023 | Bacteria | 1705 |
| 365 | Ga0207677_10201962 | 3300026023 | Bacteria | 1581 |
| 366 | Ga0207677_10232751 | 3300026023 | Bacteria | 1485 |
| 367 | Ga0207703_10231325 | 3300026035 | Bacteria | 1657 |
| 368 | Ga0207639_10010000 | 3300026041 | Bacteria | 6557 |
| 369 | Ga0207639_10052443 | 3300026041 | Bacteria | 3108 |
| 370 | Ga0207678_10002445 | 3300026067 | Bacteria | 16883 |
| 371 | Ga0207678_10006353 | 3300026067 | Bacteria | 10489 |
| 372 | Ga0207678_10006601 | 3300026067 | Bacteria | 10286 |
| 373 | Ga0207678_10130265 | 3300026067 | Bacteria | 2145 |
| 374 | Ga0207708_10014923 | 3300026075 | Bacteria | 5818 |
| 375 | Ga0207702_10088618 | 3300026078 | Bacteria | 2704 |
| 376 | Ga0207641_10145888 | 3300026088 | Bacteria | 2140 |
| 377 | Ga0207648_10000119 | 3300026089 | Bacteria | 76875 |
| 378 | Ga0207648_10006342 | 3300026089 | Bacteria | 11762 |
| 379 | Ga0207648_10030511 | 3300026089 | Bacteria | 4774 |
| 380 | Ga0207648_10035260 | 3300026089 | Bacteria | 4408 |
| 381 | Ga0207648_10062176 | 3300026089 | Bacteria | 3256 |
| 382 | Ga0207648_10089200 | 3300026089 | Bacteria | 2693 |
| 383 | Ga0207648_10399724 | 3300026089 | Bacteria | 1245 |
| 384 | Ga0207674_10009872 | 3300026116 | Bacteria | 10861 |
| 385 | Ga0207674_10159225 | 3300026116 | Bacteria | 2212 |
| 386 | Ga0207675_100032777 | 3300026118 | Bacteria | 4840 |
| 387 | Ga0207683_10023532 | 3300026121 | Bacteria | 5299 |
| 388 | Ga0207683_10049844 | 3300026121 | Bacteria | 3666 |
| 389 | Ga0207683_10058641 | 3300026121 | Bacteria | 3380 |
| 390 | Ga0207683_10118846 | 3300026121 | Bacteria | 2371 |
| 391 | Ga0207698_10121211 | 3300026142 | Bacteria | 2214 |
| 392 | Ga0207698_10178538 | 3300026142 | Bacteria | 1878 |
| 393 | Ga0207698_10182134 | 3300026142 | Bacteria | 1862 |
| 394 | Ga0207698_10543853 | 3300026142 | Bacteria | 1137 |
| 395 | Ga0268266_10060061 | 3300028379 | Bacteria | 3276 |
| 396 | Ga0268266_10070557 | 3300028379 | Bacteria | 3027 |
| 397 | Ga0268265_10060528 | 3300028380 | Bacteria | 2902 |
| 398 | Ga0268265_10204733 | 3300028380 | Bacteria | 1715 |
| 399 | Ga0268264_10008551 | 3300028381 | Bacteria | 8509 |
| 400 | Ga0268264_10111576 | 3300028381 | Bacteria | 2396 |
| 401 | Ga0268264_10398379 | 3300028381 | Bacteria | 1322 |
| 402 | Ga0307517_10081897 | 3300028786 | Bacteria | 2746 |
| 403 | Ga0307515_10000195 | 3300028794 | Bacteria | 148138 |
| 404 | Ga0316183_1124715 | 3300030742 | Bacteria | 11765 |
| 405 | Ga0307513_10001731 | 3300031456 | Bacteria | 31140 |
| 406 | Ga0307408_100000200 | 3300031548 | Bacteria | 65177 |
| 407 | Ga0307408_100134837 | 3300031548 | Bacteria | 1931 |
| 408 | Ga0307408_100280050 | 3300031548 | Bacteria | 1388 |
| 409 | Ga0307516_10002973 | 3300031730 | Bacteria | 22180 |
| 410 | Ga0307516_10006719 | 3300031730 | Bacteria | 13445 |
| 411 | Ga0307516_10098572 | 3300031730 | Bacteria | 2741 |
| 412 | Ga0307405_10022557 | 3300031731 | Bacteria | 3561 |
| 413 | Ga0307405_10162074 | 3300031731 | Bacteria | 1585 |
| 414 | Ga0307406_10004441 | 3300031901 | Bacteria | 7634 |
| 415 | Ga0307406_10150811 | 3300031901 | Bacteria | 1658 |
| 416 | Ga0307412_10003421 | 3300031911 | Bacteria | 8816 |
| 417 | Ga0307412_10007892 | 3300031911 | Bacteria | 6062 |
| 418 | Ga0307412_10071279 | 3300031911 | Bacteria | 2372 |
| 419 | Ga0307416_100197355 | 3300032002 | Bacteria | 1905 |
| 420 | Ga0307414_10081926 | 3300032004 | Bacteria | 2364 |
| 421 | Ga0307414_10131848 | 3300032004 | Bacteria | 1941 |
| 422 | Ga0307411_10609413 | 3300032005 | Bacteria | 940 |
| 423 | Ga0373931_0136762 | 3300035691 | Bacteria | 1415 |
| 424 | Ga0373927_0015731 | 3300035695 | Bacteria | 4995 |
| 425 | Ga0373937_0012507 | 3300036401 | Bacteria | 7469 |
| 426 | Ga0373925_0021639 | 3300037068 | Bacteria | 4688 |
| 427 | Ga0373925_0037039 | 3300037068 | Bacteria | 3600 |
| 428 | Ga0395899_0018078 | 3300037312 | Bacteria | 5365 |
| 429 | Ga0395899_0033664 | 3300037312 | Bacteria | 3848 |
| 430 | Ga0395900_0023033 | 3300037418 | Bacteria | 6374 |
| 431 | Ga0395900_0307825 | 3300037418 | Bacteria | 1568 |
| 432 | Ga0395900_0657826 | 3300037418 | Bacteria | 984 |
| 433 | Ga0395898_0003690 | 3300037466 | Bacteria | 17014 |
| 434 | Ga0395898_0050321 | 3300037466 | Bacteria | 4078 |
| 435 | Ga0395905_0000421 | 3300037471 | Bacteria | 59264 |
| 436 | Ga0395905_0028868 | 3300037471 | Bacteria | 5228 |
| 437 | Ga0395905_0116084 | 3300037471 | Bacteria | 2516 |
| 438 | Ga0395905_0134246 | 3300037471 | Bacteria | 2328 |
| 439 | Ga0395905_0154316 | 3300037471 | Bacteria | 2159 |
| 440 | Ga0395901_0066699 | 3300038443 | Bacteria | 3748 |
| 441 | Ga0395901_0157157 | 3300038443 | Bacteria | 2388 |
| 442 | Ga0395901_0217550 | 3300038443 | Bacteria | 1997 |
| 443 | Ga0436361_1143890 | 3300039447 | Bacteria | 13239 |
| 444 | Ga0439436_0006508 | 3300041404 | Bacteria | 3585 |
| 445 | Ga0439461_0014337 | 3300041410 | Bacteria | 1506 |
| 446 | Ga0439461_0026663 | 3300041410 | Bacteria | 1180 |
| 447 | Ga0439466_0055840 | 3300041411 | Bacteria | 1282 |
| 448 | Ga0439465_0001810 | 3300041413 | Bacteria | 6995 |
| 449 | Ga0451839_1198531 | 3300041496 | Bacteria | 1319 |
| 450 | Ga0439431_0001122 | 3300041997 | Bacteria | 5822 |
| 451 | Ga0439445_0001661 | 3300042004 | Bacteria | 4862 |
| 452 | Ga0439432_003301 | 3300042006 | Bacteria | 5994 |
| 453 | Ga0439432_032244 | 3300042006 | Bacteria | 1690 |
| 454 | Ga0439449_0002844 | 3300042007 | Bacteria | 6733 |
| 455 | Ga0439449_0036098 | 3300042007 | Bacteria | 1838 |
| 456 | Ga0439452_004527 | 3300042010 | Bacteria | 4646 |
| 457 | Ga0439457_005798 | 3300042014 | Bacteria | 3066 |
| 458 | Ga0439457_024855 | 3300042014 | Bacteria | 1326 |
| 459 | Ga0439462_0019581 | 3300042015 | Bacteria | 1762 |
| 460 | Ga0450923_012492 | 3300042125 | Bacteria | 1546 |
| 461 | Ga0450890_002360 | 3300042127 | Bacteria | 2605 |
| 462 | Ga0450892_000160 | 3300042130 | Bacteria | 7782 |
| 463 | Ga0450898_005819 | 3300042134 | Bacteria | 1877 |
| 464 | Ga0450889_000338 | 3300042144 | Bacteria | 5219 |
| 465 | Ga0450906_003992 | 3300042145 | Bacteria | 3122 |
| 466 | Ga0450910_019328 | 3300042147 | Bacteria | 1022 |
| 467 | Ga0450908_002489 | 3300042184 | Bacteria | 3602 |
| 468 | Ga0439434_0002733 | 3300042435 | Bacteria | 5141 |
| 469 | Ga0450918_008218 | 3300042531 | Bacteria | 1836 |
| 470 | Ga0451577_0002570 | 3300042876 | Bacteria | 21430 |
| 471 | Ga0451577_0438419 | 3300042876 | Bacteria | 1186 |
| 472 | Ga0451577_0592001 | 3300042876 | Bacteria | 1006 |
| 473 | Ga0466969_0008092 | 3300044656 | Bacteria | 5583 |
| 474 | Ga0466972_0037322 | 3300044658 | Bacteria | 2376 |
| 475 | Ga0466966_0007151 | 3300044684 | Bacteria | 7397 |
| 476 | Ga0466966_0011845 | 3300044684 | Bacteria | 5776 |
| 477 | Ga0466961_0026791 | 3300044693 | Bacteria | 3706 |
| 478 | Ga0453684_0613142 | 3300044712 | Bacteria | 1191 |
| 479 | Ga0453684_0657291 | 3300044712 | Bacteria | 1143 |
| 480 | Ga0495627_017433 | 3300046453 | Bacteria | 2439 |
| 481 | Ga0495638_0082054 | 3300046460 | Bacteria | 1956 |
| 482 | Ga0495650_0010085 | 3300046471 | Bacteria | 5306 |
| 483 | Ga0495583_0000034 | 3300046506 | Bacteria | 246856 |
| 484 | Ga0495606_0001750 | 3300046507 | Bacteria | 27863 |
| 485 | Ga0495616_0066528 | 3300046513 | Bacteria | 1753 |
| 486 | Ga0495620_0029354 | 3300046515 | Bacteria | 2546 |
| 487 | Ga0495620_0041269 | 3300046515 | Bacteria | 2025 |
| 488 | Ga0495631_0000021 | 3300046518 | Bacteria | 92765 |
| 489 | Ga0495632_0006988 | 3300046519 | Bacteria | 7162 |
| 490 | Ga0495637_0021992 | 3300046520 | Bacteria | 2915 |
| 491 | Ga0495643_0111984 | 3300046522 | Bacteria | 1387 |
| 492 | Ga0495648_0127719 | 3300046524 | Bacteria | 1356 |
| 493 | Ga0495597_0000157 | 3300046542 | Bacteria | 60125 |
| 494 | Ga0495633_0001670 | 3300046558 | Bacteria | 16748 |
| 495 | Ga0495668_0057402 | 3300046616 | Bacteria | 2148 |
