F472392

General Info

Members Datasets Scaffolds Average Seq Length
648 377 607 292

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0438419|Ga0451577_0438419_207_1154
Length 315
Sequence MSNDTRTLDAATLAHLQSWVGQTETVSDVITAAPVRALGATLDRDDALPVTGTPLAPLWHWLYFLPQHRQSEIGPDGHARRGGFLPPVPLPRRMWAGGRLQWRSDNPLRVGDAVQRSSRIASVTHKAGRSGDLLFVLVQHEVHNAQGLALTEAHDIVYRAAAQAPTLGTGVSSLPPEGALASRGGPSMLAQPGDPVPSPIAAEAGAPWQREIVPDAVLLFRYSALTFNGHRIHYDRQYVTEVEGYPGLIVHGPLIATLLVDLVRRHAPDAFIQSFNFKALRPTFDLHPFRLNGQPSADGKRVRLWAQDHEGWLTM

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
3 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
4 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
5 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
6 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
7 2643221658 Variovorax sp. Root411 Isolate Unclassified
8 2643221672 Variovorax sp. Root434 Isolate Unclassified
9 2643221683 Variovorax sp. Root473 Isolate Unclassified
10 2738541277 Variovorax sp. GV051 Isolate Unclassified
11 2738541307 Variovorax sp. GV008 Isolate Unclassified
12 2738543019 Variovorax sp. GV040 Isolate Unclassified
13 2818991446 Variovorax sp. 1180 Isolate Unclassified
14 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
15 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
16 2842677519 Variovorax sp. R-72495 Isolate Unclassified
17 2842733646 Variovorax sp. R-72446 Isolate Unclassified
18 2842747753 Variovorax sp. R-72060 Isolate Unclassified
19 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
20 2885198086 Variovorax sp. 679 Isolate Unclassified
21 2885211737 Variovorax sp. 553 Isolate Unclassified
22 2899924645 Variovorax sp. 369 Isolate Unclassified
23 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
24 2904456579 Variovorax sp. 2002 Isolate Unclassified
25 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
26 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
27 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
28 2928037797 Variovorax sp. 1126 Isolate Unclassified
29 2928044640 Variovorax sp. 1128 Isolate Unclassified
30 2928051484 Variovorax sp. 1133 Isolate Unclassified
31 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
32 2928070936 Variovorax gossypii 1167 Isolate Unclassified
33 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
34 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
35 2929520902 Variovorax beijingensis 502 Isolate Unclassified
36 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
37 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
38 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
39 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
40 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
41 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
42 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
43 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
44 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
45 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
46 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
47 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
48 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
49 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
50 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
51 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
52 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
53 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
54 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
55 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
56 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
57 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
58 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
59 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
60 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
61 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
62 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
63 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
64 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
65 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
66 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
67 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
68 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
69 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
70 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
71 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
72 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
73 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
74 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
75 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
76 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
77 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
78 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
79 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
80 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
81 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
82 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
83 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
84 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
85 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
86 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
87 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
88 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
89 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
90 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
91 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
92 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
93 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
94 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
95 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
96 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
97 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
98 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
99 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
100 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
101 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
102 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
103 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
104 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
105 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
106 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
107 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
108 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
109 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
110 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
111 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
112 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
113 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
114 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
115 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
116 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
117 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
118 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
119 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
120 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
121 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
122 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
123 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
124 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
125 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
126 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
127 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
128 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
130 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
131 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
132 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
133 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
134 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
135 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
136 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
137 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
138 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
140 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
141 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
142 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
143 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
144 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
145 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
146 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
147 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
148 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
149 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
150 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
151 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
152 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
153 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
154 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
155 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
156 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
157 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
158 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
159 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
160 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
161 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
162 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
163 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
164 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
165 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
166 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
167 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
168 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
172 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
174 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
177 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
180 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
182 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
185 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
236 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
237 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
238 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
239 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
240 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
241 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
242 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
243 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
244 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
245 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