| 496 | Ga0495668_0114181 | 3300046616 | Bacteria | 1477 |
| 497 | Ga0495611_0008518 | 3300046648 | Bacteria | 4336 |
| 498 | Ga0495625_0000012 | 3300046660 | Bacteria | 363006 |
| 499 | Ga0495625_0022250 | 3300046660 | Bacteria | 4864 |
| 500 | Ga0495625_0033882 | 3300046660 | Bacteria | 3772 |
| 501 | Ga0495625_0092376 | 3300046660 | Bacteria | 2091 |
| 502 | Ga0495625_0146286 | 3300046660 | Bacteria | 1591 |
| 503 | Ga0495661_0011511 | 3300046665 | Bacteria | 6001 |
| 504 | Ga0495588_0031063 | 3300046674 | Bacteria | 2687 |
| 505 | Ga0495658_0042706 | 3300046683 | Bacteria | 2532 |
| 506 | Ga0495658_0336209 | 3300046683 | Bacteria | 959 |
| 507 | Ga0495669_0015030 | 3300046684 | Bacteria | 3311 |
| 508 | Ga0495670_0001518 | 3300046691 | Bacteria | 11330 |
| 509 | Ga0495671_0026731 | 3300046692 | Bacteria | 2988 |
| 510 | Ga0495671_0129468 | 3300046692 | Bacteria | 1231 |
| 511 | Ga0495649_0000470 | 3300046694 | Bacteria | 34696 |
| 512 | Ga0495649_0001920 | 3300046694 | Bacteria | 15144 |
| 513 | Ga0495589_0000033 | 3300046794 | Bacteria | 162794 |
| 514 | Ga0495589_0005062 | 3300046794 | Bacteria | 6974 |
| 515 | Ga0495589_0015362 | 3300046794 | Bacteria | 3941 |
| 516 | Ga0495660_0053780 | 3300046810 | Bacteria | 2184 |
| 517 | Ga0495581_0128471 | 3300047315 | Bacteria | 1477 |
| 518 | Ga0495677_0000874 | 3300047445 | Bacteria | 12167 |
| 519 | Ga0495681_0009255 | 3300047470 | Bacteria | 6090 |
| 520 | Ga0495614_0003864 | 3300048089 | Bacteria | 6735 |
| 521 | Ga0496101_0197630 | 3300048904 | Bacteria | 1554 |
| 522 | Ga0496102_0065022 | 3300048905 | Bacteria | 3342 |
| 523 | Ga0496104_0109871 | 3300048907 | Bacteria | 2643 |
| 524 | Ga0496109_0158482 | 3300048912 | Bacteria | 2120 |
| 525 | Ga0496110_0050780 | 3300048913 | Bacteria | 3643 |
| 526 | Ga0496115_0183765 | 3300048918 | Bacteria | 1728 |
| 527 | Ga0496116_0044916 | 3300048919 | Bacteria | 2995 |
| 528 | Ga0496117_0011160 | 3300048920 | Bacteria | 8074 |
| 529 | Ga0496117_0030126 | 3300048920 | Bacteria | 4170 |
| 530 | Ga0496118_0102292 | 3300048921 | Bacteria | 1931 |
| 531 | Ga0496118_0238353 | 3300048921 | Bacteria | 1043 |
| 532 | Ga0496119_0038364 | 3300048922 | Bacteria | 3097 |
| 533 | Ga0496121_0085656 | 3300048924 | Bacteria | 2479 |
| 534 | Ga0496121_0180064 | 3300048924 | Bacteria | 1526 |
| 535 | Ga0496122_0200657 | 3300048925 | Bacteria | 1167 |
| 536 | Ga0496123_0054443 | 3300048926 | Bacteria | 2634 |
| 537 | Ga0496123_0087843 | 3300048926 | Bacteria | 1858 |
| 538 | Ga0496123_0091973 | 3300048926 | Bacteria | 1797 |
| 539 | Ga0496124_0046565 | 3300048927 | Bacteria | 3713 |
| 540 | Ga0496124_0068685 | 3300048927 | Bacteria | 2944 |
| 541 | Ga0496125_0006952 | 3300048928 | Bacteria | 12116 |
| 542 | Ga0496125_0036027 | 3300048928 | Bacteria | 4328 |
| 543 | Ga0496125_0087016 | 3300048928 | Bacteria | 2361 |
| 544 | Ga0501031_0225466 | 3300049568 | Bacteria | 1220 |
| 545 | Ga0501036_0164411 | 3300049572 | Bacteria | 1871 |
| 546 | Ga0501040_0096319 | 3300049576 | Bacteria | 2060 |
| 547 | Ga0501042_0026616 | 3300049578 | Bacteria | 4063 |
| 548 | Ga0501043_0104944 | 3300049579 | Bacteria | 2221 |
| 549 | Ga0501046_0121496 | 3300049580 | Bacteria | 1987 |
| 550 | Ga0501047_0036244 | 3300049581 | Bacteria | 4766 |
| 551 | Ga0501048_0016755 | 3300049582 | Bacteria | 5402 |
| 552 | Ga0501071_0063292 | 3300049587 | Bacteria | 2682 |
| 553 | Ga0501072_0004600 | 3300049588 | Bacteria | 10505 |
| 554 | Ga0501075_0001513 | 3300049591 | Bacteria | 15163 |
| 555 | Ga0501076_0004572 | 3300049592 | Bacteria | 9850 |
| 556 | Ga0501077_0197583 | 3300049593 | Bacteria | 1278 |
| 557 | Ga0501249_006096 | 3300049679 | Bacteria | 2477 |
| 558 | Ga0501079_0003913 | 3300049741 | Bacteria | 10999 |
| 559 | Ga0501080_0004252 | 3300049742 | Bacteria | 12707 |
| 560 | Ga0501044_0058219 | 3300049823 | Bacteria | 3963 |
| 561 | Ga0501045_0003295 | 3300049824 | Bacteria | 11029 |
| 562 | nmdc:mga03683_12981_c1 | 3300050489 | Bacteria | 3055 |
| 563 | nmdc:mga03683_24037_c1 | 3300050489 | Bacteria | 2381 |
| 564 | nmdc:mga03683_60615_c1 | 3300050489 | Bacteria | 1598 |
| 565 | nmdc:mga03n38_19842_c1 | 3300050490 | Bacteria | 2678 |
| 566 | nmdc:mga03n38_41284_c1 | 3300050490 | Bacteria | 2010 |
| 567 | nmdc:mga03n38_55764_c1 | 3300050490 | Bacteria | 1781 |
| 568 | nmdc:mga00v17_30844_c1 | 3300050491 | Bacteria | 3156 |
| 569 | nmdc:mga00v17_41129_c1 | 3300050491 | Bacteria | 2388 |
| 570 | nmdc:mga0yw44_133478_c1 | 3300050492 | Bacteria | 1609 |
| 571 | nmdc:mga0yw44_7767_c1 | 3300050492 | Bacteria | 5301 |
| 572 | nmdc:mga0k408_125039_c1 | 3300050493 | Bacteria | 1525 |
| 573 | nmdc:mga0k408_151760_c1 | 3300050493 | Bacteria | 1380 |
| 574 | nmdc:mga0k408_1652_c1 | 3300050493 | Bacteria | 12054 |
| 575 | nmdc:mga0k408_17654_c1 | 3300050493 | Bacteria | 3976 |
| 576 | nmdc:mga0k408_3908_c1 | 3300050493 | Bacteria | 7899 |
| 577 | nmdc:mga0k408_9932_c1 | 3300050493 | Bacteria | 5138 |
| 578 | nmdc:mga06z11_116231_c1 | 3300050494 | Bacteria | 1487 |
| 579 | nmdc:mga06z11_210980_c1 | 3300050494 | Bacteria | 1131 |
| 580 | nmdc:mga07m45_12514_c1 | 3300050496 | Bacteria | 4486 |
| 581 | nmdc:mga07m45_15913_c1 | 3300050496 | Bacteria | 4022 |
| 582 | nmdc:mga07m45_16947_c1 | 3300050496 | Bacteria | 3906 |
| 583 | nmdc:mga08y16_217260_c1 | 3300050511 | Bacteria | 1485 |
| 584 | nmdc:mga0n895_299159_c1 | 3300050512 | Bacteria | 1631 |
| 585 | nmdc:mga08x19_50530_c1 | 3300050514 | Bacteria | 2668 |
| 586 | Ga0500610_0005654 | 3300053079 | Bacteria | 5153 |
| 587 | Ga0500610_0023766 | 3300053079 | Bacteria | 3038 |
| 588 | Ga0500643_012105 | 3300053087 | Bacteria | 3106 |
| 589 | Ga0500651_0000095 | 3300053093 | Bacteria | 54857 |
| 590 | Ga0500641_0101364 | 3300053096 | Bacteria | 1235 |
| 591 | Ga0500571_000379 | 3300053110 | Bacteria | 17609 |
| 592 | Ga0500592_019484 | 3300053116 | Bacteria | 1090 |
| 593 | Ga0500593_022497 | 3300053117 | Bacteria | 2783 |
| 594 | Ga0500594_0001104 | 3300053118 | Bacteria | 5785 |
| 595 | Ga0500607_003662 | 3300053121 | Bacteria | 11040 |
| 596 | Ga0500626_018467 | 3300053128 | Bacteria | 3080 |
| 597 | Ga0500655_003070 | 3300053133 | Bacteria | 3029 |
| 598 | Ga0500658_0000763 | 3300053134 | Bacteria | 13270 |
| 599 | Ga0500658_0000783 | 3300053134 | Bacteria | 13145 |
| 600 | Ga0500564_062282 | 3300053138 | Bacteria | 1691 |
| 601 | Ga0500568_0004399 | 3300053139 | Bacteria | 7538 |
| 602 | Ga0500616_0025191 | 3300053153 | Bacteria | 3300 |
| 603 | Ga0500627_0001630 | 3300053158 | Bacteria | 6339 |
| 604 | Ga0500634_0041574 | 3300053161 | Bacteria | 2496 |
| 605 | Ga0590077_012140 | 3300059426 | Bacteria | 1783 |
| 606 | Ga0501082_0015479 | 3300060353 | Bacteria | 6565 |
| 607 | Ga0530510_0003286 | 3300061734 | Bacteria | 11125 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031911 | Ga0307412_10003421 | Ga0307412_100034213 | 257 |
| 2 | 3300028794 | Ga0307515_10000195 | Ga0307515_1000019518 | 260 |
| 3 | 3300009036 | Ga0105244_10079444 | Ga0105244_100794441 | 264 |
| 4 | 3300041411 | Ga0439466_0055840 | Ga0439466_0055840_289_1197 | 264 |
| 5 | 3300042125 | Ga0450923_012492 | Ga0450923_012492_463_1371 | 264 |
| 6 | 3300042134 | Ga0450898_005819 | Ga0450898_005819_408_1316 | 264 |
| 7 | 3300042145 | Ga0450906_003992 | Ga0450906_003992_342_1250 | 264 |
| 8 | 3300042147 | Ga0450910_019328 | Ga0450910_019328_91_999 | 264 |
| 9 | 3300042184 | Ga0450908_002489 | Ga0450908_002489_422_1330 | 264 |
| 10 | 3300042435 | Ga0439434_0002733 | Ga0439434_0002733_2151_3059 | 264 |
| 11 | 3300042531 | Ga0450918_008218 | Ga0450918_008218_852_1760 | 264 |
| 12 | 3300048926 | Ga0496123_0087843 | Ga0496123_0087843_271_1209 | 264 |
| 13 | 3300010375 | Ga0105239_10098604 | Ga0105239_100986042 | 266 |
| 14 | 3300042876 | Ga0451577_0438419 | Ga0451577_0438419_207_1154 | 268 |
| 15 | 3300053079 | Ga0500610_0005654 | Ga0500610_0005654_2419_3309 | 268 |
| 16 | 3300053096 | Ga0500641_0101364 | Ga0500641_0101364_321_1211 | 268 |
| 17 | 3300053158 | Ga0500627_0001630 | Ga0500627_0001630_1320_2210 | 268 |
| 18 | 3300037471 | Ga0395905_0134246 | Ga0395905_0134246_358_1200 | 269 |
| 19 | 3300003187 | JGI25151J46595_10002864 | JGI25151J46595_100028644 | 270 |
| 20 | 3300006048 | Ga0075363_100103566 | Ga0075363_1001035662 | 270 |
| 21 | 3300025258 | Ga0209129_1002316 | Ga0209129_10023168 | 270 |
| 22 | 3300025294 | Ga0209025_1000230 | Ga0209025_100023092 | 270 |
| 23 | 3300006237 | Ga0097621_100575132 | Ga0097621_1005751321 | 271 |
| 24 | 3300049568 | Ga0501031_0225466 | Ga0501031_0225466_177_1076 | 271 |
| 25 | 3300049572 | Ga0501036_0164411 | Ga0501036_0164411_821_1720 | 271 |
| 26 | 3300049579 | Ga0501043_0104944 | Ga0501043_0104944_1225_2124 | 271 |
| 27 | 3300049581 | Ga0501047_0036244 | Ga0501047_0036244_3788_4687 | 271 |
| 28 | 3300049823 | Ga0501044_0058219 | Ga0501044_0058219_1467_2366 | 271 |
| 29 | 3300005344 | Ga0070661_100371929 | Ga0070661_1003719291 | 272 |
| 30 | 3300005456 | Ga0070678_100031542 | Ga0070678_1000315422 | 272 |
| 31 | 3300005471 | Ga0070698_100086842 | Ga0070698_1000868423 | 272 |
| 32 | 3300005471 | Ga0070698_100293278 | Ga0070698_1002932782 | 272 |
| 33 | 3300005544 | Ga0070686_100053105 | Ga0070686_1000531051 | 272 |
| 34 | 3300005548 | Ga0070665_100011810 | Ga0070665_1000118108 | 272 |
| 35 | 3300005549 | Ga0070704_100003685 | Ga0070704_1000036856 | 272 |
| 36 | 3300005616 | Ga0068852_100046536 | Ga0068852_1000465363 | 272 |
| 37 | 3300005834 | Ga0068851_10075785 | Ga0068851_100757852 | 272 |
| 38 | 3300005841 | Ga0068863_100126211 | Ga0068863_1001262113 | 272 |
| 39 | 3300005842 | Ga0068858_100021427 | Ga0068858_1000214274 | 272 |
| 40 | 3300005844 | Ga0068862_100347884 | Ga0068862_1003478841 | 272 |
| 41 | 3300005844 | Ga0068862_100487504 | Ga0068862_1004875041 | 272 |
| 42 | 3300006358 | Ga0068871_100038278 | Ga0068871_1000382783 | 272 |
| 43 | 3300006914 | Ga0075436_100040806 | Ga0075436_1000408062 | 272 |
| 44 | 3300009101 | Ga0105247_10100109 | Ga0105247_101001092 | 272 |
| 45 | 3300009148 | Ga0105243_10485563 | Ga0105243_104855631 | 272 |
| 46 | 3300009177 | Ga0105248_10322262 | Ga0105248_103222622 | 272 |
| 47 | 3300013102 | Ga0157371_10098047 | Ga0157371_100980472 | 272 |
| 48 | 3300013296 | Ga0157374_10406134 | Ga0157374_104061342 | 272 |
| 49 | 3300013308 | Ga0157375_10092205 | Ga0157375_100922052 | 272 |
| 50 | 3300014969 | Ga0157376_10008387 | Ga0157376_100083876 | 272 |
| 51 | 3300014969 | Ga0157376_10091198 | Ga0157376_100911982 | 272 |
| 52 | 3300025908 | Ga0207643_10002167 | Ga0207643_100021678 | 272 |
| 53 | 3300025941 | Ga0207711_10253687 | Ga0207711_102536872 | 272 |
| 54 | 3300025942 | Ga0207689_10674292 | Ga0207689_106742921 | 272 |
| 55 | 3300025972 | Ga0207668_10265206 | Ga0207668_102652062 | 272 |
| 56 | 3300026067 | Ga0207678_10006601 | Ga0207678_100066017 | 272 |
| 57 | 3300026078 | Ga0207702_10088618 | Ga0207702_100886183 | 272 |
| 58 | 3300026088 | Ga0207641_10145888 | Ga0207641_101458881 | 272 |
| 59 | 3300026089 | Ga0207648_10399724 | Ga0207648_103997241 | 272 |
| 60 | 3300026121 | Ga0207683_10049844 | Ga0207683_100498442 | 272 |
| 61 | 3300026142 | Ga0207698_10121211 | Ga0207698_101212112 | 272 |
| 62 | 3300028379 | Ga0268266_10060061 | Ga0268266_100600613 | 272 |
| 63 | 3300031730 | Ga0307516_10098572 | Ga0307516_100985723 | 272 |
| 64 | 3300036401 | Ga0373937_0012507 | Ga0373937_0012507_6214_7059 | 272 |
| 65 | 3300037068 | Ga0373925_0021639 | Ga0373925_0021639_530_1375 | 272 |
| 66 | 3300037312 | Ga0395899_0018078 | Ga0395899_0018078_1823_2674 | 272 |
| 67 | 3300037418 | Ga0395900_0023033 | Ga0395900_0023033_4142_4993 | 272 |
| 68 | 3300037466 | Ga0395898_0003690 | Ga0395898_0003690_2723_3574 | 272 |
| 69 | 3300037471 | Ga0395905_0028868 | Ga0395905_0028868_1782_2633 | 272 |
| 70 | 3300037471 | Ga0395905_0116084 | Ga0395905_0116084_945_1796 | 272 |
| 71 | 3300037471 | Ga0395905_0154316 | Ga0395905_0154316_159_1013 | 272 |
| 72 | 3300038443 | Ga0395901_0066699 | Ga0395901_0066699_2365_3216 | 272 |
| 73 | 3300038443 | Ga0395901_0157157 | Ga0395901_0157157_482_1336 | 272 |
| 74 | 3300042876 | Ga0451577_0002570 | Ga0451577_0002570_2880_3722 | 272 |
| 75 | 3300044656 | Ga0466969_0008092 | Ga0466969_0008092_3830_4681 | 272 |
| 76 | 3300044658 | Ga0466972_0037322 | Ga0466972_0037322_900_1745 | 272 |
| 77 | 3300044684 | Ga0466966_0007151 | Ga0466966_0007151_933_1778 | 272 |
| 78 | 3300044684 | Ga0466966_0011845 | Ga0466966_0011845_1248_2099 | 272 |
| 79 | 3300044693 | Ga0466961_0026791 | Ga0466961_0026791_2371_3222 | 272 |
| 80 | 3300044712 | Ga0453684_0613142 | Ga0453684_0613142_328_1173 | 272 |
| 81 | 3300044712 | Ga0453684_0657291 | Ga0453684_0657291_226_1071 | 272 |
| 82 | 3300047315 | Ga0495581_0128471 | Ga0495581_0128471_272_1117 | 272 |
| 83 | 3300050511 | nmdc:mga08y16_217260_c1 | nmdc:mga08y16_217260_c1_20_865 | 272 |
| 84 | 3300050514 | nmdc:mga08x19_50530_c1 | nmdc:mga08x19_50530_c1_1345_2190 | 272 |
| 85 | iso_pu_bacteria | 2842747753 | 2842748424 | 272 |
| 86 | 3300035695 | Ga0373927_0015731 | Ga0373927_0015731_575_1438 | 273 |
| 87 | 3300037312 | Ga0395899_0033664 | Ga0395899_0033664_148_1095 | 273 |
| 88 | 3300037418 | Ga0395900_0307825 | Ga0395900_0307825_298_1191 | 273 |
| 89 | 3300037466 | Ga0395898_0050321 | Ga0395898_0050321_1090_1983 | 273 |
| 90 | 3300038443 | Ga0395901_0217550 | Ga0395901_0217550_351_1244 | 273 |
| 91 | iso_pu_bacteria | 2842733646 | 2842735858 | 273 |
| 92 | iso_pu_bacteria | 2919704043 | 2919708548 | 273 |
| 93 | 3300005356 | Ga0070674_100016462 | Ga0070674_1000164623 | 274 |
| 94 | 3300005459 | Ga0068867_100018445 | Ga0068867_1000184451 | 274 |
| 95 | 3300005578 | Ga0068854_100373794 | Ga0068854_1003737942 | 274 |
| 96 | 3300006038 | Ga0075365_10024549 | Ga0075365_100245493 | 274 |
| 97 | 3300006048 | Ga0075363_100082350 | Ga0075363_1000823502 | 274 |
| 98 | 3300006178 | Ga0075367_10008687 | Ga0075367_100086872 | 274 |
| 99 | 3300013104 | Ga0157370_10212098 | Ga0157370_102120982 | 274 |
| 100 | 3300025291 | Ga0209675_1003199 | Ga0209675_10031997 | 274 |
| 101 | 3300025298 | Ga0209050_1006208 | Ga0209050_10062083 | 274 |
| 102 | 3300026041 | Ga0207639_10052443 | Ga0207639_100524432 | 274 |
| 103 | 3300028381 | Ga0268264_10111576 | Ga0268264_101115762 | 274 |
| 104 | 3300031911 | Ga0307412_10071279 | Ga0307412_100712793 | 274 |
| 105 | 3300032002 | Ga0307416_100197355 | Ga0307416_1001973552 | 274 |
| 106 | 3300032005 | Ga0307411_10609413 | Ga0307411_106094131 | 274 |
| 107 | 3300042014 | Ga0439457_024855 | Ga0439457_024855_114_962 | 274 |
| 108 | 3300046515 | Ga0495620_0041269 | Ga0495620_0041269_234_1124 | 274 |
| 109 | 3300046520 | Ga0495637_0021992 | Ga0495637_0021992_1314_2204 | 274 |
| 110 | 3300046524 | Ga0495648_0127719 | Ga0495648_0127719_247_1137 | 274 |
| 111 | 3300046660 | Ga0495625_0092376 | Ga0495625_0092376_572_1462 | 274 |
| 112 | 3300046674 | Ga0495588_0031063 | Ga0495588_0031063_1349_2239 | 274 |
| 113 | 3300046683 | Ga0495658_0336209 | Ga0495658_0336209_16_906 | 274 |
| 114 | 3300048919 | Ga0496116_0044916 | Ga0496116_0044916_1350_2246 | 274 |
| 115 | 3300048924 | Ga0496121_0180064 | Ga0496121_0180064_42_938 | 274 |
| 116 | 3300048925 | Ga0496122_0200657 | Ga0496122_0200657_91_987 | 274 |
| 117 | 3300048926 | Ga0496123_0054443 | Ga0496123_0054443_105_1001 | 274 |
| 118 | 3300050490 | nmdc:mga03n38_55764_c1 | nmdc:mga03n38_55764_c1_732_1613 | 274 |
| 119 | 3300050492 | nmdc:mga0yw44_133478_c1 | nmdc:mga0yw44_133478_c1_613_1494 | 274 |
| 120 | 3300050493 | nmdc:mga0k408_17654_c1 | nmdc:mga0k408_17654_c1_1569_2450 | 274 |
| 121 | 3300050494 | nmdc:mga06z11_116231_c1 | nmdc:mga06z11_116231_c1_38_919 | 274 |
| 122 | 3300053079 | Ga0500610_0023766 | Ga0500610_0023766_447_1337 | 274 |