246 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
247 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
248 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
249 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
252 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
253 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
254 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
255 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
256 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
257 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
258 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
259 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
260 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
261 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
262 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
263 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
264 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
265 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
266 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
267 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
268 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
269 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
270 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
271 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
272 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
273 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
274 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
275 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
276 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
277 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
278 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
279 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
280 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
281 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
282 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
283 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
284 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
285 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
286 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
287 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
288 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
289 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
290 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
291 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
292 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
293 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
294 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
295 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
296 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
297 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
298 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
299 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
300 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
301 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
302 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
303 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
304 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
305 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
306 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
307 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
308 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
309 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
310 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
311 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
312 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
313 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
314 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
315 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
316 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
322 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
323 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
324 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
325 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
326 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
327 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
328 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
329 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
330 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
339 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
340 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
341 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
342 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
343 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
344 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
345 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
346 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
348 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
349 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
350 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
351 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
352 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
353 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
354 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
355 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
356 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
357 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
358 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
359 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
360 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
361 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
362 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
363 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
364 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
365 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
366 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
367 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
368 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
369 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
370 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
371 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
372 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
373 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
374 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
375 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
376 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
377 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.52
Metatranscriptomes 0.15
Isolates 6.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.23
Nodule 0.31
Rhizoplane 1.39
Rhizosphere 66.51
Stem 0
Stem Tuber 0
Unclassified 7.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1000195 3300002073 Bacteria 4920
2 JGI25158J39367_1007490 3300002739 Bacteria 1538
3 JGI25150J39212_1001112 3300002774 Bacteria 8094
4 JGI25159J45721_1001424 3300002987 Bacteria 9921
5 JGI25151J46595_10002864 3300003187 Bacteria 9918
6 JGI25151J46595_10003442 3300003187 Bacteria 8753
7 JGI25153J46596_10000620 3300003215 Bacteria 21703
8 JGI25153J46596_10003509 3300003215 Bacteria 8753
9 JGI25153J46596_10024776 3300003215 Bacteria 2156
10 JGI25160J50197_1001928 3300003354 Bacteria 9921
11 JGI25161J50226_1001375 3300003374 Bacteria 7410
12 JGI25161J50226_1002423 3300003374 Bacteria 4790
13 Ga0006562J51391_1083753 3300003578 Bacteria 2160
14 Ga0055527_1004559 3300003760 Bacteria 1890
15 Ga0055535_1001422 3300003761 Bacteria 12268
16 Ga0055542_1000109 3300003762 Bacteria 111107
17 Ga0055526_1005481 3300003771 Bacteria 7282
18 Ga0055526_1005616 3300003771 Bacteria 7142
19 Ga0055537_1000195 3300003773 Bacteria 45368
20 Ga0055537_1001992 3300003773 Bacteria 7282
21 Ga0055524_1003731 3300003775 Bacteria 7282
22 Ga0055524_1009153 3300003775 Bacteria 4052
23 Ga0055536_1002896 3300003781 Bacteria 9426
24 Ga0055536_1003710 3300003781 Bacteria 8101
25 Ga0055536_1008623 3300003781 Bacteria 4348
26 Ga0055534_1000285 3300003784 Bacteria 34241
27 Ga0055534_1001560 3300003784 Bacteria 8929
28 Ga0055528_1002453 3300003790 Bacteria 9921
29 Ga0055528_1002896 3300003790 Bacteria 8921
30 Ga0055530_10000495 3300003791 Bacteria 34154
31 Ga0055530_10005626 3300003791 Bacteria 5873
32 Ga0055540_1002205 3300003792 Bacteria 10582
33 Ga0055540_1003089 3300003792 Bacteria 8278
34 Ga0055540_1004833 3300003792 Bacteria 5915
35 Ga0055540_1005512 3300003792 Bacteria 5294
36 Ga0055531_10002052 3300003794 Bacteria 13898
37 Ga0055531_10002338 3300003794 Bacteria 12771
38 Ga0055531_10003743 3300003794 Bacteria 9554
39 Ga0055543_1001345 3300004625 Bacteria 9959
40 Ga0055543_1015707 3300004625 Bacteria 1452
41 Ga0065165_1003856 3300005262 Bacteria 9959
42 Ga0065165_1030924 3300005262 Bacteria 1698
43 Ga0065714_10007224 3300005288 Bacteria 4179
44 Ga0065715_10120017 3300005293 Bacteria 2270
45 Ga0070658_10007478 3300005327 Bacteria 8814
46 Ga0070676_10214323 3300005328 Bacteria 1269
47 Ga0070676_10251039 3300005328 Bacteria 1180
48 Ga0070683_100026879 3300005329 Bacteria 5187
49 Ga0070683_100302770 3300005329 Bacteria 1521
50 Ga0070670_100027478 3300005331 Bacteria 4894
51 Ga0070677_10001855 3300005333 Bacteria 6681
52 Ga0070677_10009884 3300005333 Bacteria 3249
53 Ga0068869_100022542 3300005334 Bacteria 4340
54 Ga0070666_10056480 3300005335 Bacteria 2651
55 Ga0070682_100205776 3300005337 Bacteria 1391
56 Ga0068868_100065308 3300005338 Bacteria 2891
57 Ga0068868_100280567 3300005338 Bacteria 1410
58 Ga0070691_10071370 3300005341 Bacteria 1686
59 Ga0070687_100007469 3300005343 Bacteria 4559
60 Ga0070661_100070055 3300005344 Bacteria 2579
61 Ga0070661_100371929 3300005344 Bacteria 1125
62 Ga0070692_10077287 3300005345 Bacteria 1786
63 Ga0070668_100021390 3300005347 Bacteria 4886
64 Ga0070668_100068787 3300005347 Bacteria 2753
65 Ga0070669_100002821 3300005353 Bacteria 12552
66 Ga0070675_100003763 3300005354 Bacteria 11518
67 Ga0070675_100085483 3300005354 Bacteria 2636
68 Ga0070671_100022052 3300005355 Bacteria 5202
69 Ga0070674_100010570 3300005356 Bacteria 5585
70 Ga0070674_100016462 3300005356 Bacteria 4635
71 Ga0070674_100023029 3300005356 Bacteria 4024
72 Ga0070674_100140718 3300005356 Bacteria 1810
73 Ga0070673_100234349 3300005364 Bacteria 1593
74 Ga0070659_100085977 3300005366 Bacteria 2516
75 Ga0070667_100021693 3300005367 Bacteria 5329
76 Ga0070667_100024167 3300005367 Bacteria 5047
77 Ga0070667_100224437 3300005367 Bacteria 1673
78 Ga0070667_100320199 3300005367 Bacteria 1399
79 Ga0070667_100556290 3300005367 Bacteria 1055
80 Ga0070714_100076498 3300005435 Bacteria 2906
81 Ga0070713_100000140 3300005436 Bacteria 47882
82 Ga0070700_100034382 3300005441 Bacteria 3061
83 Ga0070663_100028606 3300005455 Bacteria 3797