| 123 | 3300053121 | Ga0500607_003662 | Ga0500607_003662_9771_10661 | 274 |
| 124 | iso_pu_bacteria | 2738541277 | 2738717323 | 274 |
| 125 | iso_pu_bacteria | 2738543019 | 2739278009 | 274 |
| 126 | iso_pu_bacteria | 2945909444 | 2945911136 | 274 |
| 127 | 3300002739 | JGI25158J39367_1007490 | JGI25158J39367_10074902 | 275 |
| 128 | 3300002774 | JGI25150J39212_1001112 | JGI25150J39212_10011128 | 275 |
| 129 | 3300002987 | JGI25159J45721_1001424 | JGI25159J45721_10014246 | 275 |
| 130 | 3300003187 | JGI25151J46595_10003442 | JGI25151J46595_100034426 | 275 |
| 131 | 3300003215 | JGI25153J46596_10003509 | JGI25153J46596_100035096 | 275 |
| 132 | 3300003215 | JGI25153J46596_10024776 | JGI25153J46596_100247762 | 275 |
| 133 | 3300003354 | JGI25160J50197_1001928 | JGI25160J50197_10019286 | 275 |
| 134 | 3300003374 | JGI25161J50226_1001375 | JGI25161J50226_10013753 | 275 |
| 135 | 3300003374 | JGI25161J50226_1002423 | JGI25161J50226_10024233 | 275 |
| 136 | 3300003578 | Ga0006562J51391_1083753 | Ga0006562J51391_10837532 | 275 |
| 137 | 3300003760 | Ga0055527_1004559 | Ga0055527_10045592 | 275 |
| 138 | 3300003761 | Ga0055535_1001422 | Ga0055535_10014227 | 275 |
| 139 | 3300003762 | Ga0055542_1000109 | Ga0055542_1000109111 | 275 |
| 140 | 3300003771 | Ga0055526_1005481 | Ga0055526_10054816 | 275 |
| 141 | 3300003771 | Ga0055526_1005616 | Ga0055526_10056166 | 275 |
| 142 | 3300003773 | Ga0055537_1000195 | Ga0055537_100019543 | 275 |
| 143 | 3300003773 | Ga0055537_1001992 | Ga0055537_10019926 | 275 |
| 144 | 3300003775 | Ga0055524_1003731 | Ga0055524_10037316 | 275 |
| 145 | 3300003775 | Ga0055524_1009153 | Ga0055524_10091532 | 275 |
| 146 | 3300003781 | Ga0055536_1002896 | Ga0055536_10028968 | 275 |
| 147 | 3300003781 | Ga0055536_1003710 | Ga0055536_10037104 | 275 |
| 148 | 3300003781 | Ga0055536_1008623 | Ga0055536_10086233 | 275 |
| 149 | 3300003784 | Ga0055534_1000285 | Ga0055534_100028534 | 275 |
| 150 | 3300003784 | Ga0055534_1001560 | Ga0055534_10015605 | 275 |
| 151 | 3300003790 | Ga0055528_1002453 | Ga0055528_10024536 | 275 |
| 152 | 3300003790 | Ga0055528_1002896 | Ga0055528_10028964 | 275 |
| 153 | 3300003791 | Ga0055530_10000495 | Ga0055530_1000049524 | 275 |
| 154 | 3300003791 | Ga0055530_10005626 | Ga0055530_100056264 | 275 |
| 155 | 3300003792 | Ga0055540_1002205 | Ga0055540_10022057 | 275 |
| 156 | 3300003792 | Ga0055540_1003089 | Ga0055540_10030895 | 275 |
| 157 | 3300003792 | Ga0055540_1004833 | Ga0055540_10048334 | 275 |
| 158 | 3300003792 | Ga0055540_1005512 | Ga0055540_10055123 | 275 |
| 159 | 3300003794 | Ga0055531_10002052 | Ga0055531_100020522 | 275 |
| 160 | 3300003794 | Ga0055531_10002338 | Ga0055531_100023387 | 275 |
| 161 | 3300003794 | Ga0055531_10003743 | Ga0055531_100037436 | 275 |
| 162 | 3300004625 | Ga0055543_1001345 | Ga0055543_10013456 | 275 |
| 163 | 3300004625 | Ga0055543_1015707 | Ga0055543_10157072 | 275 |
| 164 | 3300005262 | Ga0065165_1003856 | Ga0065165_10038566 | 275 |
| 165 | 3300005262 | Ga0065165_1030924 | Ga0065165_10309242 | 275 |
| 166 | 3300005288 | Ga0065714_10007224 | Ga0065714_100072243 | 275 |
| 167 | 3300005366 | Ga0070659_100085977 | Ga0070659_1000859772 | 275 |
| 168 | 3300005457 | Ga0070662_100224053 | Ga0070662_1002240532 | 275 |
| 169 | 3300005457 | Ga0070662_100252724 | Ga0070662_1002527242 | 275 |
| 170 | 3300005536 | Ga0070697_100036413 | Ga0070697_1000364135 | 275 |
| 171 | 3300005539 | Ga0068853_100013928 | Ga0068853_1000139282 | 275 |
| 172 | 3300005564 | Ga0070664_100011902 | Ga0070664_1000119028 | 275 |
| 173 | 3300005616 | Ga0068852_100186786 | Ga0068852_1001867862 | 275 |
| 174 | 3300005844 | Ga0068862_100065534 | Ga0068862_1000655342 | 275 |
| 175 | 3300006038 | Ga0075365_10023759 | Ga0075365_100237592 | 275 |
| 176 | 3300006048 | Ga0075363_100011081 | Ga0075363_1000110812 | 275 |
| 177 | 3300006048 | Ga0075363_100019974 | Ga0075363_1000199743 | 275 |
| 178 | 3300006051 | Ga0075364_10047864 | Ga0075364_100478642 | 275 |
| 179 | 3300006051 | Ga0075364_10058901 | Ga0075364_100589013 | 275 |
| 180 | 3300006177 | Ga0075362_10037146 | Ga0075362_100371462 | 275 |
| 181 | 3300006177 | Ga0075362_10082346 | Ga0075362_100823462 | 275 |
| 182 | 3300006195 | Ga0075366_10015053 | Ga0075366_100150532 | 275 |
| 183 | 3300006353 | Ga0075370_10006104 | Ga0075370_100061045 | 275 |
| 184 | 3300006353 | Ga0075370_10039862 | Ga0075370_100398622 | 275 |
| 185 | 3300006353 | Ga0075370_10101600 | Ga0075370_101016002 | 275 |
| 186 | 3300006948 | Ga0099826_10001304 | Ga0099826_1000130412 | 275 |
| 187 | 3300009036 | Ga0105244_10005148 | Ga0105244_100051489 | 275 |
| 188 | 3300009148 | Ga0105243_10000200 | Ga0105243_100002005 | 275 |
| 189 | 3300009148 | Ga0105243_10004089 | Ga0105243_100040898 | 275 |
| 190 | 3300009148 | Ga0105243_10078507 | Ga0105243_100785072 | 275 |
| 191 | 3300011119 | Ga0105246_10051231 | Ga0105246_100512313 | 275 |
| 192 | 3300013100 | Ga0157373_10129396 | Ga0157373_101293962 | 275 |
| 193 | 3300013100 | Ga0157373_10264740 | Ga0157373_102647402 | 275 |
| 194 | 3300013105 | Ga0157369_10015892 | Ga0157369_100158923 | 275 |
| 195 | 3300014497 | Ga0182008_10006481 | Ga0182008_100064816 | 275 |
| 196 | 3300015261 | Ga0182006_1012639 | Ga0182006_10126394 | 275 |
| 197 | 3300015262 | Ga0182007_10002662 | Ga0182007_100026629 | 275 |
| 198 | 3300017792 | Ga0163161_10000079 | Ga0163161_100000797 | 275 |
| 199 | 3300017792 | Ga0163161_10077868 | Ga0163161_100778682 | 275 |
| 200 | 3300021361 | Ga0213872_10005591 | Ga0213872_100055911 | 275 |
| 201 | 3300025208 | Ga0209436_108606 | Ga0209436_1086062 | 275 |
| 202 | 3300025228 | Ga0209672_100979 | Ga0209672_10097913 | 275 |
| 203 | 3300025229 | Ga0209147_102886 | Ga0209147_1028863 | 275 |
| 204 | 3300025242 | Ga0209258_100048 | Ga0209258_100048111 | 275 |
| 205 | 3300025245 | Ga0207425_1000107 | Ga0207425_100010764 | 275 |
| 206 | 3300025245 | Ga0207425_1007836 | Ga0207425_10078363 | 275 |
| 207 | 3300025254 | Ga0209148_1000040 | Ga0209148_1000040111 | 275 |
| 208 | 3300025258 | Ga0209129_1000007 | Ga0209129_100000755 | 275 |
| 209 | 3300025258 | Ga0209129_1008679 | Ga0209129_10086793 | 275 |
| 210 | 3300025263 | Ga0209565_1000087 | Ga0209565_100008743 | 275 |
| 211 | 3300025263 | Ga0209565_1001141 | Ga0209565_10011419 | 275 |
| 212 | 3300025263 | Ga0209565_1006544 | Ga0209565_10065443 | 275 |
| 213 | 3300025273 | Ga0209673_1000145 | Ga0209673_100014543 | 275 |
| 214 | 3300025273 | Ga0209673_1000559 | Ga0209673_10005596 | 275 |
| 215 | 3300025273 | Ga0209673_1000636 | Ga0209673_100063656 | 275 |
| 216 | 3300025273 | Ga0209673_1003414 | Ga0209673_10034149 | 275 |
| 217 | 3300025273 | Ga0209673_1020967 | Ga0209673_10209672 | 275 |
| 218 | 3300025284 | Ga0209130_1000215 | Ga0209130_100021516 | 275 |
| 219 | 3300025284 | Ga0209130_1000341 | Ga0209130_100034123 | 275 |
| 220 | 3300025291 | Ga0209675_1000085 | Ga0209675_100008543 | 275 |
| 221 | 3300025291 | Ga0209675_1001865 | Ga0209675_10018658 | 275 |
| 222 | 3300025292 | Ga0209676_1000004 | Ga0209676_1000004796 | 275 |
| 223 | 3300025292 | Ga0209676_1000071 | Ga0209676_1000071206 | 275 |
| 224 | 3300025292 | Ga0209676_1000172 | Ga0209676_100017260 | 275 |
| 225 | 3300025292 | Ga0209676_1005241 | Ga0209676_10052416 | 275 |
| 226 | 3300025294 | Ga0209025_1000507 | Ga0209025_10005077 | 275 |
| 227 | 3300025295 | Ga0209564_1000200 | Ga0209564_1000200133 | 275 |
| 228 | 3300025295 | Ga0209564_1000318 | Ga0209564_100031877 | 275 |
| 229 | 3300025297 | Ga0209758_1000025 | Ga0209758_1000025471 | 275 |
| 230 | 3300025297 | Ga0209758_1046212 | Ga0209758_10462122 | 275 |
| 231 | 3300025298 | Ga0209050_1000002 | Ga0209050_10000021306 | 275 |
| 232 | 3300025298 | Ga0209050_1000509 | Ga0209050_10005099 | 275 |
| 233 | 3300025298 | Ga0209050_1019262 | Ga0209050_10192622 | 275 |
| 234 | 3300025299 | Ga0209256_1000067 | Ga0209256_100006766 | 275 |
| 235 | 3300025299 | Ga0209256_1000198 | Ga0209256_100019877 | 275 |
| 236 | 3300025302 | Ga0207426_1000001 | Ga0207426_1000001107 | 275 |
| 237 | 3300025302 | Ga0207426_1000178 | Ga0207426_100017861 | 275 |
| 238 | 3300025302 | Ga0207426_1000264 | Ga0207426_100026458 | 275 |
| 239 | 3300025303 | Ga0209051_1000002 | Ga0209051_10000021076 | 275 |
| 240 | 3300025303 | Ga0209051_1000096 | Ga0209051_1000096109 | 275 |
| 241 | 3300025303 | Ga0209051_1000169 | Ga0209051_100016988 | 275 |
| 242 | 3300025303 | Ga0209051_1000278 | Ga0209051_100027862 | 275 |
| 243 | 3300025303 | Ga0209051_1000342 | Ga0209051_10003422 | 275 |
| 244 | 3300025303 | Ga0209051_1000397 | Ga0209051_100039749 | 275 |
| 245 | 3300025304 | Ga0209257_1000002 | Ga0209257_10000021217 | 275 |
| 246 | 3300025304 | Ga0209257_1000072 | Ga0209257_1000072224 | 275 |
| 247 | 3300025304 | Ga0209257_1000497 | Ga0209257_100049758 | 275 |
| 248 | 3300025304 | Ga0209257_1001087 | Ga0209257_100108724 | 275 |
| 249 | 3300025304 | Ga0209257_1005665 | Ga0209257_10056655 | 275 |
| 250 | 3300025304 | Ga0209257_1006992 | Ga0209257_10069924 | 275 |
| 251 | 3300025728 | Ga0207655_1001662 | Ga0207655_10016623 | 275 |
| 252 | 3300025933 | Ga0207706_10141781 | Ga0207706_101417812 | 275 |
| 253 | 3300025935 | Ga0207709_10000038 | Ga0207709_1000003868 | 275 |
| 254 | 3300025935 | Ga0207709_10001681 | Ga0207709_1000168114 | 275 |
| 255 | 3300025935 | Ga0207709_10006910 | Ga0207709_100069107 | 275 |
| 256 | 3300025942 | Ga0207689_10104271 | Ga0207689_101042711 | 275 |
| 257 | 3300025945 | Ga0207679_10062927 | Ga0207679_100629272 | 275 |
| 258 | 3300025949 | Ga0207667_10060380 | Ga0207667_100603803 | 275 |
| 259 | 3300026041 | Ga0207639_10010000 | Ga0207639_100100007 | 275 |
| 260 | 3300026116 | Ga0207674_10159225 | Ga0207674_101592252 | 275 |
| 261 | 3300026142 | Ga0207698_10543853 | Ga0207698_105438531 | 275 |
| 262 | 3300028380 | Ga0268265_10060528 | Ga0268265_100605283 | 275 |
| 263 | 3300030742 | Ga0316183_1124715 | Ga0316183_11247152 | 275 |
| 264 | 3300031456 | Ga0307513_10001731 | Ga0307513_1000173125 | 275 |
| 265 | 3300031548 | Ga0307408_100000200 | Ga0307408_10000020033 | 275 |
| 266 | 3300031548 | Ga0307408_100134837 | Ga0307408_1001348372 | 275 |
| 267 | 3300031548 | Ga0307408_100280050 | Ga0307408_1002800502 | 275 |
| 268 | 3300031730 | Ga0307516_10006719 | Ga0307516_1000671910 | 275 |
| 269 | 3300031731 | Ga0307405_10022557 | Ga0307405_100225573 | 275 |
| 270 | 3300031731 | Ga0307405_10162074 | Ga0307405_101620742 | 275 |
| 271 | 3300031901 | Ga0307406_10004441 | Ga0307406_100044415 | 275 |
| 272 | 3300031901 | Ga0307406_10150811 | Ga0307406_101508112 | 275 |
| 273 | 3300031911 | Ga0307412_10007892 | Ga0307412_100078926 | 275 |
| 274 | 3300032004 | Ga0307414_10081926 | Ga0307414_100819262 | 275 |
| 275 | 3300032004 | Ga0307414_10131848 | Ga0307414_101318482 | 275 |
| 276 | 3300037471 | Ga0395905_0000421 | Ga0395905_0000421_44546_45406 | 275 |
| 277 | 3300039447 | Ga0436361_1143890 | Ga0436361_1143890_6919_7845 | 275 |
| 278 | 3300041404 | Ga0439436_0006508 | Ga0439436_0006508_736_1635 | 275 |
| 279 | 3300041410 | Ga0439461_0014337 | Ga0439461_0014337_335_1234 | 275 |
| 280 | 3300041413 | Ga0439465_0001810 | Ga0439465_0001810_5691_6590 | 275 |
| 281 | 3300041496 | Ga0451839_1198531 | Ga0451839_1198531_105_1007 | 275 |
| 282 | 3300041997 | Ga0439431_0001122 | Ga0439431_0001122_2575_3474 | 275 |
| 283 | 3300042004 | Ga0439445_0001661 | Ga0439445_0001661_1378_2277 | 275 |
| 284 | 3300042006 | Ga0439432_003301 | Ga0439432_003301_3098_3997 | 275 |
| 285 | 3300042007 | Ga0439449_0002844 | Ga0439449_0002844_1035_1934 | 275 |
| 286 | 3300042010 | Ga0439452_004527 | Ga0439452_004527_2393_3292 | 275 |
| 287 | 3300042014 | Ga0439457_005798 | Ga0439457_005798_1951_2850 | 275 |
| 288 | 3300042015 | Ga0439462_0019581 | Ga0439462_0019581_400_1299 | 275 |
| 289 | 3300042876 | Ga0451577_0592001 | Ga0451577_0592001_30_920 | 275 |
| 290 | 3300046453 | Ga0495627_017433 | Ga0495627_017433_1436_2335 | 275 |
| 291 | 3300046460 | Ga0495638_0082054 | Ga0495638_0082054_664_1572 | 275 |
| 292 | 3300046515 | Ga0495620_0029354 | Ga0495620_0029354_1405_2313 | 275 |
| 293 | 3300046518 | Ga0495631_0000021 | Ga0495631_0000021_80694_81602 | 275 |
| 294 | 3300046522 | Ga0495643_0111984 | Ga0495643_0111984_11_889 | 275 |
| 295 | 3300046558 | Ga0495633_0001670 | Ga0495633_0001670_7137_8000 | 275 |
| 296 | 3300046616 | Ga0495668_0057402 | Ga0495668_0057402_858_1766 | 275 |
| 297 | 3300046648 | Ga0495611_0008518 | Ga0495611_0008518_603_1466 | 275 |
| 298 | 3300046660 | Ga0495625_0000012 | Ga0495625_0000012_232138_233034 | 275 |
| 299 | 3300046660 | Ga0495625_0033882 | Ga0495625_0033882_1683_2591 | 275 |
| 300 | 3300046660 | Ga0495625_0146286 | Ga0495625_0146286_153_1016 | 275 |
| 301 | 3300046665 | Ga0495661_0011511 | Ga0495661_0011511_1184_2047 | 275 |
| 302 | 3300046683 | Ga0495658_0042706 | Ga0495658_0042706_175_1095 | 275 |
| 303 | 3300046691 | Ga0495670_0001518 | Ga0495670_0001518_7101_7964 | 275 |
| 304 | 3300046692 | Ga0495671_0026731 | Ga0495671_0026731_430_1329 | 275 |
| 305 | 3300046794 | Ga0495589_0015362 | Ga0495589_0015362_2786_3649 | 275 |
| 306 | 3300047445 | Ga0495677_0000874 | Ga0495677_0000874_3170_4033 | 275 |
| 307 | 3300047470 | Ga0495681_0009255 | Ga0495681_0009255_4701_5564 | 275 |
| 308 | 3300048089 | Ga0495614_0003864 | Ga0495614_0003864_2087_3007 | 275 |
| 309 | 3300048920 | Ga0496117_0011160 | Ga0496117_0011160_1526_2449 | 275 |
| 310 | 3300048920 | Ga0496117_0030126 | Ga0496117_0030126_1934_2830 | 275 |
| 311 | 3300048921 | Ga0496118_0102292 | Ga0496118_0102292_764_1687 | 275 |
| 312 | 3300048921 | Ga0496118_0238353 | Ga0496118_0238353_37_933 | 275 |
| 313 | 3300048922 | Ga0496119_0038364 | Ga0496119_0038364_880_1788 | 275 |
| 314 | 3300048924 | Ga0496121_0085656 | Ga0496121_0085656_1256_2164 | 275 |
| 315 | 3300048926 | Ga0496123_0091973 | Ga0496123_0091973_329_1237 | 275 |
| 316 | 3300048927 | Ga0496124_0046565 | Ga0496124_0046565_1463_2359 | 275 |
| 317 | 3300048927 | Ga0496124_0068685 | Ga0496124_0068685_1373_2296 | 275 |
| 318 | 3300048928 | Ga0496125_0006952 | Ga0496125_0006952_5391_6287 | 275 |
| 319 | 3300048928 | Ga0496125_0036027 | Ga0496125_0036027_3152_4060 | 275 |
| 320 | 3300048928 | Ga0496125_0087016 | Ga0496125_0087016_655_1578 | 275 |
| 321 | 3300049679 | Ga0501249_006096 | Ga0501249_006096_1524_2432 | 275 |
| 322 | 3300050489 | nmdc:mga03683_12981_c1 | nmdc:mga03683_12981_c1_1588_2496 | 275 |
| 323 | 3300050489 | nmdc:mga03683_24037_c1 | nmdc:mga03683_24037_c1_1098_2006 | 275 |
| 324 | 3300050489 | nmdc:mga03683_60615_c1 | nmdc:mga03683_60615_c1_452_1360 | 275 |
| 325 | 3300050490 | nmdc:mga03n38_19842_c1 | nmdc:mga03n38_19842_c1_1239_2114 | 275 |
| 326 | 3300050490 | nmdc:mga03n38_41284_c1 | nmdc:mga03n38_41284_c1_1071_1979 | 275 |
| 327 | 3300050491 | nmdc:mga00v17_41129_c1 | nmdc:mga00v17_41129_c1_242_1150 | 275 |
| 328 | 3300050493 | nmdc:mga0k408_125039_c1 | nmdc:mga0k408_125039_c1_18_926 | 275 |
| 329 | 3300050493 | nmdc:mga0k408_151760_c1 | nmdc:mga0k408_151760_c1_261_1169 | 275 |
| 330 | 3300050496 | nmdc:mga07m45_12514_c1 | nmdc:mga07m45_12514_c1_61_957 | 275 |
| 331 | 3300050496 | nmdc:mga07m45_15913_c1 | nmdc:mga07m45_15913_c1_1051_1959 | 275 |
| 332 | 3300050496 | nmdc:mga07m45_16947_c1 | nmdc:mga07m45_16947_c1_719_1615 | 275 |
| 333 | 3300053087 | Ga0500643_012105 | Ga0500643_012105_1558_2478 | 275 |
| 334 | 3300053093 | Ga0500651_0000095 | Ga0500651_0000095_11332_12252 | 275 |
| 335 | 3300053110 | Ga0500571_000379 | Ga0500571_000379_10884_11804 | 275 |
| 336 | 3300053116 | Ga0500592_019484 | Ga0500592_019484_94_1002 | 275 |
| 337 | 3300053117 | Ga0500593_022497 | Ga0500593_022497_1399_2298 | 275 |
| 338 | 3300053118 | Ga0500594_0001104 | Ga0500594_0001104_1067_1975 | 275 |
| 339 | 3300053128 | Ga0500626_018467 | Ga0500626_018467_1508_2416 | 275 |