84 Ga0070678_100008716 3300005456 Bacteria 6091
85 Ga0070678_100031542 3300005456 Bacteria 3658
86 Ga0070678_100070954 3300005456 Bacteria 2606
87 Ga0070678_100278919 3300005456 Bacteria 1412
88 Ga0070662_100033873 3300005457 Bacteria 3599
89 Ga0070662_100049967 3300005457 Bacteria 3016
90 Ga0070662_100224053 3300005457 Bacteria 1502
91 Ga0070662_100252724 3300005457 Bacteria 1418
92 Ga0068867_100000447 3300005459 Bacteria 27402
93 Ga0068867_100018445 3300005459 Bacteria 4960
94 Ga0068867_100060005 3300005459 Bacteria 2820
95 Ga0068867_100213875 3300005459 Bacteria 1550
96 Ga0070685_10005666 3300005466 Bacteria 6338
97 Ga0070685_10065935 3300005466 Bacteria 2132
98 Ga0070698_100086842 3300005471 Bacteria 3114
99 Ga0070698_100293278 3300005471 Bacteria 1557
100 Ga0070679_100124053 3300005530 Bacteria 2566
101 Ga0070679_100125205 3300005530 Bacteria 2552
102 Ga0070684_100113405 3300005535 Bacteria 2433
103 Ga0070697_100036413 3300005536 Bacteria 3975
104 Ga0068853_100013928 3300005539 Bacteria 6577
105 Ga0068853_100117921 3300005539 Bacteria 2365
106 Ga0068853_100453151 3300005539 Bacteria 1207
107 Ga0070672_100011724 3300005543 Bacteria 6123
108 Ga0070672_100251457 3300005543 Bacteria 1489
109 Ga0070686_100053105 3300005544 Bacteria 2586
110 Ga0070695_100031388 3300005545 Bacteria 3314
111 Ga0070696_100490378 3300005546 Bacteria 976
112 Ga0070665_100011810 3300005548 Bacteria 8820
113 Ga0070665_100051370 3300005548 Bacteria 4134
114 Ga0070665_100306480 3300005548 Bacteria 1591
115 Ga0070665_100552469 3300005548 Bacteria 1164
116 Ga0070704_100003685 3300005549 Bacteria 8814
117 Ga0068855_100015898 3300005563 Bacteria 9053
118 Ga0070664_100011902 3300005564 Bacteria 7061
119 Ga0070664_100029999 3300005564 Bacteria 4535
120 Ga0068857_100088667 3300005577 Bacteria 2767
121 Ga0068854_100005659 3300005578 Bacteria 7895
122 Ga0068854_100373794 3300005578 Bacteria 1173
123 Ga0068856_100013123 3300005614 Bacteria 8027
124 Ga0068856_100070422 3300005614 Bacteria 3459
125 Ga0068856_100141167 3300005614 Bacteria 2416
126 Ga0070702_100307981 3300005615 Bacteria 1098
127 Ga0068852_100011309 3300005616 Bacteria 6714
128 Ga0068852_100046536 3300005616 Bacteria 3697
129 Ga0068852_100115168 3300005616 Bacteria 2451
130 Ga0068852_100186786 3300005616 Bacteria 1952
131 Ga0068852_100261099 3300005616 Bacteria 1663
132 Ga0068859_100320694 3300005617 Bacteria 1643
133 Ga0068859_100350372 3300005617 Bacteria 1571
134 Ga0068859_100529108 3300005617 Bacteria 1274
135 Ga0068864_100061606 3300005618 Bacteria 3250
136 Ga0068864_100192046 3300005618 Bacteria 1872
137 Ga0068864_100227702 3300005618 Bacteria 1723
138 Ga0068866_10047798 3300005718 Bacteria 2159
139 Ga0068851_10075785 3300005834 Bacteria 1749
140 Ga0068870_10136544 3300005840 Bacteria 1430
141 Ga0068863_100088314 3300005841 Bacteria 2938
142 Ga0068863_100126211 3300005841 Bacteria 2441
143 Ga0068858_100021427 3300005842 Bacteria 6038
144 Ga0068858_100212283 3300005842 Bacteria 1832
145 Ga0068860_100011430 3300005843 Bacteria 8745
146 Ga0068860_100160380 3300005843 Bacteria 2168
147 Ga0068862_100034751 3300005844 Bacteria 4266
148 Ga0068862_100065534 3300005844 Bacteria 3129
149 Ga0068862_100086701 3300005844 Bacteria 2722
150 Ga0068862_100347884 3300005844 Bacteria 1374
151 Ga0068862_100487504 3300005844 Bacteria 1168
152 Ga0075365_10023759 3300006038 Bacteria 3859
153 Ga0075365_10024549 3300006038 Bacteria 3805
154 Ga0075363_100011081 3300006048 Bacteria 4307
155 Ga0075363_100019974 3300006048 Bacteria 3355
156 Ga0075363_100082350 3300006048 Bacteria 1761
157 Ga0075363_100103566 3300006048 Bacteria 1577
158 Ga0075364_10015537 3300006051 Bacteria 4723
159 Ga0075364_10047864 3300006051 Bacteria 2786
160 Ga0075364_10058901 3300006051 Bacteria 2517
161 Ga0075362_10037146 3300006177 Bacteria 2134
162 Ga0075362_10082346 3300006177 Bacteria 1485
163 Ga0075367_10008687 3300006178 Bacteria 5274
164 Ga0075366_10012633 3300006195 Bacteria 4795
165 Ga0075366_10013726 3300006195 Bacteria 4616
166 Ga0075366_10015053 3300006195 Bacteria 4424
167 Ga0075366_10048998 3300006195 Bacteria 2506
168 Ga0097621_100025706 3300006237 Bacteria 4609
169 Ga0097621_100575132 3300006237 Bacteria 1027
170 Ga0075370_10006104 3300006353 Bacteria 6041
171 Ga0075370_10020735 3300006353 Bacteria 3595
172 Ga0075370_10039862 3300006353 Bacteria 2648
173 Ga0075370_10101600 3300006353 Bacteria 1664
174 Ga0075370_10190614 3300006353 Bacteria 1208
175 Ga0068871_100038278 3300006358 Bacteria 3829
176 Ga0075428_100221658 3300006844 Bacteria 2042
177 Ga0068865_100062333 3300006881 Bacteria 2617
178 Ga0068865_100104083 3300006881 Bacteria 2083
179 Ga0075436_100040806 3300006914 Bacteria 3203
180 Ga0097620_100320697 3300006931 Bacteria 1643
181 Ga0097620_100350339 3300006931 Bacteria 1571
182 Ga0097620_100529058 3300006931 Bacteria 1274
183 Ga0099826_10001304 3300006948 Bacteria 14708
184 Ga0105244_10005148 3300009036 Bacteria 8766
185 Ga0105244_10079444 3300009036 Bacteria 1626
186 Ga0105240_10000945 3300009093 Bacteria 51693
187 Ga0105240_10012575 3300009093 Bacteria 11676
188 Ga0111539_10334450 3300009094 Bacteria 1763
189 Ga0111539_10733500 3300009094 Bacteria 1150
190 Ga0111539_11085566 3300009094 Bacteria 930
191 Ga0105245_10015361 3300009098 Bacteria 6674
192 Ga0105245_10212076 3300009098 Bacteria 1864
193 Ga0105245_10213971 3300009098 Bacteria 1856
194 Ga0105247_10100109 3300009101 Bacteria 1852
195 Ga0105247_10183688 3300009101 Bacteria 1397
196 Ga0105243_10000200 3300009148 Bacteria 69918
197 Ga0105243_10000702 3300009148 Bacteria 32284
198 Ga0105243_10004089 3300009148 Bacteria 11616
199 Ga0105243_10078507 3300009148 Bacteria 2688
200 Ga0105243_10485563 3300009148 Bacteria 1167
201 Ga0105241_10048073 3300009174 Bacteria 3245
202 Ga0105242_10003462 3300009176 Bacteria 12272
203 Ga0105248_10322262 3300009177 Bacteria 1741
204 Ga0105237_10000823 3300009545 Bacteria 42469
205 Ga0105237_10317923 3300009545 Bacteria 1560
206 Ga0105237_10402978 3300009545 Bacteria 1372
207 Ga0105238_10020717 3300009551 Bacteria 6696
208 Ga0105238_10121177 3300009551 Bacteria 2595
209 Ga0105238_10539978 3300009551 Bacteria 1170
210 Ga0105249_10072561 3300009553 Bacteria 3182
211 Ga0105249_10073716 3300009553 Bacteria 3158
212 Ga0105239_10010731 3300010375 Bacteria 10233
213 Ga0105239_10013330 3300010375 Bacteria 9135
214 Ga0105239_10022210 3300010375 Bacteria 6993
215 Ga0105239_10098604 3300010375 Bacteria 3230
216 Ga0105246_10051231 3300011119 Bacteria 2834
217 Ga0157373_10129396 3300013100 Bacteria 1775
218 Ga0157373_10264740 3300013100 Bacteria 1217
219 Ga0157371_10098047 3300013102 Bacteria 2078
220 Ga0157370_10212098 3300013104 Bacteria 1795
221 Ga0157369_10015892 3300013105 Bacteria 8475
222 Ga0157374_10406134 3300013296 Bacteria 1359
223 Ga0157378_10059591 3300013297 Bacteria 3406
224 Ga0157378_10115984 3300013297 Bacteria 2462
225 Ga0163162_10028368 3300013306 Bacteria 5538
226 Ga0163162_10274017 3300013306 Bacteria 1819
227 Ga0157375_10083529 3300013308 Bacteria 3239
228 Ga0157375_10092205 3300013308 Bacteria 3093
229 Ga0157375_10131121 3300013308 Bacteria 2626
230 Ga0157375_10239652 3300013308 Bacteria 1973
231 Ga0157375_10283178 3300013308 Bacteria 1821
232 Ga0157380_10292758 3300014326 Bacteria 1496
233 Ga0157380_10706717 3300014326 Bacteria 1014
234 Ga0182008_10006481 3300014497 Bacteria 6537
235 Ga0157377_10000027 3300014745 Bacteria 135472
236 Ga0157379_10205326 3300014968 Bacteria 1782
237 Ga0157376_10008387 3300014969 Bacteria 7453
238 Ga0157376_10091198 3300014969 Bacteria 2639
239 Ga0157376_10208506 3300014969 Bacteria 1803
240 Ga0182006_1012639 3300015261 Bacteria 3689
241 Ga0182007_10002662 3300015262 Bacteria 8769
242 Ga0163161_10000079 3300017792 Bacteria 97522
243 Ga0163161_10005521 3300017792 Bacteria 8762
244 Ga0163161_10077868 3300017792 Bacteria 2436
245 Ga0163161_10313581 3300017792 Bacteria 1238
246 Ga0213872_10005591 3300021361 Bacteria 6420
247 Ga0209436_108606 3300025208 Bacteria 2015
248 Ga0209672_100979 3300025228 Bacteria 12626
249 Ga0209147_102886 3300025229 Bacteria 3782
250 Ga0209258_100048 3300025242 Bacteria 365881
251 Ga0207425_1000107 3300025245 Bacteria 77829
252 Ga0207425_1007836 3300025245 Bacteria 2783
253 Ga0209148_1000040 3300025254 Bacteria 473531
254 Ga0209129_1000007 3300025258 Bacteria 771325
255 Ga0209129_1002316 3300025258 Bacteria 9447
256 Ga0209129_1008679 3300025258 Bacteria 2792
257 Ga0209565_1000087 3300025263 Bacteria 152027
258 Ga0209565_1001141 3300025263 Bacteria 12785
259 Ga0209565_1006544 3300025263 Bacteria 3255
260 Ga0209673_1000145 3300025273 Bacteria 152027
261 Ga0209673_1000559 3300025273 Bacteria 59593
262 Ga0209673_1000636 3300025273 Bacteria 53032
263 Ga0209673_1003414 3300025273 Bacteria 9412
264 Ga0209673_1020967 3300025273 Bacteria 2298
265 Ga0209130_1000215 3300025284 Bacteria 75723
266 Ga0209130_1000341 3300025284 Bacteria 53640
267 Ga0209675_1000085 3300025291 Bacteria 152027
268 Ga0209675_1001865 3300025291 Bacteria 11408
269 Ga0209675_1003199 3300025291 Bacteria 7936
270 Ga0209676_1000004 3300025292 Bacteria 1138360
271 Ga0209676_1000071 3300025292 Bacteria 309464
272 Ga0209676_1000172 3300025292 Bacteria 153664
273 Ga0209676_1005241 3300025292 Bacteria 6862
274 Ga0209025_1000230 3300025294 Bacteria 131131
275 Ga0209025_1000507 3300025294 Bacteria 74783
276 Ga0209564_1000200 3300025295 Bacteria 137503
277 Ga0209564_1000318 3300025295 Bacteria 93851
278 Ga0209758_1000025 3300025297 Bacteria 586687
279 Ga0209758_1000057 3300025297 Bacteria 333111
280 Ga0209758_1046212 3300025297 Bacteria 1572
281 Ga0209050_1000002 3300025298 Bacteria 1792849
282 Ga0209050_1000509 3300025298 Bacteria 65792
283 Ga0209050_1006208 3300025298 Bacteria 7169
284 Ga0209050_1019262 3300025298 Bacteria 2602
285 Ga0209256_1000067 3300025299 Bacteria 246812
286 Ga0209256_1000198 3300025299 Bacteria 113429
287 Ga0207426_1000001 3300025302 Bacteria 1341301
288 Ga0207426_1000178 3300025302 Bacteria 159291
289 Ga0207426_1000264 3300025302 Bacteria 110747
290 Ga0209051_1000002 3300025303 Bacteria 1631846
291 Ga0209051_1000096 3300025303 Bacteria 167399
292 Ga0209051_1000169 3300025303 Bacteria 119220
293 Ga0209051_1000278 3300025303 Bacteria 83769
294 Ga0209051_1000342 3300025303 Bacteria 70022
295 Ga0209051_1000397 3300025303 Bacteria 60597
296 Ga0209257_1000002 3300025304 Bacteria 1767052
297 Ga0209257_1000072 3300025304 Bacteria 332791
298 Ga0209257_1000497 3300025304 Bacteria 70185
299 Ga0209257_1001087 3300025304 Bacteria 35572
300 Ga0209257_1005665 3300025304 Bacteria 8623
301 Ga0209257_1006992 3300025304 Bacteria 7014
302 Ga0207697_10017578 3300025315 Bacteria 2938
303 Ga0207655_1001662 3300025728 Bacteria 19671
304 Ga0207682_10029380 3300025893 Bacteria 2198
305 Ga0207682_10032517 3300025893 Bacteria 2097
306 Ga0207688_10020321 3300025901 Bacteria 3625
307 Ga0207645_10011003 3300025907 Bacteria 6191
308 Ga0207645_10233992 3300025907 Bacteria 1213