| 340 | 3300053133 | Ga0500655_003070 | Ga0500655_003070_1689_2609 | 275 |
| 341 | 3300053134 | Ga0500658_0000763 | Ga0500658_0000763_4680_5600 | 275 |
| 342 | 3300053134 | Ga0500658_0000783 | Ga0500658_0000783_6286_7194 | 275 |
| 343 | 3300053138 | Ga0500564_062282 | Ga0500564_062282_107_1027 | 275 |
| 344 | 3300053139 | Ga0500568_0004399 | Ga0500568_0004399_4249_5157 | 275 |
| 345 | 3300053153 | Ga0500616_0025191 | Ga0500616_0025191_191_1099 | 275 |
| 346 | 3300053161 | Ga0500634_0041574 | Ga0500634_0041574_1275_2150 | 275 |
| 347 | iso_pu_bacteria | 2513020051 | 2513229097 | 275 |
| 348 | iso_pu_bacteria | 2599185214 | 2599624850 | 275 |
| 349 | iso_pu_bacteria | 2599185226 | 2599672862 | 275 |
| 350 | iso_pu_bacteria | 2599185227 | 2599682688 | 275 |
| 351 | iso_pu_bacteria | 2599185229 | 2599694471 | 275 |
| 352 | iso_pu_bacteria | 2643221628 | 2644162479 | 275 |
| 353 | iso_pu_bacteria | 2643221658 | 2644329181 | 275 |
| 354 | iso_pu_bacteria | 2643221672 | 2644401725 | 275 |
| 355 | iso_pu_bacteria | 2643221683 | 2644467835 | 275 |
| 356 | iso_pu_bacteria | 2738541307 | 2738878899 | 275 |
| 357 | iso_pu_bacteria | 2818991446 | 2819596790 | 275 |
| 358 | iso_pu_bacteria | 2831265667 | 2831265906 | 275 |
| 359 | iso_pu_bacteria | 2838054893 | 2838060815 | 275 |
| 360 | iso_pu_bacteria | 2842677519 | 2842678397 | 275 |
| 361 | iso_pu_bacteria | 2885192300 | 2885197374 | 275 |
| 362 | iso_pu_bacteria | 2885198086 | 2885203553 | 275 |
| 363 | iso_pu_bacteria | 2885211737 | 2885217097 | 275 |
| 364 | iso_pu_bacteria | 2899924645 | 2899930426 | 275 |
| 365 | iso_pu_bacteria | 2904449895 | 2904455048 | 275 |
| 366 | iso_pu_bacteria | 2904456579 | 2904457408 | 275 |
| 367 | iso_pu_bacteria | 2904541872 | 2904543855 | 275 |
| 368 | iso_pu_bacteria | 2919462493 | 2919465187 | 275 |
| 369 | iso_pu_bacteria | 2919704043 | 2919708745 | 275 |
| 370 | iso_pu_bacteria | 2928037797 | 2928039539 | 275 |
| 371 | iso_pu_bacteria | 2928044640 | 2928044856 | 275 |
| 372 | iso_pu_bacteria | 2928051484 | 2928052657 | 275 |
| 373 | iso_pu_bacteria | 2928064002 | 2928064682 | 275 |
| 374 | iso_pu_bacteria | 2928070936 | 2928074891 | 275 |
| 375 | iso_pu_bacteria | 2928084124 | 2928089031 | 275 |
| 376 | iso_pu_bacteria | 2929160207 | 2929162587 | 275 |
| 377 | iso_pu_bacteria | 2929520902 | 2929525154 | 275 |
| 378 | iso_pu_bacteria | 2945945610 | 2945948517 | 275 |
| 379 | iso_pu_bacteria | 2945972063 | 2945977791 | 275 |
| 380 | iso_pu_bacteria | 2945984333 | 2945986563 | 275 |
| 381 | iso_pu_bacteria | 2954767861 | 2954772742 | 275 |
| 382 | 3300006051 | Ga0075364_10015537 | Ga0075364_100155372 | 276 |
| 383 | 3300006195 | Ga0075366_10013726 | Ga0075366_100137263 | 276 |
| 384 | 3300009176 | Ga0105242_10003462 | Ga0105242_100034625 | 276 |
| 385 | 3300013297 | Ga0157378_10115984 | Ga0157378_101159842 | 276 |
| 386 | 3300025922 | Ga0207646_10222534 | Ga0207646_102225341 | 276 |
| 387 | 3300025934 | Ga0207686_10057835 | Ga0207686_100578352 | 276 |
| 388 | 3300049576 | Ga0501040_0096319 | Ga0501040_0096319_619_1476 | 276 |
| 389 | 3300049578 | Ga0501042_0026616 | Ga0501042_0026616_1830_2687 | 276 |
| 390 | 3300049580 | Ga0501046_0121496 | Ga0501046_0121496_688_1545 | 276 |
| 391 | 3300049582 | Ga0501048_0016755 | Ga0501048_0016755_1593_2450 | 276 |
| 392 | 3300049587 | Ga0501071_0063292 | Ga0501071_0063292_742_1599 | 276 |
| 393 | 3300049588 | Ga0501072_0004600 | Ga0501072_0004600_9070_9927 | 276 |
| 394 | 3300049591 | Ga0501075_0001513 | Ga0501075_0001513_291_1148 | 276 |
| 395 | 3300049592 | Ga0501076_0004572 | Ga0501076_0004572_1064_1921 | 276 |
| 396 | 3300049593 | Ga0501077_0197583 | Ga0501077_0197583_132_989 | 276 |
| 397 | 3300049741 | Ga0501079_0003913 | Ga0501079_0003913_3258_4115 | 276 |
| 398 | 3300049742 | Ga0501080_0004252 | Ga0501080_0004252_2717_3574 | 276 |
| 399 | 3300049824 | Ga0501045_0003295 | Ga0501045_0003295_3337_4194 | 276 |
| 400 | 3300050491 | nmdc:mga00v17_30844_c1 | nmdc:mga00v17_30844_c1_315_1226 | 276 |
| 401 | 3300060353 | Ga0501082_0015479 | Ga0501082_0015479_2953_3810 | 276 |
| 402 | 3300061734 | Ga0530510_0003286 | Ga0530510_0003286_3683_4540 | 276 |
| 403 | 3300005293 | Ga0065715_10120017 | Ga0065715_101200172 | 277 |
| 404 | 3300005328 | Ga0070676_10214323 | Ga0070676_102143232 | 277 |
| 405 | 3300005331 | Ga0070670_100027478 | Ga0070670_1000274784 | 277 |
| 406 | 3300005333 | Ga0070677_10001855 | Ga0070677_100018554 | 277 |
| 407 | 3300005333 | Ga0070677_10009884 | Ga0070677_100098843 | 277 |
| 408 | 3300005338 | Ga0068868_100065308 | Ga0068868_1000653082 | 277 |
| 409 | 3300005353 | Ga0070669_100002821 | Ga0070669_10000282112 | 277 |
| 410 | 3300005354 | Ga0070675_100003763 | Ga0070675_1000037637 | 277 |
| 411 | 3300005355 | Ga0070671_100022052 | Ga0070671_1000220524 | 277 |
| 412 | 3300005356 | Ga0070674_100010570 | Ga0070674_1000105705 | 277 |
| 413 | 3300005364 | Ga0070673_100234349 | Ga0070673_1002343492 | 277 |
| 414 | 3300005367 | Ga0070667_100024167 | Ga0070667_1000241674 | 277 |
| 415 | 3300005435 | Ga0070714_100076498 | Ga0070714_1000764982 | 277 |
| 416 | 3300005456 | Ga0070678_100008716 | Ga0070678_1000087165 | 277 |
| 417 | 3300005459 | Ga0068867_100213875 | Ga0068867_1002138752 | 277 |
| 418 | 3300005530 | Ga0070679_100124053 | Ga0070679_1001240534 | 277 |
| 419 | 3300005530 | Ga0070679_100125205 | Ga0070679_1001252054 | 277 |
| 420 | 3300005543 | Ga0070672_100011724 | Ga0070672_1000117243 | 277 |
| 421 | 3300005563 | Ga0068855_100015898 | Ga0068855_1000158984 | 277 |
| 422 | 3300005614 | Ga0068856_100141167 | Ga0068856_1001411673 | 277 |
| 423 | 3300005616 | Ga0068852_100115168 | Ga0068852_1001151682 | 277 |
| 424 | 3300005618 | Ga0068864_100061606 | Ga0068864_1000616062 | 277 |
| 425 | 3300006237 | Ga0097621_100025706 | Ga0097621_1000257063 | 277 |
| 426 | 3300009093 | Ga0105240_10000945 | Ga0105240_1000094535 | 277 |
| 427 | 3300009551 | Ga0105238_10121177 | Ga0105238_101211772 | 277 |
| 428 | 3300013308 | Ga0157375_10083529 | Ga0157375_100835292 | 277 |
| 429 | 3300014326 | Ga0157380_10292758 | Ga0157380_102927582 | 277 |
| 430 | 3300014326 | Ga0157380_10706717 | Ga0157380_107067171 | 277 |
| 431 | 3300014969 | Ga0157376_10208506 | Ga0157376_102085062 | 277 |
| 432 | 3300017792 | Ga0163161_10005521 | Ga0163161_100055212 | 277 |
| 433 | 3300025893 | Ga0207682_10029380 | Ga0207682_100293801 | 277 |
| 434 | 3300025893 | Ga0207682_10032517 | Ga0207682_100325171 | 277 |
| 435 | 3300025907 | Ga0207645_10011003 | Ga0207645_100110032 | 277 |
| 436 | 3300025909 | Ga0207705_10335496 | Ga0207705_103354961 | 277 |
| 437 | 3300025913 | Ga0207695_10128363 | Ga0207695_101283632 | 277 |
| 438 | 3300025919 | Ga0207657_10024037 | Ga0207657_100240373 | 277 |
| 439 | 3300025921 | Ga0207652_10159249 | Ga0207652_101592492 | 277 |
| 440 | 3300025923 | Ga0207681_10014220 | Ga0207681_100142202 | 277 |
| 441 | 3300025924 | Ga0207694_10108642 | Ga0207694_101086422 | 277 |
| 442 | 3300025925 | Ga0207650_10003059 | Ga0207650_100030595 | 277 |
| 443 | 3300025926 | Ga0207659_10001323 | Ga0207659_100013237 | 277 |
| 444 | 3300025931 | Ga0207644_10014009 | Ga0207644_100140093 | 277 |
| 445 | 3300025938 | Ga0207704_10155045 | Ga0207704_101550452 | 277 |
| 446 | 3300025940 | Ga0207691_10014001 | Ga0207691_100140017 | 277 |
| 447 | 3300025949 | Ga0207667_10094776 | Ga0207667_100947763 | 277 |
| 448 | 3300025986 | Ga0207658_10008898 | Ga0207658_100088986 | 277 |
| 449 | 3300026023 | Ga0207677_10058187 | Ga0207677_100581872 | 277 |
| 450 | 3300026089 | Ga0207648_10006342 | Ga0207648_1000634212 | 277 |
| 451 | 3300026121 | Ga0207683_10023532 | Ga0207683_100235323 | 277 |
| 452 | 3300026142 | Ga0207698_10178538 | Ga0207698_101785382 | 277 |
| 453 | 3300059426 | Ga0590077_012140 | Ga0590077_012140_98_955 | 277 |
| 454 | 3300005329 | Ga0070683_100302770 | Ga0070683_1003027702 | 278 |