309 Ga0207643_10002167 3300025908 Bacteria 10767
310 Ga0207643_10017684 3300025908 Bacteria 3901
311 Ga0207705_10335496 3300025909 Bacteria 1163
312 Ga0207695_10052257 3300025913 Bacteria 4282
313 Ga0207695_10128363 3300025913 Bacteria 2495
314 Ga0207671_10004092 3300025914 Bacteria 14115
315 Ga0207693_10073887 3300025915 Bacteria 2669
316 Ga0207657_10024037 3300025919 Bacteria 5658
317 Ga0207657_10032138 3300025919 Bacteria 4745
318 Ga0207649_10208424 3300025920 Bacteria 1385
319 Ga0207652_10159249 3300025921 Bacteria 2023
320 Ga0207646_10222534 3300025922 Bacteria 1705
321 Ga0207681_10014220 3300025923 Bacteria 4940
322 Ga0207681_10441542 3300025923 Bacteria 1057
323 Ga0207694_10007400 3300025924 Bacteria 8327
324 Ga0207694_10108642 3300025924 Bacteria 2204
325 Ga0207650_10003059 3300025925 Bacteria 11524
326 Ga0207650_10221477 3300025925 Bacteria 1523
327 Ga0207659_10001323 3300025926 Bacteria 14807
328 Ga0207659_10239654 3300025926 Bacteria 1467
329 Ga0207687_10013419 3300025927 Bacteria 5349
330 Ga0207644_10014009 3300025931 Bacteria 5359
331 Ga0207706_10121038 3300025933 Bacteria 2301
332 Ga0207706_10141781 3300025933 Bacteria 2114
333 Ga0207686_10057835 3300025934 Bacteria 2442
334 Ga0207709_10000038 3300025935 Bacteria 266638
335 Ga0207709_10000526 3300025935 Bacteria 33311
336 Ga0207709_10001681 3300025935 Bacteria 14906
337 Ga0207709_10006910 3300025935 Bacteria 6350
338 Ga0207709_10147595 3300025935 Bacteria 1625
339 Ga0207669_10012633 3300025937 Bacteria 4160
340 Ga0207704_10007994 3300025938 Bacteria 5030
341 Ga0207704_10140604 3300025938 Bacteria 1688
342 Ga0207704_10155045 3300025938 Bacteria 1622
343 Ga0207691_10014001 3300025940 Bacteria 7651
344 Ga0207691_10162622 3300025940 Bacteria 1958
345 Ga0207691_10256012 3300025940 Bacteria 1510
346 Ga0207711_10253687 3300025941 Bacteria 1616
347 Ga0207689_10010022 3300025942 Bacteria 8169
348 Ga0207689_10104271 3300025942 Bacteria 2330
349 Ga0207689_10674292 3300025942 Bacteria 871
350 Ga0207679_10062927 3300025945 Bacteria 2767
351 Ga0207679_10072446 3300025945 Bacteria 2602
352 Ga0207667_10060380 3300025949 Bacteria 3969
353 Ga0207667_10094776 3300025949 Bacteria 3082
354 Ga0207668_10098739 3300025972 Bacteria 2164
355 Ga0207668_10265206 3300025972 Bacteria 1401
356 Ga0207640_10019380 3300025981 Bacteria 4019
357 Ga0207640_10130551 3300025981 Bacteria 1816
358 Ga0207658_10005361 3300025986 Bacteria 8808
359 Ga0207658_10008898 3300025986 Bacteria 6810
360 Ga0207658_10174344 3300025986 Bacteria 1775
361 Ga0207658_10190111 3300025986 Bacteria 1706
362 Ga0207658_10277283 3300025986 Bacteria 1436
363 Ga0207677_10058187 3300026023 Bacteria 2659
364 Ga0207677_10169562 3300026023 Bacteria 1705
365 Ga0207677_10201962 3300026023 Bacteria 1581
366 Ga0207677_10232751 3300026023 Bacteria 1485
367 Ga0207703_10231325 3300026035 Bacteria 1657
368 Ga0207639_10010000 3300026041 Bacteria 6557
369 Ga0207639_10052443 3300026041 Bacteria 3108
370 Ga0207678_10002445 3300026067 Bacteria 16883
371 Ga0207678_10006353 3300026067 Bacteria 10489
372 Ga0207678_10006601 3300026067 Bacteria 10286
373 Ga0207678_10130265 3300026067 Bacteria 2145
374 Ga0207708_10014923 3300026075 Bacteria 5818
375 Ga0207702_10088618 3300026078 Bacteria 2704
376 Ga0207641_10145888 3300026088 Bacteria 2140
377 Ga0207648_10000119 3300026089 Bacteria 76875
378 Ga0207648_10006342 3300026089 Bacteria 11762
379 Ga0207648_10030511 3300026089 Bacteria 4774
380 Ga0207648_10035260 3300026089 Bacteria 4408
381 Ga0207648_10062176 3300026089 Bacteria 3256
382 Ga0207648_10089200 3300026089 Bacteria 2693
383 Ga0207648_10399724 3300026089 Bacteria 1245
384 Ga0207674_10009872 3300026116 Bacteria 10861
385 Ga0207674_10159225 3300026116 Bacteria 2212
386 Ga0207675_100032777 3300026118 Bacteria 4840
387 Ga0207683_10023532 3300026121 Bacteria 5299
388 Ga0207683_10049844 3300026121 Bacteria 3666
389 Ga0207683_10058641 3300026121 Bacteria 3380
390 Ga0207683_10118846 3300026121 Bacteria 2371
391 Ga0207698_10121211 3300026142 Bacteria 2214
392 Ga0207698_10178538 3300026142 Bacteria 1878
393 Ga0207698_10182134 3300026142 Bacteria 1862
394 Ga0207698_10543853 3300026142 Bacteria 1137
395 Ga0268266_10060061 3300028379 Bacteria 3276
396 Ga0268266_10070557 3300028379 Bacteria 3027
397 Ga0268265_10060528 3300028380 Bacteria 2902
398 Ga0268265_10204733 3300028380 Bacteria 1715
399 Ga0268264_10008551 3300028381 Bacteria 8509
400 Ga0268264_10111576 3300028381 Bacteria 2396
401 Ga0268264_10398379 3300028381 Bacteria 1322
402 Ga0307517_10081897 3300028786 Bacteria 2746
403 Ga0307515_10000195 3300028794 Bacteria 148138
404 Ga0316183_1124715 3300030742 Bacteria 11765
405 Ga0307513_10001731 3300031456 Bacteria 31140
406 Ga0307408_100000200 3300031548 Bacteria 65177
407 Ga0307408_100134837 3300031548 Bacteria 1931
408 Ga0307408_100280050 3300031548 Bacteria 1388
409 Ga0307516_10002973 3300031730 Bacteria 22180
410 Ga0307516_10006719 3300031730 Bacteria 13445
411 Ga0307516_10098572 3300031730 Bacteria 2741
412 Ga0307405_10022557 3300031731 Bacteria 3561
413 Ga0307405_10162074 3300031731 Bacteria 1585
414 Ga0307406_10004441 3300031901 Bacteria 7634
415 Ga0307406_10150811 3300031901 Bacteria 1658
416 Ga0307412_10003421 3300031911 Bacteria 8816
417 Ga0307412_10007892 3300031911 Bacteria 6062
418 Ga0307412_10071279 3300031911 Bacteria 2372
419 Ga0307416_100197355 3300032002 Bacteria 1905
420 Ga0307414_10081926 3300032004 Bacteria 2364
421 Ga0307414_10131848 3300032004 Bacteria 1941
422 Ga0307411_10609413 3300032005 Bacteria 940
423 Ga0373931_0136762 3300035691 Bacteria 1415
424 Ga0373927_0015731 3300035695 Bacteria 4995
425 Ga0373937_0012507 3300036401 Bacteria 7469
426 Ga0373925_0021639 3300037068 Bacteria 4688
427 Ga0373925_0037039 3300037068 Bacteria 3600
428 Ga0395899_0018078 3300037312 Bacteria 5365
429 Ga0395899_0033664 3300037312 Bacteria 3848
430 Ga0395900_0023033 3300037418 Bacteria 6374
431 Ga0395900_0307825 3300037418 Bacteria 1568
432 Ga0395900_0657826 3300037418 Bacteria 984
433 Ga0395898_0003690 3300037466 Bacteria 17014
434 Ga0395898_0050321 3300037466 Bacteria 4078
435 Ga0395905_0000421 3300037471 Bacteria 59264
436 Ga0395905_0028868 3300037471 Bacteria 5228
437 Ga0395905_0116084 3300037471 Bacteria 2516
438 Ga0395905_0134246 3300037471 Bacteria 2328
439 Ga0395905_0154316 3300037471 Bacteria 2159
440 Ga0395901_0066699 3300038443 Bacteria 3748
441 Ga0395901_0157157 3300038443 Bacteria 2388
442 Ga0395901_0217550 3300038443 Bacteria 1997
443 Ga0436361_1143890 3300039447 Bacteria 13239
444 Ga0439436_0006508 3300041404 Bacteria 3585
445 Ga0439461_0014337 3300041410 Bacteria 1506
446 Ga0439461_0026663 3300041410 Bacteria 1180
447 Ga0439466_0055840 3300041411 Bacteria 1282
448 Ga0439465_0001810 3300041413 Bacteria 6995
449 Ga0451839_1198531 3300041496 Bacteria 1319
450 Ga0439431_0001122 3300041997 Bacteria 5822
451 Ga0439445_0001661 3300042004 Bacteria 4862
452 Ga0439432_003301 3300042006 Bacteria 5994
453 Ga0439432_032244 3300042006 Bacteria 1690
454 Ga0439449_0002844 3300042007 Bacteria 6733
455 Ga0439449_0036098 3300042007 Bacteria 1838
456 Ga0439452_004527 3300042010 Bacteria 4646
457 Ga0439457_005798 3300042014 Bacteria 3066
458 Ga0439457_024855 3300042014 Bacteria 1326
459 Ga0439462_0019581 3300042015 Bacteria 1762
460 Ga0450923_012492 3300042125 Bacteria 1546
461 Ga0450890_002360 3300042127 Bacteria 2605
462 Ga0450892_000160 3300042130 Bacteria 7782
463 Ga0450898_005819 3300042134 Bacteria 1877
464 Ga0450889_000338 3300042144 Bacteria 5219
465 Ga0450906_003992 3300042145 Bacteria 3122
466 Ga0450910_019328 3300042147 Bacteria 1022
467 Ga0450908_002489 3300042184 Bacteria 3602
468 Ga0439434_0002733 3300042435 Bacteria 5141
469 Ga0450918_008218 3300042531 Bacteria 1836
470 Ga0451577_0002570 3300042876 Bacteria 21430
471 Ga0451577_0438419 3300042876 Bacteria 1186
472 Ga0451577_0592001 3300042876 Bacteria 1006
473 Ga0466969_0008092 3300044656 Bacteria 5583
474 Ga0466972_0037322 3300044658 Bacteria 2376
475 Ga0466966_0007151 3300044684 Bacteria 7397
476 Ga0466966_0011845 3300044684 Bacteria 5776
477 Ga0466961_0026791 3300044693 Bacteria 3706
478 Ga0453684_0613142 3300044712 Bacteria 1191
479 Ga0453684_0657291 3300044712 Bacteria 1143
480 Ga0495627_017433 3300046453 Bacteria 2439
481 Ga0495638_0082054 3300046460 Bacteria 1956
482 Ga0495650_0010085 3300046471 Bacteria 5306
483 Ga0495583_0000034 3300046506 Bacteria 246856
484 Ga0495606_0001750 3300046507 Bacteria 27863
485 Ga0495616_0066528 3300046513 Bacteria 1753
486 Ga0495620_0029354 3300046515 Bacteria 2546
487 Ga0495620_0041269 3300046515 Bacteria 2025
488 Ga0495631_0000021 3300046518 Bacteria 92765
489 Ga0495632_0006988 3300046519 Bacteria 7162
490 Ga0495637_0021992 3300046520 Bacteria 2915
491 Ga0495643_0111984 3300046522 Bacteria 1387
492 Ga0495648_0127719 3300046524 Bacteria 1356
493 Ga0495597_0000157 3300046542 Bacteria 60125
494 Ga0495633_0001670 3300046558 Bacteria 16748
495 Ga0495668_0057402 3300046616 Bacteria 2148
496 Ga0495668_0114181 3300046616 Bacteria 1477
497 Ga0495611_0008518 3300046648 Bacteria 4336
498 Ga0495625_0000012 3300046660 Bacteria 363006
499 Ga0495625_0022250 3300046660 Bacteria 4864
500 Ga0495625_0033882 3300046660 Bacteria 3772
501 Ga0495625_0092376 3300046660 Bacteria 2091
502 Ga0495625_0146286 3300046660 Bacteria 1591
503 Ga0495661_0011511 3300046665 Bacteria 6001
504 Ga0495588_0031063 3300046674 Bacteria 2687
505 Ga0495658_0042706 3300046683 Bacteria 2532
506 Ga0495658_0336209 3300046683 Bacteria 959
507 Ga0495669_0015030 3300046684 Bacteria 3311
508 Ga0495670_0001518 3300046691 Bacteria 11330
509 Ga0495671_0026731 3300046692 Bacteria 2988
510 Ga0495671_0129468 3300046692 Bacteria 1231
511 Ga0495649_0000470 3300046694 Bacteria 34696
512 Ga0495649_0001920 3300046694 Bacteria 15144
513 Ga0495589_0000033 3300046794 Bacteria 162794
514 Ga0495589_0005062 3300046794 Bacteria 6974
515 Ga0495589_0015362 3300046794 Bacteria 3941
516 Ga0495660_0053780 3300046810 Bacteria 2184
517 Ga0495581_0128471 3300047315 Bacteria 1477
518 Ga0495677_0000874 3300047445 Bacteria 12167
519 Ga0495681_0009255 3300047470 Bacteria 6090
520 Ga0495614_0003864 3300048089 Bacteria 6735
521 Ga0496101_0197630 3300048904 Bacteria 1554
522 Ga0496102_0065022 3300048905 Bacteria 3342
523 Ga0496104_0109871 3300048907 Bacteria 2643
524 Ga0496109_0158482 3300048912 Bacteria 2120
525 Ga0496110_0050780 3300048913 Bacteria 3643
526 Ga0496115_0183765 3300048918 Bacteria 1728
527 Ga0496116_0044916 3300048919 Bacteria 2995
528 Ga0496117_0011160 3300048920 Bacteria 8074
529 Ga0496117_0030126 3300048920 Bacteria 4170
530 Ga0496118_0102292 3300048921 Bacteria 1931
531 Ga0496118_0238353 3300048921 Bacteria 1043
532 Ga0496119_0038364 3300048922 Bacteria 3097
533 Ga0496121_0085656 3300048924 Bacteria 2479
534 Ga0496121_0180064 3300048924 Bacteria 1526
535 Ga0496122_0200657 3300048925 Bacteria 1167
536 Ga0496123_0054443 3300048926 Bacteria 2634
537 Ga0496123_0087843 3300048926 Bacteria 1858