| 455 | 3300005335 | Ga0070666_10056480 | Ga0070666_100564802 | 278 |
| 456 | 3300005338 | Ga0068868_100280567 | Ga0068868_1002805672 | 278 |
| 457 | 3300005341 | Ga0070691_10071370 | Ga0070691_100713702 | 278 |
| 458 | 3300005345 | Ga0070692_10077287 | Ga0070692_100772872 | 278 |
| 459 | 3300005347 | Ga0070668_100068787 | Ga0070668_1000687872 | 278 |
| 460 | 3300005356 | Ga0070674_100023029 | Ga0070674_1000230293 | 278 |
| 461 | 3300005367 | Ga0070667_100021693 | Ga0070667_1000216933 | 278 |
| 462 | 3300005367 | Ga0070667_100320199 | Ga0070667_1003201992 | 278 |
| 463 | 3300005436 | Ga0070713_100000140 | Ga0070713_10000014036 | 278 |
| 464 | 3300005455 | Ga0070663_100028606 | Ga0070663_1000286061 | 278 |
| 465 | 3300005456 | Ga0070678_100070954 | Ga0070678_1000709542 | 278 |
| 466 | 3300005457 | Ga0070662_100033873 | Ga0070662_1000338732 | 278 |
| 467 | 3300005459 | Ga0068867_100000447 | Ga0068867_1000004474 | 278 |
| 468 | 3300005539 | Ga0068853_100117921 | Ga0068853_1001179211 | 278 |
| 469 | 3300005545 | Ga0070695_100031388 | Ga0070695_1000313882 | 278 |
| 470 | 3300005546 | Ga0070696_100490378 | Ga0070696_1004903781 | 278 |
| 471 | 3300005548 | Ga0070665_100552469 | Ga0070665_1005524692 | 278 |
| 472 | 3300005614 | Ga0068856_100013123 | Ga0068856_1000131234 | 278 |
| 473 | 3300005616 | Ga0068852_100261099 | Ga0068852_1002610992 | 278 |
| 474 | 3300005617 | Ga0068859_100350372 | Ga0068859_1003503722 | 278 |
| 475 | 3300005618 | Ga0068864_100227702 | Ga0068864_1002277021 | 278 |
| 476 | 3300005718 | Ga0068866_10047798 | Ga0068866_100477982 | 278 |
| 477 | 3300005841 | Ga0068863_100088314 | Ga0068863_1000883141 | 278 |
| 478 | 3300005842 | Ga0068858_100212283 | Ga0068858_1002122832 | 278 |
| 479 | 3300005843 | Ga0068860_100011430 | Ga0068860_1000114303 | 278 |
| 480 | 3300005843 | Ga0068860_100160380 | Ga0068860_1001603802 | 278 |
| 481 | 3300005844 | Ga0068862_100034751 | Ga0068862_1000347513 | 278 |
| 482 | 3300006195 | Ga0075366_10012633 | Ga0075366_100126334 | 278 |
| 483 | 3300006195 | Ga0075366_10048998 | Ga0075366_100489982 | 278 |
| 484 | 3300006353 | Ga0075370_10020735 | Ga0075370_100207353 | 278 |
| 485 | 3300006353 | Ga0075370_10190614 | Ga0075370_101906142 | 278 |
| 486 | 3300006844 | Ga0075428_100221658 | Ga0075428_1002216582 | 278 |
| 487 | 3300006881 | Ga0068865_100104083 | Ga0068865_1001040832 | 278 |
| 488 | 3300006931 | Ga0097620_100350339 | Ga0097620_1003503392 | 278 |
| 489 | 3300009093 | Ga0105240_10012575 | Ga0105240_100125758 | 278 |
| 490 | 3300009094 | Ga0111539_10733500 | Ga0111539_107335002 | 278 |
| 491 | 3300009094 | Ga0111539_11085566 | Ga0111539_110855661 | 278 |
| 492 | 3300009098 | Ga0105245_10212076 | Ga0105245_102120762 | 278 |
| 493 | 3300009148 | Ga0105243_10000702 | Ga0105243_1000070215 | 278 |
| 494 | 3300009545 | Ga0105237_10000823 | Ga0105237_1000082326 | 278 |
| 495 | 3300009551 | Ga0105238_10020717 | Ga0105238_100207177 | 278 |
| 496 | 3300009553 | Ga0105249_10072561 | Ga0105249_100725612 | 278 |
| 497 | 3300009553 | Ga0105249_10073716 | Ga0105249_100737162 | 278 |
| 498 | 3300010375 | Ga0105239_10010731 | Ga0105239_100107311 | 278 |
| 499 | 3300013297 | Ga0157378_10059591 | Ga0157378_100595912 | 278 |
| 500 | 3300013306 | Ga0163162_10028368 | Ga0163162_100283683 | 278 |
| 501 | 3300013306 | Ga0163162_10274017 | Ga0163162_102740172 | 278 |
| 502 | 3300013308 | Ga0157375_10131121 | Ga0157375_101311212 | 278 |
| 503 | 3300013308 | Ga0157375_10283178 | Ga0157375_102831782 | 278 |
| 504 | 3300014745 | Ga0157377_10000027 | Ga0157377_1000002798 | 278 |
| 505 | 3300014968 | Ga0157379_10205326 | Ga0157379_102053262 | 278 |
| 506 | 3300017792 | Ga0163161_10313581 | Ga0163161_103135812 | 278 |
| 507 | 3300025315 | Ga0207697_10017578 | Ga0207697_100175782 | 278 |
| 508 | 3300025913 | Ga0207695_10052257 | Ga0207695_100522573 | 278 |
| 509 | 3300025914 | Ga0207671_10004092 | Ga0207671_100040929 | 278 |
| 510 | 3300025915 | Ga0207693_10073887 | Ga0207693_100738872 | 278 |
| 511 | 3300025919 | Ga0207657_10032138 | Ga0207657_100321382 | 278 |
| 512 | 3300025923 | Ga0207681_10441542 | Ga0207681_104415422 | 278 |
| 513 | 3300025924 | Ga0207694_10007400 | Ga0207694_100074006 | 278 |
| 514 | 3300025933 | Ga0207706_10121038 | Ga0207706_101210382 | 278 |
| 515 | 3300025935 | Ga0207709_10000526 | Ga0207709_1000052620 | 278 |
| 516 | 3300025935 | Ga0207709_10147595 | Ga0207709_101475952 | 278 |
| 517 | 3300025937 | Ga0207669_10012633 | Ga0207669_100126332 | 278 |
| 518 | 3300025938 | Ga0207704_10007994 | Ga0207704_100079942 | 278 |
| 519 | 3300025938 | Ga0207704_10140604 | Ga0207704_101406042 | 278 |
| 520 | 3300025986 | Ga0207658_10005361 | Ga0207658_100053615 | 278 |
| 521 | 3300025986 | Ga0207658_10174344 | Ga0207658_101743442 | 278 |
| 522 | 3300025986 | Ga0207658_10190111 | Ga0207658_101901112 | 278 |
| 523 | 3300026023 | Ga0207677_10201962 | Ga0207677_102019622 | 278 |
| 524 | 3300026023 | Ga0207677_10232751 | Ga0207677_102327512 | 278 |
| 525 | 3300026035 | Ga0207703_10231325 | Ga0207703_102313252 | 278 |
| 526 | 3300026067 | Ga0207678_10006353 | Ga0207678_100063533 | 278 |
| 527 | 3300026089 | Ga0207648_10000119 | Ga0207648_1000011941 | 278 |
| 528 | 3300026089 | Ga0207648_10035260 | Ga0207648_100352602 | 278 |
| 529 | 3300026089 | Ga0207648_10062176 | Ga0207648_100621763 | 278 |
| 530 | 3300026089 | Ga0207648_10089200 | Ga0207648_100892002 | 278 |
| 531 | 3300026118 | Ga0207675_100032777 | Ga0207675_1000327772 | 278 |
| 532 | 3300026142 | Ga0207698_10182134 | Ga0207698_101821342 | 278 |
| 533 | 3300028380 | Ga0268265_10204733 | Ga0268265_102047332 | 278 |
| 534 | 3300028381 | Ga0268264_10008551 | Ga0268264_100085515 | 278 |
| 535 | 3300028381 | Ga0268264_10398379 | Ga0268264_103983792 | 278 |
| 536 | 3300028786 | Ga0307517_10081897 | Ga0307517_100818972 | 278 |
| 537 | 3300031730 | Ga0307516_10002973 | Ga0307516_100029733 | 278 |
| 538 | 3300035691 | Ga0373931_0136762 | Ga0373931_0136762_172_1071 | 278 |
| 539 | 3300041410 | Ga0439461_0026663 | Ga0439461_0026663_291_1151 | 278 |
| 540 | 3300042006 | Ga0439432_032244 | Ga0439432_032244_449_1564 | 278 |
| 541 | 3300042007 | Ga0439449_0036098 | Ga0439449_0036098_868_1824 | 278 |
| 542 | 3300042127 | Ga0450890_002360 | Ga0450890_002360_1463_2323 | 278 |
| 543 | 3300042130 | Ga0450892_000160 | Ga0450892_000160_1191_2051 | 278 |
| 544 | 3300042144 | Ga0450889_000338 | Ga0450889_000338_2313_3173 | 278 |
| 545 | 3300046506 | Ga0495583_0000034 | Ga0495583_0000034_79484_80344 | 278 |
| 546 | 3300046507 | Ga0495606_0001750 | Ga0495606_0001750_18271_19131 | 278 |
| 547 | 3300046519 | Ga0495632_0006988 | Ga0495632_0006988_5299_6159 | 278 |
| 548 | 3300046616 | Ga0495668_0114181 | Ga0495668_0114181_383_1243 | 278 |
| 549 | 3300046660 | Ga0495625_0022250 | Ga0495625_0022250_3432_4295 | 278 |
| 550 | 3300046684 | Ga0495669_0015030 | Ga0495669_0015030_918_1778 | 278 |
| 551 | 3300046692 | Ga0495671_0129468 | Ga0495671_0129468_159_1019 | 278 |
| 552 | 3300046694 | Ga0495649_0000470 | Ga0495649_0000470_7458_8318 | 278 |
| 553 | 3300046694 | Ga0495649_0001920 | Ga0495649_0001920_2849_3712 | 278 |
| 554 | 3300046794 | Ga0495589_0005062 | Ga0495589_0005062_1501_2361 | 278 |
| 555 | 3300046810 | Ga0495660_0053780 | Ga0495660_0053780_855_1718 | 278 |
| 556 | 3300048905 | Ga0496102_0065022 | Ga0496102_0065022_396_1253 | 278 |
| 557 | 3300048907 | Ga0496104_0109871 | Ga0496104_0109871_1504_2361 | 278 |
| 558 | 3300048918 | Ga0496115_0183765 | Ga0496115_0183765_449_1321 | 278 |
| 559 | 3300050492 | nmdc:mga0yw44_7767_c1 | nmdc:mga0yw44_7767_c1_1457_2317 | 278 |
| 560 | 3300050493 | nmdc:mga0k408_1652_c1 | nmdc:mga0k408_1652_c1_2072_2932 | 278 |
| 561 | 3300050493 | nmdc:mga0k408_3908_c1 | nmdc:mga0k408_3908_c1_5515_6375 | 278 |
| 562 | 3300050493 | nmdc:mga0k408_9932_c1 | nmdc:mga0k408_9932_c1_3150_4010 | 278 |