538 Ga0496123_0091973 3300048926 Bacteria 1797
539 Ga0496124_0046565 3300048927 Bacteria 3713
540 Ga0496124_0068685 3300048927 Bacteria 2944
541 Ga0496125_0006952 3300048928 Bacteria 12116
542 Ga0496125_0036027 3300048928 Bacteria 4328
543 Ga0496125_0087016 3300048928 Bacteria 2361
544 Ga0501031_0225466 3300049568 Bacteria 1220
545 Ga0501036_0164411 3300049572 Bacteria 1871
546 Ga0501040_0096319 3300049576 Bacteria 2060
547 Ga0501042_0026616 3300049578 Bacteria 4063
548 Ga0501043_0104944 3300049579 Bacteria 2221
549 Ga0501046_0121496 3300049580 Bacteria 1987
550 Ga0501047_0036244 3300049581 Bacteria 4766
551 Ga0501048_0016755 3300049582 Bacteria 5402
552 Ga0501071_0063292 3300049587 Bacteria 2682
553 Ga0501072_0004600 3300049588 Bacteria 10505
554 Ga0501075_0001513 3300049591 Bacteria 15163
555 Ga0501076_0004572 3300049592 Bacteria 9850
556 Ga0501077_0197583 3300049593 Bacteria 1278
557 Ga0501249_006096 3300049679 Bacteria 2477
558 Ga0501079_0003913 3300049741 Bacteria 10999
559 Ga0501080_0004252 3300049742 Bacteria 12707
560 Ga0501044_0058219 3300049823 Bacteria 3963
561 Ga0501045_0003295 3300049824 Bacteria 11029
562 nmdc:mga03683_12981_c1 3300050489 Bacteria 3055
563 nmdc:mga03683_24037_c1 3300050489 Bacteria 2381
564 nmdc:mga03683_60615_c1 3300050489 Bacteria 1598
565 nmdc:mga03n38_19842_c1 3300050490 Bacteria 2678
566 nmdc:mga03n38_41284_c1 3300050490 Bacteria 2010
567 nmdc:mga03n38_55764_c1 3300050490 Bacteria 1781
568 nmdc:mga00v17_30844_c1 3300050491 Bacteria 3156
569 nmdc:mga00v17_41129_c1 3300050491 Bacteria 2388
570 nmdc:mga0yw44_133478_c1 3300050492 Bacteria 1609
571 nmdc:mga0yw44_7767_c1 3300050492 Bacteria 5301
572 nmdc:mga0k408_125039_c1 3300050493 Bacteria 1525
573 nmdc:mga0k408_151760_c1 3300050493 Bacteria 1380
574 nmdc:mga0k408_1652_c1 3300050493 Bacteria 12054
575 nmdc:mga0k408_17654_c1 3300050493 Bacteria 3976
576 nmdc:mga0k408_3908_c1 3300050493 Bacteria 7899
577 nmdc:mga0k408_9932_c1 3300050493 Bacteria 5138
578 nmdc:mga06z11_116231_c1 3300050494 Bacteria 1487
579 nmdc:mga06z11_210980_c1 3300050494 Bacteria 1131
580 nmdc:mga07m45_12514_c1 3300050496 Bacteria 4486
581 nmdc:mga07m45_15913_c1 3300050496 Bacteria 4022
582 nmdc:mga07m45_16947_c1 3300050496 Bacteria 3906
583 nmdc:mga08y16_217260_c1 3300050511 Bacteria 1485
584 nmdc:mga0n895_299159_c1 3300050512 Bacteria 1631
585 nmdc:mga08x19_50530_c1 3300050514 Bacteria 2668
586 Ga0500610_0005654 3300053079 Bacteria 5153
587 Ga0500610_0023766 3300053079 Bacteria 3038
588 Ga0500643_012105 3300053087 Bacteria 3106
589 Ga0500651_0000095 3300053093 Bacteria 54857
590 Ga0500641_0101364 3300053096 Bacteria 1235
591 Ga0500571_000379 3300053110 Bacteria 17609
592 Ga0500592_019484 3300053116 Bacteria 1090
593 Ga0500593_022497 3300053117 Bacteria 2783
594 Ga0500594_0001104 3300053118 Bacteria 5785
595 Ga0500607_003662 3300053121 Bacteria 11040
596 Ga0500626_018467 3300053128 Bacteria 3080
597 Ga0500655_003070 3300053133 Bacteria 3029
598 Ga0500658_0000763 3300053134 Bacteria 13270
599 Ga0500658_0000783 3300053134 Bacteria 13145
600 Ga0500564_062282 3300053138 Bacteria 1691
601 Ga0500568_0004399 3300053139 Bacteria 7538
602 Ga0500616_0025191 3300053153 Bacteria 3300
603 Ga0500627_0001630 3300053158 Bacteria 6339
604 Ga0500634_0041574 3300053161 Bacteria 2496
605 Ga0590077_012140 3300059426 Bacteria 1783
606 Ga0501082_0015479 3300060353 Bacteria 6565
607 Ga0530510_0003286 3300061734 Bacteria 11125

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031911 Ga0307412_10003421 Ga0307412_100034213 257
2 3300028794 Ga0307515_10000195 Ga0307515_1000019518 260
3 3300009036 Ga0105244_10079444 Ga0105244_100794441 264
4 3300041411 Ga0439466_0055840 Ga0439466_0055840_289_1197 264
5 3300042125 Ga0450923_012492 Ga0450923_012492_463_1371 264
6 3300042134 Ga0450898_005819 Ga0450898_005819_408_1316 264
7 3300042145 Ga0450906_003992 Ga0450906_003992_342_1250 264
8 3300042147 Ga0450910_019328 Ga0450910_019328_91_999 264
9 3300042184 Ga0450908_002489 Ga0450908_002489_422_1330 264
10 3300042435 Ga0439434_0002733 Ga0439434_0002733_2151_3059 264
11 3300042531 Ga0450918_008218 Ga0450918_008218_852_1760 264
12 3300048926 Ga0496123_0087843 Ga0496123_0087843_271_1209 264
13 3300010375 Ga0105239_10098604 Ga0105239_100986042 266
14 3300042876 Ga0451577_0438419 Ga0451577_0438419_207_1154 268
15 3300053079 Ga0500610_0005654 Ga0500610_0005654_2419_3309 268
16 3300053096 Ga0500641_0101364 Ga0500641_0101364_321_1211 268
17 3300053158 Ga0500627_0001630 Ga0500627_0001630_1320_2210 268
18 3300037471 Ga0395905_0134246 Ga0395905_0134246_358_1200 269
19 3300003187 JGI25151J46595_10002864 JGI25151J46595_100028644 270
20 3300006048 Ga0075363_100103566 Ga0075363_1001035662 270
21 3300025258 Ga0209129_1002316 Ga0209129_10023168 270
22 3300025294 Ga0209025_1000230 Ga0209025_100023092 270
23 3300006237 Ga0097621_100575132 Ga0097621_1005751321 271
24 3300049568 Ga0501031_0225466 Ga0501031_0225466_177_1076 271
25 3300049572 Ga0501036_0164411 Ga0501036_0164411_821_1720 271
26 3300049579 Ga0501043_0104944 Ga0501043_0104944_1225_2124 271
27 3300049581 Ga0501047_0036244 Ga0501047_0036244_3788_4687 271
28 3300049823 Ga0501044_0058219 Ga0501044_0058219_1467_2366 271
29 3300005344 Ga0070661_100371929 Ga0070661_1003719291 272
30 3300005456 Ga0070678_100031542 Ga0070678_1000315422 272
31 3300005471 Ga0070698_100086842 Ga0070698_1000868423 272
32 3300005471 Ga0070698_100293278 Ga0070698_1002932782 272
33 3300005544 Ga0070686_100053105 Ga0070686_1000531051 272
34 3300005548 Ga0070665_100011810 Ga0070665_1000118108 272
35 3300005549 Ga0070704_100003685 Ga0070704_1000036856 272
36 3300005616 Ga0068852_100046536 Ga0068852_1000465363 272
37 3300005834 Ga0068851_10075785 Ga0068851_100757852 272
38 3300005841 Ga0068863_100126211 Ga0068863_1001262113 272
39 3300005842 Ga0068858_100021427 Ga0068858_1000214274 272
40 3300005844 Ga0068862_100347884 Ga0068862_1003478841 272
41 3300005844 Ga0068862_100487504 Ga0068862_1004875041 272
42 3300006358 Ga0068871_100038278 Ga0068871_1000382783 272
43 3300006914 Ga0075436_100040806 Ga0075436_1000408062 272
44 3300009101 Ga0105247_10100109 Ga0105247_101001092 272
45 3300009148 Ga0105243_10485563 Ga0105243_104855631 272
46 3300009177 Ga0105248_10322262 Ga0105248_103222622 272
47 3300013102 Ga0157371_10098047 Ga0157371_100980472 272
48 3300013296 Ga0157374_10406134 Ga0157374_104061342 272
49 3300013308 Ga0157375_10092205 Ga0157375_100922052 272
50 3300014969 Ga0157376_10008387 Ga0157376_100083876 272
51 3300014969 Ga0157376_10091198 Ga0157376_100911982 272
52 3300025908 Ga0207643_10002167 Ga0207643_100021678 272
53 3300025941 Ga0207711_10253687 Ga0207711_102536872 272
54 3300025942 Ga0207689_10674292 Ga0207689_106742921 272
55 3300025972 Ga0207668_10265206 Ga0207668_102652062 272
56 3300026067 Ga0207678_10006601 Ga0207678_100066017 272
57 3300026078 Ga0207702_10088618 Ga0207702_100886183 272
58 3300026088 Ga0207641_10145888 Ga0207641_101458881 272
59 3300026089 Ga0207648_10399724 Ga0207648_103997241 272
60 3300026121 Ga0207683_10049844 Ga0207683_100498442 272
61 3300026142 Ga0207698_10121211 Ga0207698_101212112 272
62 3300028379 Ga0268266_10060061 Ga0268266_100600613 272
63 3300031730 Ga0307516_10098572 Ga0307516_100985723 272
64 3300036401 Ga0373937_0012507 Ga0373937_0012507_6214_7059 272
65 3300037068 Ga0373925_0021639 Ga0373925_0021639_530_1375 272
66 3300037312 Ga0395899_0018078 Ga0395899_0018078_1823_2674 272
67 3300037418 Ga0395900_0023033 Ga0395900_0023033_4142_4993 272
68 3300037466 Ga0395898_0003690 Ga0395898_0003690_2723_3574 272
69 3300037471 Ga0395905_0028868 Ga0395905_0028868_1782_2633 272
70 3300037471 Ga0395905_0116084 Ga0395905_0116084_945_1796 272
71 3300037471 Ga0395905_0154316 Ga0395905_0154316_159_1013 272
72 3300038443 Ga0395901_0066699 Ga0395901_0066699_2365_3216 272
73 3300038443 Ga0395901_0157157 Ga0395901_0157157_482_1336 272
74 3300042876 Ga0451577_0002570 Ga0451577_0002570_2880_3722 272
75 3300044656 Ga0466969_0008092 Ga0466969_0008092_3830_4681 272
76 3300044658 Ga0466972_0037322 Ga0466972_0037322_900_1745 272
77 3300044684 Ga0466966_0007151 Ga0466966_0007151_933_1778 272
78 3300044684 Ga0466966_0011845 Ga0466966_0011845_1248_2099 272
79 3300044693 Ga0466961_0026791 Ga0466961_0026791_2371_3222 272
80 3300044712 Ga0453684_0613142 Ga0453684_0613142_328_1173 272
81 3300044712 Ga0453684_0657291 Ga0453684_0657291_226_1071 272
82 3300047315 Ga0495581_0128471 Ga0495581_0128471_272_1117 272
83 3300050511 nmdc:mga08y16_217260_c1 nmdc:mga08y16_217260_c1_20_865 272
84 3300050514 nmdc:mga08x19_50530_c1 nmdc:mga08x19_50530_c1_1345_2190 272
85 iso_pu_bacteria 2842747753 2842748424 272
86 3300035695 Ga0373927_0015731 Ga0373927_0015731_575_1438 273
87 3300037312 Ga0395899_0033664 Ga0395899_0033664_148_1095 273
88 3300037418 Ga0395900_0307825 Ga0395900_0307825_298_1191 273
89 3300037466 Ga0395898_0050321 Ga0395898_0050321_1090_1983 273
90 3300038443 Ga0395901_0217550 Ga0395901_0217550_351_1244 273
91 iso_pu_bacteria 2842733646 2842735858 273
92 iso_pu_bacteria 2919704043 2919708548 273
93 3300005356 Ga0070674_100016462 Ga0070674_1000164623 274
94 3300005459 Ga0068867_100018445 Ga0068867_1000184451 274
95 3300005578 Ga0068854_100373794 Ga0068854_1003737942 274
96 3300006038 Ga0075365_10024549 Ga0075365_100245493 274
97 3300006048 Ga0075363_100082350 Ga0075363_1000823502 274
98 3300006178 Ga0075367_10008687 Ga0075367_100086872 274
99 3300013104 Ga0157370_10212098 Ga0157370_102120982 274
100 3300025291 Ga0209675_1003199 Ga0209675_10031997 274
101 3300025298 Ga0209050_1006208 Ga0209050_10062083 274
102 3300026041 Ga0207639_10052443 Ga0207639_100524432 274
103 3300028381 Ga0268264_10111576 Ga0268264_101115762 274
104 3300031911 Ga0307412_10071279 Ga0307412_100712793 274
105 3300032002 Ga0307416_100197355 Ga0307416_1001973552 274
106 3300032005 Ga0307411_10609413 Ga0307411_106094131 274
107 3300042014 Ga0439457_024855 Ga0439457_024855_114_962 274
108 3300046515 Ga0495620_0041269 Ga0495620_0041269_234_1124 274
109 3300046520 Ga0495637_0021992 Ga0495637_0021992_1314_2204 274
110 3300046524 Ga0495648_0127719 Ga0495648_0127719_247_1137 274
111 3300046660 Ga0495625_0092376 Ga0495625_0092376_572_1462 274
112 3300046674 Ga0495588_0031063 Ga0495588_0031063_1349_2239 274
113 3300046683 Ga0495658_0336209 Ga0495658_0336209_16_906 274
114 3300048919 Ga0496116_0044916 Ga0496116_0044916_1350_2246 274
115 3300048924 Ga0496121_0180064 Ga0496121_0180064_42_938 274
116 3300048925 Ga0496122_0200657 Ga0496122_0200657_91_987 274
117 3300048926 Ga0496123_0054443 Ga0496123_0054443_105_1001 274
118 3300050490 nmdc:mga03n38_55764_c1 nmdc:mga03n38_55764_c1_732_1613 274
119 3300050492 nmdc:mga0yw44_133478_c1 nmdc:mga0yw44_133478_c1_613_1494 274
120 3300050493 nmdc:mga0k408_17654_c1 nmdc:mga0k408_17654_c1_1569_2450 274
121 3300050494 nmdc:mga06z11_116231_c1 nmdc:mga06z11_116231_c1_38_919 274
122 3300053079 Ga0500610_0023766 Ga0500610_0023766_447_1337 274
123 3300053121 Ga0500607_003662 Ga0500607_003662_9771_10661 274
124 iso_pu_bacteria 2738541277 2738717323 274
125 iso_pu_bacteria 2738543019 2739278009 274
126 iso_pu_bacteria 2945909444 2945911136 274
127 3300002739 JGI25158J39367_1007490 JGI25158J39367_10074902 275
128 3300002774 JGI25150J39212_1001112 JGI25150J39212_10011128 275
129 3300002987 JGI25159J45721_1001424 JGI25159J45721_10014246 275
130 3300003187 JGI25151J46595_10003442 JGI25151J46595_100034426 275
131 3300003215 JGI25153J46596_10003509 JGI25153J46596_100035096 275
132 3300003215 JGI25153J46596_10024776 JGI25153J46596_100247762 275
133 3300003354 JGI25160J50197_1001928 JGI25160J50197_10019286 275
134 3300003374 JGI25161J50226_1001375 JGI25161J50226_10013753 275
135 3300003374 JGI25161J50226_1002423 JGI25161J50226_10024233 275
136 3300003578 Ga0006562J51391_1083753 Ga0006562J51391_10837532 275
137 3300003760 Ga0055527_1004559 Ga0055527_10045592 275
138 3300003761 Ga0055535_1001422 Ga0055535_10014227 275
139 3300003762 Ga0055542_1000109 Ga0055542_1000109111 275
140 3300003771 Ga0055526_1005481 Ga0055526_10054816 275
141 3300003771 Ga0055526_1005616 Ga0055526_10056166 275
142 3300003773 Ga0055537_1000195 Ga0055537_100019543 275
143 3300003773 Ga0055537_1001992 Ga0055537_10019926 275
144 3300003775 Ga0055524_1003731 Ga0055524_10037316 275
145 3300003775 Ga0055524_1009153 Ga0055524_10091532 275
146 3300003781 Ga0055536_1002896 Ga0055536_10028968 275
147 3300003781 Ga0055536_1003710 Ga0055536_10037104 275
148 3300003781 Ga0055536_1008623 Ga0055536_10086233 275
149 3300003784 Ga0055534_1000285 Ga0055534_100028534 275
150 3300003784 Ga0055534_1001560 Ga0055534_10015605 275
151 3300003790 Ga0055528_1002453 Ga0055528_10024536 275
152 3300003790 Ga0055528_1002896 Ga0055528_10028964 275
153 3300003791 Ga0055530_10000495 Ga0055530_1000049524 275
154 3300003791 Ga0055530_10005626 Ga0055530_100056264 275
155 3300003792 Ga0055540_1002205 Ga0055540_10022057 275
156 3300003792 Ga0055540_1003089 Ga0055540_10030895 275
157 3300003792 Ga0055540_1004833 Ga0055540_10048334 275
158 3300003792 Ga0055540_1005512 Ga0055540_10055123 275
159 3300003794 Ga0055531_10002052 Ga0055531_100020522 275
160 3300003794 Ga0055531_10002338 Ga0055531_100023387 275
161 3300003794 Ga0055531_10003743 Ga0055531_100037436 275
162 3300004625 Ga0055543_1001345 Ga0055543_10013456 275
163 3300004625 Ga0055543_1015707 Ga0055543_10157072 275
164 3300005262 Ga0065165_1003856 Ga0065165_10038566 275
165 3300005262 Ga0065165_1030924 Ga0065165_10309242 275
166 3300005288 Ga0065714_10007224 Ga0065714_100072243 275
167 3300005366 Ga0070659_100085977 Ga0070659_1000859772 275
168 3300005457 Ga0070662_100224053 Ga0070662_1002240532 275
169 3300005457 Ga0070662_100252724 Ga0070662_1002527242 275
170 3300005536 Ga0070697_100036413 Ga0070697_1000364135 275
171 3300005539 Ga0068853_100013928 Ga0068853_1000139282 275
172 3300005564 Ga0070664_100011902 Ga0070664_1000119028 275
173 3300005616 Ga0068852_100186786 Ga0068852_1001867862 275
174 3300005844 Ga0068862_100065534 Ga0068862_1000655342 275
175 3300006038 Ga0075365_10023759 Ga0075365_100237592 275
176 3300006048 Ga0075363_100011081 Ga0075363_1000110812 275
177 3300006048 Ga0075363_100019974 Ga0075363_1000199743 275
178 3300006051 Ga0075364_10047864 Ga0075364_100478642 275
179 3300006051 Ga0075364_10058901 Ga0075364_100589013 275
180 3300006177 Ga0075362_10037146 Ga0075362_100371462 275
181 3300006177 Ga0075362_10082346 Ga0075362_100823462 275
182 3300006195 Ga0075366_10015053 Ga0075366_100150532 275
183 3300006353 Ga0075370_10006104 Ga0075370_100061045 275
184 3300006353 Ga0075370_10039862 Ga0075370_100398622 275
185 3300006353 Ga0075370_10101600 Ga0075370_101016002 275
186 3300006948 Ga0099826_10001304 Ga0099826_1000130412 275
187 3300009036 Ga0105244_10005148 Ga0105244_100051489 275
188 3300009148 Ga0105243_10000200 Ga0105243_100002005 275
189 3300009148 Ga0105243_10004089 Ga0105243_100040898 275
190 3300009148 Ga0105243_10078507 Ga0105243_100785072 275
191 3300011119 Ga0105246_10051231 Ga0105246_100512313 275
192 3300013100 Ga0157373_10129396 Ga0157373_101293962 275
193 3300013100 Ga0157373_10264740 Ga0157373_102647402 275
194 3300013105 Ga0157369_10015892 Ga0157369_100158923 275
195 3300014497 Ga0182008_10006481 Ga0182008_100064816 275
196 3300015261 Ga0182006_1012639 Ga0182006_10126394 275
197 3300015262 Ga0182007_10002662 Ga0182007_100026629 275
198 3300017792 Ga0163161_10000079 Ga0163161_100000797 275
199 3300017792 Ga0163161_10077868 Ga0163161_100778682 275
200 3300021361 Ga0213872_10005591 Ga0213872_100055911 275
201 3300025208 Ga0209436_108606 Ga0209436_1086062 275
202 3300025228 Ga0209672_100979 Ga0209672_10097913 275
203 3300025229 Ga0209147_102886 Ga0209147_1028863 275
204 3300025242 Ga0209258_100048 Ga0209258_100048111 275
205 3300025245 Ga0207425_1000107 Ga0207425_100010764 275
206 3300025245 Ga0207425_1007836 Ga0207425_10078363 275
207 3300025254 Ga0209148_1000040 Ga0209148_1000040111 275
208 3300025258 Ga0209129_1000007 Ga0209129_100000755 275
209 3300025258 Ga0209129_1008679 Ga0209129_10086793 275
210 3300025263 Ga0209565_1000087 Ga0209565_100008743 275
211 3300025263 Ga0209565_1001141 Ga0209565_10011419 275
212 3300025263 Ga0209565_1006544 Ga0209565_10065443 275
213 3300025273 Ga0209673_1000145 Ga0209673_100014543 275
214 3300025273 Ga0209673_1000559 Ga0209673_10005596 275
215 3300025273 Ga0209673_1000636 Ga0209673_100063656 275
216 3300025273 Ga0209673_1003414 Ga0209673_10034149 275
217 3300025273 Ga0209673_1020967 Ga0209673_10209672 275
218 3300025284 Ga0209130_1000215 Ga0209130_100021516 275
219 3300025284 Ga0209130_1000341 Ga0209130_100034123 275
220 3300025291 Ga0209675_1000085 Ga0209675_100008543 275
221 3300025291 Ga0209675_1001865 Ga0209675_10018658 275
222 3300025292 Ga0209676_1000004 Ga0209676_1000004796 275
223 3300025292 Ga0209676_1000071 Ga0209676_1000071206 275
224 3300025292 Ga0209676_1000172 Ga0209676_100017260 275
225 3300025292 Ga0209676_1005241 Ga0209676_10052416 275
226 3300025294 Ga0209025_1000507 Ga0209025_10005077 275
227 3300025295 Ga0209564_1000200 Ga0209564_1000200133 275
228 3300025295 Ga0209564_1000318 Ga0209564_100031877 275
229 3300025297 Ga0209758_1000025 Ga0209758_1000025471 275
230 3300025297 Ga0209758_1046212 Ga0209758_10462122 275
231 3300025298 Ga0209050_1000002 Ga0209050_10000021306 275
232 3300025298 Ga0209050_1000509 Ga0209050_10005099 275
233 3300025298 Ga0209050_1019262 Ga0209050_10192622 275
234 3300025299 Ga0209256_1000067 Ga0209256_100006766 275
235 3300025299 Ga0209256_1000198 Ga0209256_100019877 275
236 3300025302 Ga0207426_1000001 Ga0207426_1000001107 275
237 3300025302 Ga0207426_1000178 Ga0207426_100017861 275
238 3300025302 Ga0207426_1000264 Ga0207426_100026458 275
239 3300025303 Ga0209051_1000002 Ga0209051_10000021076 275
240 3300025303 Ga0209051_1000096 Ga0209051_1000096109 275
241 3300025303 Ga0209051_1000169 Ga0209051_100016988 275
242 3300025303 Ga0209051_1000278 Ga0209051_100027862 275
243 3300025303 Ga0209051_1000342 Ga0209051_10003422 275
244 3300025303 Ga0209051_1000397 Ga0209051_100039749 275
245 3300025304 Ga0209257_1000002 Ga0209257_10000021217 275
246 3300025304 Ga0209257_1000072 Ga0209257_1000072224 275
247 3300025304 Ga0209257_1000497 Ga0209257_100049758 275
248 3300025304 Ga0209257_1001087 Ga0209257_100108724 275
249 3300025304 Ga0209257_1005665 Ga0209257_10056655 275
250 3300025304 Ga0209257_1006992 Ga0209257_10069924 275
251 3300025728 Ga0207655_1001662 Ga0207655_10016623 275
252 3300025933 Ga0207706_10141781 Ga0207706_101417812 275
253 3300025935 Ga0207709_10000038 Ga0207709_1000003868 275
254 3300025935 Ga0207709_10001681 Ga0207709_1000168114 275
255 3300025935 Ga0207709_10006910 Ga0207709_100069107 275
256 3300025942 Ga0207689_10104271 Ga0207689_101042711 275
257 3300025945 Ga0207679_10062927 Ga0207679_100629272 275
258 3300025949 Ga0207667_10060380 Ga0207667_100603803 275
259 3300026041 Ga0207639_10010000 Ga0207639_100100007 275
260 3300026116 Ga0207674_10159225 Ga0207674_101592252 275
261 3300026142 Ga0207698_10543853 Ga0207698_105438531 275
262 3300028380 Ga0268265_10060528 Ga0268265_100605283 275
263 3300030742 Ga0316183_1124715 Ga0316183_11247152 275
264 3300031456 Ga0307513_10001731 Ga0307513_1000173125 275
265 3300031548 Ga0307408_100000200 Ga0307408_10000020033 275
266 3300031548 Ga0307408_100134837 Ga0307408_1001348372 275
267 3300031548 Ga0307408_100280050 Ga0307408_1002800502 275
268 3300031730 Ga0307516_10006719 Ga0307516_1000671910 275
269 3300031731 Ga0307405_10022557 Ga0307405_100225573 275
270 3300031731 Ga0307405_10162074 Ga0307405_101620742 275
271 3300031901 Ga0307406_10004441 Ga0307406_100044415 275
272 3300031901 Ga0307406_10150811 Ga0307406_101508112 275
273 3300031911 Ga0307412_10007892 Ga0307412_100078926 275
274 3300032004 Ga0307414_10081926 Ga0307414_100819262 275
275 3300032004 Ga0307414_10131848 Ga0307414_101318482 275
276 3300037471 Ga0395905_0000421 Ga0395905_0000421_44546_45406 275
277 3300039447 Ga0436361_1143890 Ga0436361_1143890_6919_7845 275
278 3300041404 Ga0439436_0006508 Ga0439436_0006508_736_1635 275
279 3300041410 Ga0439461_0014337 Ga0439461_0014337_335_1234 275
280 3300041413 Ga0439465_0001810 Ga0439465_0001810_5691_6590 275
281 3300041496 Ga0451839_1198531 Ga0451839_1198531_105_1007 275
282 3300041997 Ga0439431_0001122 Ga0439431_0001122_2575_3474 275
283 3300042004 Ga0439445_0001661 Ga0439445_0001661_1378_2277 275
284 3300042006 Ga0439432_003301 Ga0439432_003301_3098_3997 275
285 3300042007 Ga0439449_0002844 Ga0439449_0002844_1035_1934 275
286 3300042010 Ga0439452_004527 Ga0439452_004527_2393_3292 275
287 3300042014 Ga0439457_005798 Ga0439457_005798_1951_2850 275
288 3300042015 Ga0439462_0019581 Ga0439462_0019581_400_1299 275
289 3300042876 Ga0451577_0592001 Ga0451577_0592001_30_920 275
290 3300046453 Ga0495627_017433 Ga0495627_017433_1436_2335 275
291 3300046460 Ga0495638_0082054 Ga0495638_0082054_664_1572 275
292 3300046515 Ga0495620_0029354 Ga0495620_0029354_1405_2313 275
293 3300046518 Ga0495631_0000021 Ga0495631_0000021_80694_81602 275
294 3300046522 Ga0495643_0111984 Ga0495643_0111984_11_889 275
295 3300046558 Ga0495633_0001670 Ga0495633_0001670_7137_8000 275
296 3300046616 Ga0495668_0057402 Ga0495668_0057402_858_1766 275
297 3300046648 Ga0495611_0008518 Ga0495611_0008518_603_1466 275
298 3300046660 Ga0495625_0000012 Ga0495625_0000012_232138_233034 275
299 3300046660 Ga0495625_0033882 Ga0495625_0033882_1683_2591 275
300 3300046660 Ga0495625_0146286 Ga0495625_0146286_153_1016 275
301 3300046665 Ga0495661_0011511 Ga0495661_0011511_1184_2047 275
302 3300046683 Ga0495658_0042706 Ga0495658_0042706_175_1095 275
303 3300046691 Ga0495670_0001518 Ga0495670_0001518_7101_7964 275
304 3300046692 Ga0495671_0026731 Ga0495671_0026731_430_1329 275
305 3300046794 Ga0495589_0015362 Ga0495589_0015362_2786_3649 275
306 3300047445 Ga0495677_0000874 Ga0495677_0000874_3170_4033 275
307 3300047470 Ga0495681_0009255 Ga0495681_0009255_4701_5564 275
308 3300048089 Ga0495614_0003864 Ga0495614_0003864_2087_3007 275
309 3300048920 Ga0496117_0011160 Ga0496117_0011160_1526_2449 275
310 3300048920 Ga0496117_0030126 Ga0496117_0030126_1934_2830 275
311 3300048921 Ga0496118_0102292 Ga0496118_0102292_764_1687 275
312 3300048921 Ga0496118_0238353 Ga0496118_0238353_37_933 275
313 3300048922 Ga0496119_0038364 Ga0496119_0038364_880_1788 275
314 3300048924 Ga0496121_0085656 Ga0496121_0085656_1256_2164 275
315 3300048926 Ga0496123_0091973 Ga0496123_0091973_329_1237 275
316 3300048927 Ga0496124_0046565 Ga0496124_0046565_1463_2359 275
317 3300048927 Ga0496124_0068685 Ga0496124_0068685_1373_2296 275
318 3300048928 Ga0496125_0006952 Ga0496125_0006952_5391_6287 275
319 3300048928 Ga0496125_0036027 Ga0496125_0036027_3152_4060 275
320 3300048928 Ga0496125_0087016 Ga0496125_0087016_655_1578 275
321 3300049679 Ga0501249_006096 Ga0501249_006096_1524_2432 275
322 3300050489 nmdc:mga03683_12981_c1 nmdc:mga03683_12981_c1_1588_2496 275
323 3300050489 nmdc:mga03683_24037_c1 nmdc:mga03683_24037_c1_1098_2006 275
324 3300050489 nmdc:mga03683_60615_c1 nmdc:mga03683_60615_c1_452_1360 275
325 3300050490 nmdc:mga03n38_19842_c1 nmdc:mga03n38_19842_c1_1239_2114 275
326 3300050490 nmdc:mga03n38_41284_c1 nmdc:mga03n38_41284_c1_1071_1979 275
327 3300050491 nmdc:mga00v17_41129_c1 nmdc:mga00v17_41129_c1_242_1150 275
328 3300050493 nmdc:mga0k408_125039_c1 nmdc:mga0k408_125039_c1_18_926 275
329 3300050493 nmdc:mga0k408_151760_c1 nmdc:mga0k408_151760_c1_261_1169 275
330 3300050496 nmdc:mga07m45_12514_c1 nmdc:mga07m45_12514_c1_61_957 275
331 3300050496 nmdc:mga07m45_15913_c1 nmdc:mga07m45_15913_c1_1051_1959 275
332 3300050496 nmdc:mga07m45_16947_c1 nmdc:mga07m45_16947_c1_719_1615 275
333 3300053087 Ga0500643_012105 Ga0500643_012105_1558_2478 275
334 3300053093 Ga0500651_0000095 Ga0500651_0000095_11332_12252 275
335 3300053110 Ga0500571_000379 Ga0500571_000379_10884_11804 275
336 3300053116 Ga0500592_019484 Ga0500592_019484_94_1002 275
337 3300053117 Ga0500593_022497 Ga0500593_022497_1399_2298 275
338 3300053118 Ga0500594_0001104 Ga0500594_0001104_1067_1975 275
339 3300053128 Ga0500626_018467 Ga0500626_018467_1508_2416 275
340 3300053133 Ga0500655_003070 Ga0500655_003070_1689_2609 275
341 3300053134 Ga0500658_0000763 Ga0500658_0000763_4680_5600 275
342 3300053134 Ga0500658_0000783 Ga0500658_0000783_6286_7194 275
343 3300053138 Ga0500564_062282 Ga0500564_062282_107_1027 275
344 3300053139 Ga0500568_0004399 Ga0500568_0004399_4249_5157 275
345 3300053153 Ga0500616_0025191 Ga0500616_0025191_191_1099 275
346 3300053161 Ga0500634_0041574 Ga0500634_0041574_1275_2150 275
347 iso_pu_bacteria 2513020051 2513229097 275
348 iso_pu_bacteria 2599185214 2599624850 275
349 iso_pu_bacteria 2599185226 2599672862 275
350 iso_pu_bacteria 2599185227 2599682688 275
351 iso_pu_bacteria 2599185229 2599694471 275
352 iso_pu_bacteria 2643221628 2644162479 275
353 iso_pu_bacteria 2643221658 2644329181 275
354 iso_pu_bacteria 2643221672 2644401725 275
355 iso_pu_bacteria 2643221683 2644467835 275
356 iso_pu_bacteria 2738541307 2738878899 275
357 iso_pu_bacteria 2818991446 2819596790 275
358 iso_pu_bacteria 2831265667 2831265906 275
359 iso_pu_bacteria 2838054893 2838060815 275
360 iso_pu_bacteria 2842677519 2842678397 275
361 iso_pu_bacteria 2885192300 2885197374 275
362 iso_pu_bacteria 2885198086 2885203553 275
363 iso_pu_bacteria 2885211737 2885217097 275
364 iso_pu_bacteria 2899924645 2899930426 275
365 iso_pu_bacteria 2904449895 2904455048 275
366 iso_pu_bacteria 2904456579 2904457408 275
367 iso_pu_bacteria 2904541872 2904543855 275
368 iso_pu_bacteria 2919462493 2919465187 275
369 iso_pu_bacteria 2919704043 2919708745 275
370 iso_pu_bacteria 2928037797 2928039539 275
371 iso_pu_bacteria 2928044640 2928044856 275
372 iso_pu_bacteria 2928051484 2928052657 275
373 iso_pu_bacteria 2928064002 2928064682 275
374 iso_pu_bacteria 2928070936 2928074891 275
375 iso_pu_bacteria 2928084124 2928089031 275
376 iso_pu_bacteria 2929160207 2929162587 275
377 iso_pu_bacteria 2929520902 2929525154 275
378 iso_pu_bacteria 2945945610 2945948517 275
379 iso_pu_bacteria 2945972063 2945977791 275
380 iso_pu_bacteria 2945984333 2945986563 275
381 iso_pu_bacteria 2954767861 2954772742 275
382 3300006051 Ga0075364_10015537 Ga0075364_100155372 276
383 3300006195 Ga0075366_10013726 Ga0075366_100137263 276
384 3300009176 Ga0105242_10003462 Ga0105242_100034625 276
385 3300013297 Ga0157378_10115984 Ga0157378_101159842 276
386 3300025922 Ga0207646_10222534 Ga0207646_102225341 276
387 3300025934 Ga0207686_10057835 Ga0207686_100578352 276
388 3300049576 Ga0501040_0096319 Ga0501040_0096319_619_1476 276
389 3300049578 Ga0501042_0026616 Ga0501042_0026616_1830_2687 276
390 3300049580 Ga0501046_0121496 Ga0501046_0121496_688_1545 276
391 3300049582 Ga0501048_0016755 Ga0501048_0016755_1593_2450 276
392 3300049587 Ga0501071_0063292 Ga0501071_0063292_742_1599 276
393 3300049588 Ga0501072_0004600 Ga0501072_0004600_9070_9927 276
394 3300049591 Ga0501075_0001513 Ga0501075_0001513_291_1148 276
395 3300049592 Ga0501076_0004572 Ga0501076_0004572_1064_1921 276
396 3300049593 Ga0501077_0197583 Ga0501077_0197583_132_989 276
397 3300049741 Ga0501079_0003913 Ga0501079_0003913_3258_4115 276
398 3300049742 Ga0501080_0004252 Ga0501080_0004252_2717_3574 276
399 3300049824 Ga0501045_0003295 Ga0501045_0003295_3337_4194 276
400 3300050491 nmdc:mga00v17_30844_c1 nmdc:mga00v17_30844_c1_315_1226 276
401 3300060353 Ga0501082_0015479 Ga0501082_0015479_2953_3810 276
402 3300061734 Ga0530510_0003286 Ga0530510_0003286_3683_4540 276
403 3300005293 Ga0065715_10120017 Ga0065715_101200172 277
404 3300005328 Ga0070676_10214323 Ga0070676_102143232 277
405 3300005331 Ga0070670_100027478 Ga0070670_1000274784 277
406 3300005333 Ga0070677_10001855 Ga0070677_100018554 277
407 3300005333 Ga0070677_10009884 Ga0070677_100098843 277
408 3300005338 Ga0068868_100065308 Ga0068868_1000653082 277
409 3300005353 Ga0070669_100002821 Ga0070669_10000282112 277
410 3300005354 Ga0070675_100003763 Ga0070675_1000037637 277
411 3300005355 Ga0070671_100022052 Ga0070671_1000220524 277
412 3300005356 Ga0070674_100010570 Ga0070674_1000105705 277
413 3300005364 Ga0070673_100234349 Ga0070673_1002343492 277
414 3300005367 Ga0070667_100024167 Ga0070667_1000241674 277
415 3300005435 Ga0070714_100076498 Ga0070714_1000764982 277
416 3300005456 Ga0070678_100008716 Ga0070678_1000087165 277
417 3300005459 Ga0068867_100213875 Ga0068867_1002138752 277
418 3300005530 Ga0070679_100124053 Ga0070679_1001240534 277
419 3300005530 Ga0070679_100125205 Ga0070679_1001252054 277
420 3300005543 Ga0070672_100011724 Ga0070672_1000117243 277
421 3300005563 Ga0068855_100015898 Ga0068855_1000158984 277
422 3300005614 Ga0068856_100141167 Ga0068856_1001411673 277
423 3300005616 Ga0068852_100115168 Ga0068852_1001151682 277
424 3300005618 Ga0068864_100061606 Ga0068864_1000616062 277
425 3300006237 Ga0097621_100025706 Ga0097621_1000257063 277
426 3300009093 Ga0105240_10000945 Ga0105240_1000094535 277
427 3300009551 Ga0105238_10121177 Ga0105238_101211772 277
428 3300013308 Ga0157375_10083529 Ga0157375_100835292 277
429 3300014326 Ga0157380_10292758 Ga0157380_102927582 277
430 3300014326 Ga0157380_10706717 Ga0157380_107067171 277
431 3300014969 Ga0157376_10208506 Ga0157376_102085062 277
432 3300017792 Ga0163161_10005521 Ga0163161_100055212 277
433 3300025893 Ga0207682_10029380 Ga0207682_100293801 277
434 3300025893 Ga0207682_10032517 Ga0207682_100325171 277
435 3300025907 Ga0207645_10011003 Ga0207645_100110032 277
436 3300025909 Ga0207705_10335496 Ga0207705_103354961 277
437 3300025913 Ga0207695_10128363 Ga0207695_101283632 277
438 3300025919 Ga0207657_10024037 Ga0207657_100240373 277
439 3300025921 Ga0207652_10159249 Ga0207652_101592492 277
440 3300025923 Ga0207681_10014220 Ga0207681_100142202 277
441 3300025924 Ga0207694_10108642 Ga0207694_101086422 277
442 3300025925 Ga0207650_10003059 Ga0207650_100030595 277
443 3300025926 Ga0207659_10001323 Ga0207659_100013237 277
444 3300025931 Ga0207644_10014009 Ga0207644_100140093 277
445 3300025938 Ga0207704_10155045 Ga0207704_101550452 277
446 3300025940 Ga0207691_10014001 Ga0207691_100140017 277
447 3300025949 Ga0207667_10094776 Ga0207667_100947763 277
448 3300025986 Ga0207658_10008898 Ga0207658_100088986 277
449 3300026023 Ga0207677_10058187 Ga0207677_100581872 277
450 3300026089 Ga0207648_10006342 Ga0207648_1000634212 277
451 3300026121 Ga0207683_10023532 Ga0207683_100235323 277
452 3300026142 Ga0207698_10178538 Ga0207698_101785382 277
453 3300059426 Ga0590077_012140 Ga0590077_012140_98_955 277
454 3300005329 Ga0070683_100302770 Ga0070683_1003027702 278
455 3300005335 Ga0070666_10056480 Ga0070666_100564802 278
456 3300005338 Ga0068868_100280567 Ga0068868_1002805672 278
457 3300005341 Ga0070691_10071370 Ga0070691_100713702 278
458 3300005345 Ga0070692_10077287 Ga0070692_100772872 278
459 3300005347 Ga0070668_100068787 Ga0070668_1000687872 278
460 3300005356 Ga0070674_100023029 Ga0070674_1000230293 278
461 3300005367 Ga0070667_100021693 Ga0070667_1000216933 278
462 3300005367 Ga0070667_100320199 Ga0070667_1003201992 278
463 3300005436 Ga0070713_100000140 Ga0070713_10000014036 278
464 3300005455 Ga0070663_100028606 Ga0070663_1000286061 278
465 3300005456 Ga0070678_100070954 Ga0070678_1000709542 278
466 3300005457 Ga0070662_100033873 Ga0070662_1000338732 278
467 3300005459 Ga0068867_100000447 Ga0068867_1000004474 278
468 3300005539 Ga0068853_100117921 Ga0068853_1001179211 278
469 3300005545 Ga0070695_100031388 Ga0070695_1000313882 278
470 3300005546 Ga0070696_100490378 Ga0070696_1004903781 278
471 3300005548 Ga0070665_100552469 Ga0070665_1005524692 278
472 3300005614 Ga0068856_100013123 Ga0068856_1000131234 278
473 3300005616 Ga0068852_100261099 Ga0068852_1002610992 278
474 3300005617 Ga0068859_100350372 Ga0068859_1003503722 278
475 3300005618 Ga0068864_100227702 Ga0068864_1002277021 278
476 3300005718 Ga0068866_10047798 Ga0068866_100477982 278
477 3300005841 Ga0068863_100088314 Ga0068863_1000883141 278
478 3300005842 Ga0068858_100212283 Ga0068858_1002122832 278
479 3300005843 Ga0068860_100011430 Ga0068860_1000114303 278
480 3300005843 Ga0068860_100160380 Ga0068860_1001603802 278
481 3300005844 Ga0068862_100034751 Ga0068862_1000347513 278
482 3300006195 Ga0075366_10012633 Ga0075366_100126334 278
483 3300006195 Ga0075366_10048998 Ga0075366_100489982 278
484 3300006353 Ga0075370_10020735 Ga0075370_100207353 278
485 3300006353 Ga0075370_10190614 Ga0075370_101906142 278
486 3300006844 Ga0075428_100221658 Ga0075428_1002216582 278
487 3300006881 Ga0068865_100104083 Ga0068865_1001040832 278
488 3300006931 Ga0097620_100350339 Ga0097620_1003503392 278
489 3300009093 Ga0105240_10012575 Ga0105240_100125758 278
490 3300009094 Ga0111539_10733500 Ga0111539_107335002 278
491 3300009094 Ga0111539_11085566 Ga0111539_110855661 278
492 3300009098 Ga0105245_10212076 Ga0105245_102120762 278
493 3300009148 Ga0105243_10000702 Ga0105243_1000070215 278
494 3300009545 Ga0105237_10000823 Ga0105237_1000082326 278
495 3300009551 Ga0105238_10020717 Ga0105238_100207177 278
496 3300009553 Ga0105249_10072561 Ga0105249_100725612 278
497 3300009553 Ga0105249_10073716 Ga0105249_100737162 278
498 3300010375 Ga0105239_10010731 Ga0105239_100107311 278
499 3300013297 Ga0157378_10059591 Ga0157378_100595912 278
500 3300013306 Ga0163162_10028368 Ga0163162_100283683 278
501 3300013306 Ga0163162_10274017 Ga0163162_102740172 278
502 3300013308 Ga0157375_10131121 Ga0157375_101311212 278
503 3300013308 Ga0157375_10283178 Ga0157375_102831782 278
504 3300014745 Ga0157377_10000027 Ga0157377_1000002798 278
505 3300014968 Ga0157379_10205326 Ga0157379_102053262 278
506 3300017792 Ga0163161_10313581 Ga0163161_103135812 278
507 3300025315 Ga0207697_10017578 Ga0207697_100175782 278
508 3300025913 Ga0207695_10052257 Ga0207695_100522573 278
509 3300025914 Ga0207671_10004092 Ga0207671_100040929 278
510 3300025915 Ga0207693_10073887 Ga0207693_100738872 278
511 3300025919 Ga0207657_10032138 Ga0207657_100321382 278
512 3300025923 Ga0207681_10441542 Ga0207681_104415422 278
513 3300025924 Ga0207694_10007400 Ga0207694_100074006 278
514 3300025933 Ga0207706_10121038 Ga0207706_101210382 278
515 3300025935 Ga0207709_10000526 Ga0207709_1000052620 278
516 3300025935 Ga0207709_10147595 Ga0207709_101475952 278
517 3300025937 Ga0207669_10012633 Ga0207669_100126332 278
518 3300025938 Ga0207704_10007994 Ga0207704_100079942 278
519 3300025938 Ga0207704_10140604 Ga0207704_101406042 278
520 3300025986 Ga0207658_10005361 Ga0207658_100053615 278
521 3300025986 Ga0207658_10174344 Ga0207658_101743442 278
522 3300025986 Ga0207658_10190111 Ga0207658_101901112 278
523 3300026023 Ga0207677_10201962 Ga0207677_102019622 278
524 3300026023 Ga0207677_10232751 Ga0207677_102327512 278
525 3300026035 Ga0207703_10231325 Ga0207703_102313252 278
526 3300026067 Ga0207678_10006353 Ga0207678_100063533 278
527 3300026089 Ga0207648_10000119 Ga0207648_1000011941 278
528 3300026089 Ga0207648_10035260 Ga0207648_100352602 278
529 3300026089 Ga0207648_10062176 Ga0207648_100621763 278
530 3300026089 Ga0207648_10089200 Ga0207648_100892002 278
531 3300026118 Ga0207675_100032777 Ga0207675_1000327772 278
532 3300026142 Ga0207698_10182134 Ga0207698_101821342 278
533 3300028380 Ga0268265_10204733 Ga0268265_102047332 278
534 3300028381 Ga0268264_10008551 Ga0268264_100085515 278
535 3300028381 Ga0268264_10398379 Ga0268264_103983792 278
536 3300028786 Ga0307517_10081897 Ga0307517_100818972 278
537 3300031730 Ga0307516_10002973 Ga0307516_100029733 278
538 3300035691 Ga0373931_0136762 Ga0373931_0136762_172_1071 278
539 3300041410 Ga0439461_0026663 Ga0439461_0026663_291_1151 278
540 3300042006 Ga0439432_032244 Ga0439432_032244_449_1564 278
541 3300042007 Ga0439449_0036098 Ga0439449_0036098_868_1824 278
542 3300042127 Ga0450890_002360 Ga0450890_002360_1463_2323 278
543 3300042130 Ga0450892_000160 Ga0450892_000160_1191_2051 278
544 3300042144 Ga0450889_000338 Ga0450889_000338_2313_3173 278
545 3300046506 Ga0495583_0000034 Ga0495583_0000034_79484_80344 278
546 3300046507 Ga0495606_0001750 Ga0495606_0001750_18271_19131 278
547 3300046519 Ga0495632_0006988 Ga0495632_0006988_5299_6159 278
548 3300046616 Ga0495668_0114181 Ga0495668_0114181_383_1243 278
549 3300046660 Ga0495625_0022250 Ga0495625_0022250_3432_4295 278
550 3300046684 Ga0495669_0015030 Ga0495669_0015030_918_1778 278
551 3300046692 Ga0495671_0129468 Ga0495671_0129468_159_1019 278
552 3300046694 Ga0495649_0000470 Ga0495649_0000470_7458_8318 278
553 3300046694 Ga0495649_0001920 Ga0495649_0001920_2849_3712 278
554 3300046794 Ga0495589_0005062 Ga0495589_0005062_1501_2361 278
555 3300046810 Ga0495660_0053780 Ga0495660_0053780_855_1718 278
556 3300048905 Ga0496102_0065022 Ga0496102_0065022_396_1253 278
557 3300048907 Ga0496104_0109871 Ga0496104_0109871_1504_2361 278
558 3300048918 Ga0496115_0183765 Ga0496115_0183765_449_1321 278
559 3300050492 nmdc:mga0yw44_7767_c1 nmdc:mga0yw44_7767_c1_1457_2317 278
560 3300050493 nmdc:mga0k408_1652_c1 nmdc:mga0k408_1652_c1_2072_2932 278
561 3300050493 nmdc:mga0k408_3908_c1 nmdc:mga0k408_3908_c1_5515_6375 278
562 3300050493 nmdc:mga0k408_9932_c1 nmdc:mga0k408_9932_c1_3150_4010 278
563 3300050494 nmdc:mga06z11_210980_c1 nmdc:mga06z11_210980_c1_257_1117 278
564 3300050512 nmdc:mga0n895_299159_c1 nmdc:mga0n895_299159_c1_750_1616 278
565 3300005459 Ga0068867_100060005 Ga0068867_1000600052 279
566 3300046513 Ga0495616_0066528 Ga0495616_0066528_846_1721 279
567 3300046542 Ga0495597_0000157 Ga0495597_0000157_54274_55149 279
568 3300046794 Ga0495589_0000033 Ga0495589_0000033_107407_108282 279
569 3300003215 JGI25153J46596_10000620 JGI25153J46596_1000062015 280
570 3300025297 Ga0209758_1000057 Ga0209758_1000057265 280
571 3300002073 JGI24745J21846_1000195 JGI24745J21846_10001952 281
572 3300005327 Ga0070658_10007478 Ga0070658_100074788 281
573 3300005328 Ga0070676_10251039 Ga0070676_102510391 281
574 3300005329 Ga0070683_100026879 Ga0070683_1000268794 281
575 3300005334 Ga0068869_100022542 Ga0068869_1000225422 281
576 3300005337 Ga0070682_100205776 Ga0070682_1002057761 281
577 3300005343 Ga0070687_100007469 Ga0070687_1000074692 281
578 3300005344 Ga0070661_100070055 Ga0070661_1000700552 281
579 3300005347 Ga0070668_100021390 Ga0070668_1000213903 281
580 3300005354 Ga0070675_100085483 Ga0070675_1000854833 281
581 3300005356 Ga0070674_100140718 Ga0070674_1001407182 281
582 3300005367 Ga0070667_100224437 Ga0070667_1002244372 281
583 3300005367 Ga0070667_100556290 Ga0070667_1005562901 281
584 3300005441 Ga0070700_100034382 Ga0070700_1000343823 281
585 3300005456 Ga0070678_100278919 Ga0070678_1002789192 281
586 3300005457 Ga0070662_100049967 Ga0070662_1000499673 281
587 3300005466 Ga0070685_10005666 Ga0070685_100056663 281
588 3300005466 Ga0070685_10065935 Ga0070685_100659351 281
589 3300005535 Ga0070684_100113405 Ga0070684_1001134052 281
590 3300005539 Ga0068853_100453151 Ga0068853_1004531511 281
591 3300005543 Ga0070672_100251457 Ga0070672_1002514572 281
592 3300005548 Ga0070665_100051370 Ga0070665_1000513703 281
593 3300005548 Ga0070665_100306480 Ga0070665_1003064802 281
594 3300005564 Ga0070664_100029999 Ga0070664_1000299991 281
595 3300005577 Ga0068857_100088667 Ga0068857_1000886672 281
596 3300005578 Ga0068854_100005659 Ga0068854_1000056594 281
597 3300005614 Ga0068856_100070422 Ga0068856_1000704223 281
598 3300005615 Ga0070702_100307981 Ga0070702_1003079811 281
599 3300005616 Ga0068852_100011309 Ga0068852_1000113093 281
600 3300005617 Ga0068859_100320694 Ga0068859_1003206942 281
601 3300005617 Ga0068859_100529108 Ga0068859_1005291082 281
602 3300005618 Ga0068864_100192046 Ga0068864_1001920462 281
603 3300005840 Ga0068870_10136544 Ga0068870_101365442 281
604 3300005844 Ga0068862_100086701 Ga0068862_1000867013 281
605 3300006881 Ga0068865_100062333 Ga0068865_1000623331 281
606 3300006931 Ga0097620_100320697 Ga0097620_1003206972 281
607 3300006931 Ga0097620_100529058 Ga0097620_1005290582 281
608 3300009094 Ga0111539_10334450 Ga0111539_103344502 281
609 3300009098 Ga0105245_10015361 Ga0105245_100153615 281
610 3300009098 Ga0105245_10213971 Ga0105245_102139711 281
611 3300009101 Ga0105247_10183688 Ga0105247_101836882 281
612 3300009174 Ga0105241_10048073 Ga0105241_100480733 281
613 3300009545 Ga0105237_10317923 Ga0105237_103179232 281
614 3300009545 Ga0105237_10402978 Ga0105237_104029782 281
615 3300009551 Ga0105238_10539978 Ga0105238_105399782 281
616 3300010375 Ga0105239_10013330 Ga0105239_100133307 281
617 3300010375 Ga0105239_10022210 Ga0105239_100222103 281
618 3300013308 Ga0157375_10239652 Ga0157375_102396522 281
619 3300025901 Ga0207688_10020321 Ga0207688_100203212 281
620 3300025907 Ga0207645_10233992 Ga0207645_102339922 281
621 3300025908 Ga0207643_10017684 Ga0207643_100176842 281
622 3300025920 Ga0207649_10208424 Ga0207649_102084241 281
623 3300025925 Ga0207650_10221477 Ga0207650_102214771 281
624 3300025926 Ga0207659_10239654 Ga0207659_102396542 281
625 3300025927 Ga0207687_10013419 Ga0207687_100134192 281
626 3300025940 Ga0207691_10162622 Ga0207691_101626222 281
627 3300025940 Ga0207691_10256012 Ga0207691_102560121 281
628 3300025942 Ga0207689_10010022 Ga0207689_100100224 281
629 3300025945 Ga0207679_10072446 Ga0207679_100724463 281
630 3300025972 Ga0207668_10098739 Ga0207668_100987392 281
631 3300025981 Ga0207640_10019380 Ga0207640_100193803 281
632 3300025981 Ga0207640_10130551 Ga0207640_101305512 281
633 3300025986 Ga0207658_10277283 Ga0207658_102772831 281
634 3300026023 Ga0207677_10169562 Ga0207677_101695621 281
635 3300026067 Ga0207678_10002445 Ga0207678_100024454 281
636 3300026067 Ga0207678_10130265 Ga0207678_101302652 281
637 3300026075 Ga0207708_10014923 Ga0207708_100149234 281
638 3300026089 Ga0207648_10030511 Ga0207648_100305115 281
639 3300026116 Ga0207674_10009872 Ga0207674_100098725 281
640 3300026121 Ga0207683_10058641 Ga0207683_100586412 281
641 3300026121 Ga0207683_10118846 Ga0207683_101188462 281
642 3300028379 Ga0268266_10070557 Ga0268266_100705573 281
643 3300037068 Ga0373925_0037039 Ga0373925_0037039_214_1083 281
644 3300037418 Ga0395900_0657826 Ga0395900_0657826_60_926 281
645 3300046471 Ga0495650_0010085 Ga0495650_0010085_1946_2851 281
646 3300048904 Ga0496101_0197630 Ga0496101_0197630_362_1228 281
647 3300048912 Ga0496109_0158482 Ga0496109_0158482_1047_1913 281
648 3300048913 Ga0496110_0050780 Ga0496110_0050780_1371_2237 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

18

153

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
8huc-assembly1.cif.gz_A crystal structure of paich (pec1) 0.9311 23 278
8huc-assembly2.cif.gz_D crystal structure of paich (pec1) 0.9264 23 278
8huc-assembly2.cif.gz_B crystal structure of paich (pec1) 0.9173 23 278
8huc-assembly1.cif.gz_C crystal structure of paich (pec1) 0.9081 23 278
1njk-assembly1.cif.gz_D crystal structure of ybaw probable thioesterase from escherichia coli 0.8944 77 142
ID Description Score Start End Superfamily
af_A0A1D8PLR8_89_286_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9093 73 276 3.10.129.10
af_A0A1D8PLR8_89_286_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9006 73 276 3.10.129.10
af_Q0IZW8_9_172_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8939 78 145 3.10.129.10
af_Q9W439_57_173_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8817 77 142 3.10.129.10
4rltA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8803 78 145 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A520HAF0-F1-model_v4 Acyl-CoA dehydrogenase 0.99 190 278 GO:0019171
AF-A0A520HAF0-F1-model_v4 Acyl-CoA dehydrogenase 0.9791 190 278 GO:0019171
AF-A0A1Z8P3P6-F1-model_v4 Acyl-CoA dehydrogenase 0.9761 23 276 GO:0019171
AF-A0A536V716-F1-model_v4 Acyl-CoA dehydrogenase 0.9754 45 278 GO:0019171
AF-A0A1V6F2K3-F1-model_v4 Uncharacterized protein 0.9753 159 278 GO:0019171

Feature Viewer

pLDDT pTM Quality
87.12 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map