| 563 | 3300050494 | nmdc:mga06z11_210980_c1 | nmdc:mga06z11_210980_c1_257_1117 | 278 |
| 564 | 3300050512 | nmdc:mga0n895_299159_c1 | nmdc:mga0n895_299159_c1_750_1616 | 278 |
| 565 | 3300005459 | Ga0068867_100060005 | Ga0068867_1000600052 | 279 |
| 566 | 3300046513 | Ga0495616_0066528 | Ga0495616_0066528_846_1721 | 279 |
| 567 | 3300046542 | Ga0495597_0000157 | Ga0495597_0000157_54274_55149 | 279 |
| 568 | 3300046794 | Ga0495589_0000033 | Ga0495589_0000033_107407_108282 | 279 |
| 569 | 3300003215 | JGI25153J46596_10000620 | JGI25153J46596_1000062015 | 280 |
| 570 | 3300025297 | Ga0209758_1000057 | Ga0209758_1000057265 | 280 |
| 571 | 3300002073 | JGI24745J21846_1000195 | JGI24745J21846_10001952 | 281 |
| 572 | 3300005327 | Ga0070658_10007478 | Ga0070658_100074788 | 281 |
| 573 | 3300005328 | Ga0070676_10251039 | Ga0070676_102510391 | 281 |
| 574 | 3300005329 | Ga0070683_100026879 | Ga0070683_1000268794 | 281 |
| 575 | 3300005334 | Ga0068869_100022542 | Ga0068869_1000225422 | 281 |
| 576 | 3300005337 | Ga0070682_100205776 | Ga0070682_1002057761 | 281 |
| 577 | 3300005343 | Ga0070687_100007469 | Ga0070687_1000074692 | 281 |
| 578 | 3300005344 | Ga0070661_100070055 | Ga0070661_1000700552 | 281 |
| 579 | 3300005347 | Ga0070668_100021390 | Ga0070668_1000213903 | 281 |
| 580 | 3300005354 | Ga0070675_100085483 | Ga0070675_1000854833 | 281 |
| 581 | 3300005356 | Ga0070674_100140718 | Ga0070674_1001407182 | 281 |
| 582 | 3300005367 | Ga0070667_100224437 | Ga0070667_1002244372 | 281 |
| 583 | 3300005367 | Ga0070667_100556290 | Ga0070667_1005562901 | 281 |
| 584 | 3300005441 | Ga0070700_100034382 | Ga0070700_1000343823 | 281 |
| 585 | 3300005456 | Ga0070678_100278919 | Ga0070678_1002789192 | 281 |
| 586 | 3300005457 | Ga0070662_100049967 | Ga0070662_1000499673 | 281 |
| 587 | 3300005466 | Ga0070685_10005666 | Ga0070685_100056663 | 281 |
| 588 | 3300005466 | Ga0070685_10065935 | Ga0070685_100659351 | 281 |
| 589 | 3300005535 | Ga0070684_100113405 | Ga0070684_1001134052 | 281 |
| 590 | 3300005539 | Ga0068853_100453151 | Ga0068853_1004531511 | 281 |
| 591 | 3300005543 | Ga0070672_100251457 | Ga0070672_1002514572 | 281 |
| 592 | 3300005548 | Ga0070665_100051370 | Ga0070665_1000513703 | 281 |
| 593 | 3300005548 | Ga0070665_100306480 | Ga0070665_1003064802 | 281 |
| 594 | 3300005564 | Ga0070664_100029999 | Ga0070664_1000299991 | 281 |
| 595 | 3300005577 | Ga0068857_100088667 | Ga0068857_1000886672 | 281 |
| 596 | 3300005578 | Ga0068854_100005659 | Ga0068854_1000056594 | 281 |
| 597 | 3300005614 | Ga0068856_100070422 | Ga0068856_1000704223 | 281 |
| 598 | 3300005615 | Ga0070702_100307981 | Ga0070702_1003079811 | 281 |
| 599 | 3300005616 | Ga0068852_100011309 | Ga0068852_1000113093 | 281 |
| 600 | 3300005617 | Ga0068859_100320694 | Ga0068859_1003206942 | 281 |
| 601 | 3300005617 | Ga0068859_100529108 | Ga0068859_1005291082 | 281 |
| 602 | 3300005618 | Ga0068864_100192046 | Ga0068864_1001920462 | 281 |
| 603 | 3300005840 | Ga0068870_10136544 | Ga0068870_101365442 | 281 |
| 604 | 3300005844 | Ga0068862_100086701 | Ga0068862_1000867013 | 281 |
| 605 | 3300006881 | Ga0068865_100062333 | Ga0068865_1000623331 | 281 |
| 606 | 3300006931 | Ga0097620_100320697 | Ga0097620_1003206972 | 281 |
| 607 | 3300006931 | Ga0097620_100529058 | Ga0097620_1005290582 | 281 |
| 608 | 3300009094 | Ga0111539_10334450 | Ga0111539_103344502 | 281 |
| 609 | 3300009098 | Ga0105245_10015361 | Ga0105245_100153615 | 281 |
| 610 | 3300009098 | Ga0105245_10213971 | Ga0105245_102139711 | 281 |
| 611 | 3300009101 | Ga0105247_10183688 | Ga0105247_101836882 | 281 |
| 612 | 3300009174 | Ga0105241_10048073 | Ga0105241_100480733 | 281 |
| 613 | 3300009545 | Ga0105237_10317923 | Ga0105237_103179232 | 281 |
| 614 | 3300009545 | Ga0105237_10402978 | Ga0105237_104029782 | 281 |
| 615 | 3300009551 | Ga0105238_10539978 | Ga0105238_105399782 | 281 |
| 616 | 3300010375 | Ga0105239_10013330 | Ga0105239_100133307 | 281 |
| 617 | 3300010375 | Ga0105239_10022210 | Ga0105239_100222103 | 281 |
| 618 | 3300013308 | Ga0157375_10239652 | Ga0157375_102396522 | 281 |
| 619 | 3300025901 | Ga0207688_10020321 | Ga0207688_100203212 | 281 |
| 620 | 3300025907 | Ga0207645_10233992 | Ga0207645_102339922 | 281 |
| 621 | 3300025908 | Ga0207643_10017684 | Ga0207643_100176842 | 281 |
| 622 | 3300025920 | Ga0207649_10208424 | Ga0207649_102084241 | 281 |
| 623 | 3300025925 | Ga0207650_10221477 | Ga0207650_102214771 | 281 |
| 624 | 3300025926 | Ga0207659_10239654 | Ga0207659_102396542 | 281 |
| 625 | 3300025927 | Ga0207687_10013419 | Ga0207687_100134192 | 281 |
| 626 | 3300025940 | Ga0207691_10162622 | Ga0207691_101626222 | 281 |
| 627 | 3300025940 | Ga0207691_10256012 | Ga0207691_102560121 | 281 |
| 628 | 3300025942 | Ga0207689_10010022 | Ga0207689_100100224 | 281 |
| 629 | 3300025945 | Ga0207679_10072446 | Ga0207679_100724463 | 281 |
| 630 | 3300025972 | Ga0207668_10098739 | Ga0207668_100987392 | 281 |
| 631 | 3300025981 | Ga0207640_10019380 | Ga0207640_100193803 | 281 |
| 632 | 3300025981 | Ga0207640_10130551 | Ga0207640_101305512 | 281 |
| 633 | 3300025986 | Ga0207658_10277283 | Ga0207658_102772831 | 281 |
| 634 | 3300026023 | Ga0207677_10169562 | Ga0207677_101695621 | 281 |
| 635 | 3300026067 | Ga0207678_10002445 | Ga0207678_100024454 | 281 |
| 636 | 3300026067 | Ga0207678_10130265 | Ga0207678_101302652 | 281 |
| 637 | 3300026075 | Ga0207708_10014923 | Ga0207708_100149234 | 281 |
| 638 | 3300026089 | Ga0207648_10030511 | Ga0207648_100305115 | 281 |
| 639 | 3300026116 | Ga0207674_10009872 | Ga0207674_100098725 | 281 |
| 640 | 3300026121 | Ga0207683_10058641 | Ga0207683_100586412 | 281 |
| 641 | 3300026121 | Ga0207683_10118846 | Ga0207683_101188462 | 281 |
| 642 | 3300028379 | Ga0268266_10070557 | Ga0268266_100705573 | 281 |
| 643 | 3300037068 | Ga0373925_0037039 | Ga0373925_0037039_214_1083 | 281 |
| 644 | 3300037418 | Ga0395900_0657826 | Ga0395900_0657826_60_926 | 281 |
| 645 | 3300046471 | Ga0495650_0010085 | Ga0495650_0010085_1946_2851 | 281 |
| 646 | 3300048904 | Ga0496101_0197630 | Ga0496101_0197630_362_1228 | 281 |
| 647 | 3300048912 | Ga0496109_0158482 | Ga0496109_0158482_1047_1913 | 281 |
| 648 | 3300048913 | Ga0496110_0050780 | Ga0496110_0050780_1371_2237 | 281 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8huc-assembly1.cif.gz_A | crystal structure of paich (pec1) | 0.9311 | 23 | 278 |
| 8huc-assembly2.cif.gz_D | crystal structure of paich (pec1) | 0.9264 | 23 | 278 |
| 8huc-assembly2.cif.gz_B | crystal structure of paich (pec1) | 0.9173 | 23 | 278 |
| 8huc-assembly1.cif.gz_C | crystal structure of paich (pec1) | 0.9081 | 23 | 278 |
| 1njk-assembly1.cif.gz_D | crystal structure of ybaw probable thioesterase from escherichia coli | 0.8944 | 77 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PLR8_89_286_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9093 | 73 | 276 | 3.10.129.10 |
| af_A0A1D8PLR8_89_286_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9006 | 73 | 276 | 3.10.129.10 |
| af_Q0IZW8_9_172_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8939 | 78 | 145 | 3.10.129.10 |
| af_Q9W439_57_173_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8817 | 77 | 142 | 3.10.129.10 |
| 4rltA00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8803 | 78 | 145 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520HAF0-F1-model_v4 | Acyl-CoA dehydrogenase | 0.99 | 190 | 278 |
GO:0019171
|
| AF-A0A520HAF0-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9791 | 190 | 278 |
GO:0019171
|
| AF-A0A1Z8P3P6-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9761 | 23 | 276 |
GO:0019171
|
| AF-A0A536V716-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9754 | 45 | 278 |
GO:0019171
|
| AF-A0A1V6F2K3-F1-model_v4 | Uncharacterized protein | 0.9753 | 159 | 278 |
GO:0019171
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar