F472344

General Info

Members Datasets Scaffolds Average Seq Length
648 327 571 250

Family's Representative Sequence

Representative Sequence 3300003791|Ga0055530_10000110|Ga0055530_1000011015
Length 301
Sequence MCVDSHSIHLSFSFNERDLHLLHASNKASLQKCSGLPRGIDPSSSIHETEHTMNKQLEGKIALVTGGSSGIGLGAAKELAAQGARVFITGRRQQELDAAVAQIGSSATALRADASVLSDLDAVYAHIAKTAGRLDILFANAGGGDMMPLGAITEEHFDRIFGTNVRGVLFTVQKALPLLSNGASVILTSSTTSIQGTASFSVYSASKAAVRNFARSWALDLKDRGIRVNAVSPGPIRTPGLGDLVPEXARQGLFDHLASQVPLGRLGEPGEIGKAVAFLASDAASFVNGIELFVDGGMAQV

Samples

Sample ID Description Type Environment
1 2511231010 Pseudomonas sp. GM25 Isolate Nodule
2 2511231018 Pseudomonas sp. GM60 Isolate Nodule
3 2511231019 Pseudomonas sp. GM67 Isolate Nodule
4 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
5 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
6 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
7 2547132181 Kosakonia sacchari SP1 Isolate Stem
8 2561511199 Enterobacter sp. R4-368 Isolate Nodule
9 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
10 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
11 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
12 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
13 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
14 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
15 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
16 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
17 2643221569 Achromobacter sp. Root565 Isolate Unclassified
18 2643221594 Achromobacter sp. Root170 Isolate Unclassified
19 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
20 2738541297 Duganella sp. GV083 Isolate Unclassified
21 2738541357 Duganella sp. GV053 Isolate Unclassified
22 2738543003 Duganella sp. GV066 Isolate Unclassified
23 2738543013 Variovorax sp. BT01 Isolate Unclassified
24 2738543026 Duganella sp. GV089 Isolate Unclassified
25 2738543029 Duganella sp. GV039 Isolate Unclassified
26 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
27 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
28 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
29 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
30 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
31 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
32 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
33 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
34 2818991446 Variovorax sp. 1180 Isolate Unclassified
35 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
36 2821131069 Duganella sp. 1224 Isolate Unclassified
37 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
38 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
39 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
40 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
41 2855730933 Achromobacter sp. HZ28 Isolate Nodule
42 2855767633 Achromobacter sp. HZ34 Isolate Nodule
43 2857553236 Duganella sp. R-74557 Isolate Unclassified
44 2857564685 Duganella sp. R-74599 Isolate Unclassified
45 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
46 2865014394 Pantoea sp. R-71966 Isolate Unclassified
47 2876601092 Pantoea endophytica 596 Isolate Unclassified
48 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
49 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
50 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
51 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
52 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
53 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
54 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
55 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
56 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
57 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
58 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
59 2928037797 Variovorax sp. 1126 Isolate Unclassified
60 2928044640 Variovorax sp. 1128 Isolate Unclassified
61 2928051484 Variovorax sp. 1133 Isolate Unclassified
62 2928058823 Ralstonia sp. 1138 Isolate Unclassified
63 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
64 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
65 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
66 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
67 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
68 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
69 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
70 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
71 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
72 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
73 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
74 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
75 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
76 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
77 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
78 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
79 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
80 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
81 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
82 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
83 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
84 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
85 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
86 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
87 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
88 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
89 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
90 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
91 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
92 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
93 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
94 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
95 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
96 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
97 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
98 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
99 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
100 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
101 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
102 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
103 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
104 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
105 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
106 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
107 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
108 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
109 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
110 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
111 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
112 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
113 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
114 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
115 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
116 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
117 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
118 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
119 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
120 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
121 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
122 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
123 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
124 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
125 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
126 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
127 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
128 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
129 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
130 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
131 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
132 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
133 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
136 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
137 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
138 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
139 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
140 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
141 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
142 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
143 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
144 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
145 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
148 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
149 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
150 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
152 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
153 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
154 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
156 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
163 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
164 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
166 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
167 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
168 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
171 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
172 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
173 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
177 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
180 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
182 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
185 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
207 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
212 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
215 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
216 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
217 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
218 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
219 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
220 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
221 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
222 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
223 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
224 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
225 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
226 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
227 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
228 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
229 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
230 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
231 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
232 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
233 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
234 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
235 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
236 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
237 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
238 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
239 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
240 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
241 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
242 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
243 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
244 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
245 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
246 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
247 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
248 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
249 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
250 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
251 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
252 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
253 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
254 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
255 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
256 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
257 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
260 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
261 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
262 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
263 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
264 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
265 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
266 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
267 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
268 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
269 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
270 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
271 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
272 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
273 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
274 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
275 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
276 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
277 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
278 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
279 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
280 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
283 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
284 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
285 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
286 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
287 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
288 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
289 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
290 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
291 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
292 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
293 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
294 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
297 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
298 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
301 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
302 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
303 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
304 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
305 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
306 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
307 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
308 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
309 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
310 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
311 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
312 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
313 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
314 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
315 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
316 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
319 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
320 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
321 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
322 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
323 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
324 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
325 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
326 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
327 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.96
Metatranscriptomes 0.15
Isolates 11.88

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 26.08
Nodule 1.85
Rhizoplane 2.78
Rhizosphere 48.61
Stem 0.15
Stem Tuber 0
Unclassified 20.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000149 3300001915 Bacteria 19701
2 JGI24740J21852_10000253 3300001979 Bacteria 22704
3 JGI25155J39150_1000366 3300002704 Bacteria 13753
4 JGI25155J39150_1000384 3300002704 Bacteria 12710
5 JGI25156J39149_1000649 3300002705 Bacteria 19021
6 JGI25156J39149_1003944 3300002705 Bacteria 4691
7 JGI25156J39149_1007255 3300002705 Bacteria 2936
8 JGI25162J39368_1000045 3300002737 Bacteria 170731
9 JGI25154J39366_1000534 3300002738 Bacteria 19006
10 JGI25157J39369_1000665 3300002741 Bacteria 19017
11 JGI25163J39215_1000153 3300002771 Bacteria 27306
12 JGI25164J39214_1000068 3300002772 Bacteria 103192
13 JGI25152J39213_1000033 3300002773 Bacteria 95187
14 JGI25152J39213_1000059 3300002773 Bacteria 73065
15 JGI25152J39213_1001371 3300002773 Bacteria 10596
16 JGI25152J39213_1008458 3300002773 Bacteria 2552
17 JGI25150J39212_1000310 3300002774 Bacteria 24161
18 JGI25150J39212_1004214 3300002774 Bacteria 3234
19 JGI25151J46595_10000125 3300003187 Bacteria 103269
20 JGI25151J46595_10000142 3300003187 Bacteria 95187
21 JGI25165J46597_1000086 3300003214 Bacteria 170731
22 JGI25153J46596_10000107 3300003215 Bacteria 95187
23 JGI25153J46596_10011490 3300003215 Bacteria 3907
24 rootL2_10195311 3300003322 Bacteria 2574
25 Ga0055538_1000053 3300003751 Bacteria 127408
26 Ga0055538_1002465 3300003751 Bacteria 2700
27 Ga0055538_1005827 3300003751 Bacteria 1242
28 Ga0055539_1000073 3300003752 Bacteria 131094
29 Ga0055539_1000078 3300003752 Bacteria 127408
30 Ga0055533_1000084 3300003756 Bacteria 127408
31 Ga0055533_1002943 3300003756 Bacteria 3656
32 Ga0055532_1000090 3300003758 Bacteria 104391
33 Ga0055532_1000453 3300003758 Bacteria 19021
34 Ga0055525_1000112 3300003759 Bacteria 127408
35 Ga0055525_1000387 3300003759 Bacteria 28280
36 Ga0055535_1000085 3300003761 Bacteria 104391
37 Ga0055535_1000266 3300003761 Bacteria 54809
38 Ga0055542_1000028 3300003762 Bacteria 251458
39 Ga0055529_1000076 3300003763 Bacteria 156104
40 Ga0055529_1000134 3300003763 Bacteria 104391
41 Ga0055526_1000001 3300003771 Bacteria 669703
42 Ga0055526_1000930 3300003771 Bacteria 21722
43 Ga0055537_1000017 3300003773 Bacteria 123856
44 Ga0055537_1000601 3300003773 Bacteria 19992
45 Ga0055537_1011205 3300003773 Bacteria 1837
46 Ga0055524_1010020 3300003775 Bacteria 3807
47 Ga0055536_1000013 3300003781 Bacteria 240693
48 Ga0055536_1001445 3300003781 Bacteria 14319
49 Ga0055536_1007380 3300003781 Bacteria 4934
50 Ga0055536_1016734 3300003781 Bacteria 2437
51 Ga0055534_1000422 3300003784 Bacteria 25397
52 Ga0055534_1000517 3300003784 Bacteria 20813
53 Ga0055528_1000182 3300003790 Bacteria 53454
54 Ga0055528_1002641 3300003790 Bacteria 9469
55 Ga0055530_10000110 3300003791 Bacteria 71015
56 Ga0055530_10000682 3300003791 Bacteria 28781
57 Ga0055530_10002989 3300003791 Bacteria 10158
58 Ga0055540_1000008 3300003792 Bacteria 309635
59 Ga0055531_10000182 3300003794 Bacteria 70786
60 Ga0055531_10002778 3300003794 Bacteria 11489
61 Ga0055531_10005527 3300003794 Bacteria 7381
62 Ga0055541_1000055 3300003841 Bacteria 127408
63 Ga0055541_1004043 3300003841 Bacteria 2700
64 Ga0055541_1015050 3300003841 Bacteria 1039
65 Ga0058692_1000046 3300003856 Bacteria 114274
66 Ga0058692_1009516 3300003856 Bacteria 2444
67 Ga0058692_1009557 3300003856 Bacteria 2435
68 Ga0055543_1000251 3300004625 Bacteria 40699
69 Ga0065165_1031028 3300005262 Bacteria 1694
70 Ga0070661_100000141 3300005344 Bacteria 58825
71 Ga0070669_100038466 3300005353 Bacteria 3474
72 Ga0070674_100054535 3300005356 Unclassified 2765
73 Ga0070663_100000034 3300005455 Bacteria 68516
74 Ga0070699_100070997 3300005518 Bacteria 3028
75 Ga0068853_100482060 3300005539 Bacteria 1169
76 Ga0070665_100019693 3300005548 Bacteria 6774
77 Ga0068855_100002732 3300005563 Bacteria 21749
78 Ga0070664_100000057 3300005564 Bacteria 68516
79 Ga0068857_100202125 3300005577 Bacteria 1811
80 Ga0068857_100294877 3300005577 Bacteria 1494
81 Ga0068857_100688019 3300005577 Bacteria 971
82 Ga0068854_100000299 3300005578 Bacteria 32817
83 Ga0068854_100001474 3300005578 Bacteria 14252
84 Ga0068856_100004528 3300005614 Bacteria 13821
85 Ga0068852_100006625 3300005616 Bacteria 8392
86 Ga0070717_10714426 3300006028 Bacteria 911
87 Ga0075368_10051601 3300006042 Bacteria 1635
88 Ga0075364_10038380 3300006051 Bacteria 3103
89 Ga0075364_10196136 3300006051 Bacteria 1368
90 Ga0075367_10039648 3300006178 Bacteria 2747
91 Ga0075370_10007730 3300006353 Bacteria 5489
92 Ga0075370_10098827 3300006353 Bacteria 1688
93 Ga0079104_1000588 3300006946 Bacteria 36329
94 Ga0079104_1006426 3300006946 Bacteria 4448
95 Ga0099795_10001072 3300007788 Bacteria 5655
96 Ga0105251_10002126 3300009011 Bacteria 15924
97 Ga0105251_10111070 3300009011 Bacteria 1249
98 Ga0105244_10001727 3300009036 Bacteria 17208
99 Ga0105244_10002986 3300009036 Bacteria 12429
100 Ga0105244_10008796 3300009036 Bacteria 6271
101 Ga0105244_10014434 3300009036 Bacteria 4567
102 Ga0105244_10022260 3300009036 Bacteria 3490
103 Ga0105244_10035782 3300009036 Bacteria 2606
104 Ga0105244_10082403 3300009036 Bacteria 1591
105 Ga0105250_10007044 3300009092 Bacteria 4855
106 Ga0105250_10037889 3300009092 Bacteria 1935
107 Ga0105240_10005332 3300009093 Bacteria 19184
108 Ga0105240_10009982 3300009093 Bacteria 13382
109 Ga0105240_10043342 3300009093 Bacteria 5726
110 Ga0105240_10089465 3300009093 Bacteria 3765
111 Ga0111539_10506466 3300009094 Bacteria 1406
112 Ga0114129_10003070 3300009147 Bacteria 23421
113 Ga0105243_10000060 3300009148 Bacteria 128124
114 Ga0105248_10001874 3300009177 Bacteria 23324
115 Ga0105237_10002344 3300009545 Bacteria 23534
116 Ga0105237_10017153 3300009545 Bacteria 7511
117 Ga0105237_10153147 3300009545 Bacteria 2302
118 Ga0105238_10074582 3300009551 Bacteria 3385
119 Ga0105238_10483004 3300009551 Bacteria 1238
120 Ga0105249_10052161 3300009553 Bacteria 3734
121 Ga0099796_10003487 3300010159 Bacteria 3660
122 Ga0105246_10001928 3300011119 Bacteria 12508
123 Ga0105246_10002304 3300011119 Bacteria 11522
124 Ga0105246_10008064 3300011119 Bacteria 6467
125 Ga0105246_10260262 3300011119 Bacteria 1382
126 Ga0157373_10000689 3300013100 Bacteria 26549
127 Ga0157373_10011967 3300013100 Bacteria 6375
128 Ga0157373_10061280 3300013100 Bacteria 2665
129 Ga0157373_10085992 3300013100 Bacteria 2216
130 Ga0157371_10000323 3300013102 Bacteria 61980
131 Ga0157371_10000882 3300013102 Bacteria 33809
132 Ga0157371_10001987 3300013102 Bacteria 20249
133 Ga0157371_10020930 3300013102 Bacteria 4809
134 Ga0157370_10000038 3300013104 Bacteria 135182
135 Ga0157370_10060812 3300013104 Bacteria 3585
136 Ga0157370_10162226 3300013104 Bacteria 2079
137 Ga0157370_10257696 3300013104 Bacteria 1612
138 Ga0157369_10116072 3300013105 Bacteria 2843
139 Ga0157369_10130059 3300013105 Bacteria 2668
140 Ga0157369_10398218 3300013105 Bacteria 1428
141 Ga0157372_10000776 3300013307 Bacteria 34547
142 Ga0157372_10012224 3300013307 Bacteria 9141
143 Ga0157372_10043233 3300013307 Bacteria 4987
144 Ga0182008_10021417 3300014497 Bacteria 3318
145 Ga0182006_1002101 3300015261 Bacteria 11139
146 Ga0182006_1002886 3300015261 Bacteria 9137
147 Ga0182006_1006256 3300015261 Bacteria 5548
148 Ga0182006_1024252 3300015261 Bacteria 2503
149 Ga0182006_1033655 3300015261 Bacteria 2054
150 Ga0182005_1003975 3300015265 Bacteria 4874
151 Ga0182005_1009668 3300015265 Bacteria 2798
152 Ga0182005_1022471 3300015265 Bacteria 1728
153 Ga0154015_1552384 3300020610 Bacteria 22900
154 Ga0213872_10001382 3300021361 Bacteria 15963
155 Ga0213872_10004287 3300021361 Bacteria 7632
156 Ga0213872_10005115 3300021361 Bacteria 6805
157 Ga0213871_10016347 3300021441 Bacteria 1787
158 Ga0209435_100080 3300025206 Bacteria 49104
159 Ga0209760_100019 3300025207 Bacteria 170806
160 Ga0209436_107749 3300025208 Bacteria 2207
161 Ga0209784_100006 3300025224 Bacteria 930704
162 Ga0209784_100035 3300025224 Bacteria 299760
163 Ga0209784_102348 3300025224 Bacteria 1956
164 Ga0209566_100002 3300025225 Bacteria 2614868
165 Ga0209566_100040 3300025225 Bacteria 299760
166 Ga0209566_102892 3300025225 Bacteria 2899
167 Ga0209674_100057 3300025226 Bacteria 299760
168 Ga0209674_100097 3300025226 Bacteria 167285
169 Ga0209674_103486 3300025226 Bacteria 2874
170 Ga0209672_100208 3300025228 Bacteria 46403
171 Ga0209672_100619 3300025228 Bacteria 18460
172 Ga0209672_106111 3300025228 Bacteria 1991
173 Ga0209147_100004 3300025229 Bacteria 1371850
174 Ga0209147_100018 3300025229 Bacteria 515719
175 Ga0209147_101308 3300025229 Bacteria 9589
176 Ga0209563_100041 3300025230 Bacteria 407467
177 Ga0209563_100059 3300025230 Bacteria 299760
178 Ga0207427_100011 3300025231 Bacteria 640076
179 Ga0207427_100362 3300025231 Bacteria 28247
180 Ga0209437_100044 3300025233 Bacteria 430619
181 Ga0209437_100117 3300025233 Bacteria 209271
182 Ga0209258_100028 3300025242 Bacteria 515719
183 Ga0209258_100067 3300025242 Bacteria 287603
184 Ga0209258_100788 3300025242 Bacteria 19070
185 Ga0207425_1000042 3300025245 Bacteria 210165
186 Ga0207425_1000064 3300025245 Bacteria 129075
187 Ga0207425_1000437 3300025245 Bacteria 27474
188 Ga0207425_1000791 3300025245 Bacteria 16149
189 Ga0209646_1000481 3300025246 Bacteria 19783
190 Ga0209026_1000729 3300025250 Bacteria 19150
191 Ga0209677_100007 3300025253 Bacteria 1021332
192 Ga0209677_100036 3300025253 Bacteria 299760
193 Ga0209148_1000067 3300025254 Bacteria 338678
194 Ga0209759_1000440 3300025256 Bacteria 48778
195 Ga0209759_1000665 3300025256 Bacteria 31894
196 Ga0209759_1005157 3300025256 Bacteria 4656
197 Ga0209129_1000041 3300025258 Bacteria 307590
198 Ga0209129_1000058 3300025258 Bacteria 252258
199 Ga0209129_1000101 3300025258 Bacteria 161931
200 Ga0209129_1002473 3300025258 Bacteria 9029
201 Ga0209233_1000057 3300025261 Bacteria 430619
202 Ga0209565_1000027 3300025263 Bacteria 360545
203 Ga0209565_1000031 3300025263 Bacteria 320341
204 Ga0209565_1003184 3300025263 Bacteria 5444
205 Ga0209455_1000073 3300025272 Bacteria 291417
206 Ga0209455_1000107 3300025272 Bacteria 195136
207 Ga0209455_1001217 3300025272 Bacteria 12269
208 Ga0209455_1011945 3300025272 Bacteria 2106
209 Ga0209673_1000031 3300025273 Bacteria 347560
210 Ga0209673_1000164 3300025273 Bacteria 138082
211 Ga0209673_1000814 3300025273 Bacteria 41220
212 Ga0209673_1041467 3300025273 Bacteria 1306
213 Ga0209130_1000025 3300025284 Bacteria 336491
214 Ga0209130_1000468 3300025284 Bacteria 41796
215 Ga0209130_1020413 3300025284 Bacteria 1516
216 Ga0209675_1000015 3300025291 Bacteria 403517
217 Ga0209675_1000064 3300025291 Bacteria 177063
218 Ga0209675_1007717 3300025291 Bacteria 4071
219 Ga0209675_1009594 3300025291 Bacteria 3400
220 Ga0209675_1010742 3300025291 Bacteria 3098
221 Ga0209676_1000002 3300025292 Bacteria 1732948
222 Ga0209676_1000125 3300025292 Bacteria 191565
223 Ga0209676_1002297 3300025292 Bacteria 13928
224 Ga0209676_1007184 3300025292 Bacteria 5310
225 Ga0209676_1028656 3300025292 Bacteria 1730
226 Ga0209676_1043034 3300025292 Bacteria 1249
227 Ga0209025_1000048 3300025294 Bacteria 335574
228 Ga0209025_1000057 3300025294 Bacteria 314601
229 Ga0209025_1000075 3300025294 Bacteria 275717
230 Ga0209025_1021207 3300025294 Bacteria 3511
231 Ga0209025_1035103 3300025294 Bacteria 2272
232 Ga0209564_1000002 3300025295 Bacteria 1636803
233 Ga0209564_1000029 3300025295 Bacteria 505995
234 Ga0209564_1000037 3300025295 Bacteria 414794
235 Ga0209564_1000040 3300025295 Bacteria 411388
236 Ga0209564_1000833 3300025295 Bacteria 41796
237 Ga0209758_1000043 3300025297 Bacteria 402310
238 Ga0209758_1000050 3300025297 Bacteria 345008
239 Ga0209758_1000056 3300025297 Bacteria 335574
240 Ga0209758_1029810 3300025297 Bacteria 2272
241 Ga0209050_1000006 3300025298 Bacteria 1359702
242 Ga0209050_1000012 3300025298 Bacteria 813717
243 Ga0209050_1000417 3300025298 Bacteria 78631
244 Ga0209050_1001644 3300025298 Bacteria 22822
245 Ga0209050_1018450 3300025298 Bacteria 2710
246 Ga0209256_1000023 3300025299 Bacteria 461150
247 Ga0209256_1000764 3300025299 Bacteria 41796
248 Ga0209256_1000795 3300025299 Bacteria 40491
249 Ga0209256_1015339 3300025299 Bacteria 2687
250 Ga0207426_1000118 3300025302 Bacteria 223341
251 Ga0207426_1000667 3300025302 Bacteria 41796
252 Ga0209051_1000001 3300025303 Bacteria 1732974
253 Ga0209051_1000332 3300025303 Bacteria 71041
254 Ga0209051_1000596 3300025303 Bacteria 42653
255 Ga0209051_1042992 3300025303 Bacteria 1590
256 Ga0209257_1000029 3300025304 Bacteria 695617
257 Ga0209257_1001127 3300025304 Bacteria 34354
258 Ga0209257_1002697 3300025304 Bacteria 16951
259 Ga0209257_1005074 3300025304 Bacteria 9559
260 Ga0209257_1017550 3300025304 Bacteria 2810
261 Ga0207656_10007589 3300025321 Bacteria 3959
262 Ga0207696_1000113 3300025711 Bacteria 151878
263 Ga0207696_1004605 3300025711 Bacteria 5907
264 Ga0207696_1007987 3300025711 Bacteria 4089
265 Ga0207696_1018885 3300025711 Bacteria 2255
266 Ga0207655_1000076 3300025728 Bacteria 226359
267 Ga0207655_1003284 3300025728 Bacteria 12138
268 Ga0207655_1007697 3300025728 Bacteria 6952
269 Ga0207713_1000001 3300025735 Bacteria 2295391
270 Ga0207713_1000271 3300025735 Bacteria 63332
271 Ga0207713_1000924 3300025735 Bacteria 26352
272 Ga0207713_1068798 3300025735 Bacteria 1314
273 Ga0207684_10065791 3300025910 Bacteria 3078
274 Ga0207695_10002492 3300025913 Bacteria 27113
275 Ga0207695_10004475 3300025913 Bacteria 19039
276 Ga0207695_10047597 3300025913 Bacteria 4536
277 Ga0207695_10091178 3300025913 Bacteria 3062
278 Ga0207671_10019159 3300025914 Bacteria 5238
279 Ga0207671_10109259 3300025914 Bacteria 2102
280 Ga0207649_10000111 3300025920 Bacteria 68568
281 Ga0207681_10025465 3300025923 Bacteria 3806
282 Ga0207644_10307320 3300025931 Bacteria 1279
283 Ga0207709_10000004 3300025935 Bacteria 825156
284 Ga0207679_10000105 3300025945 Bacteria 68561
285 Ga0207667_10004150 3300025949 Bacteria 17803
286 Ga0207712_10026115 3300025961 Bacteria 3888
287 Ga0207640_10000154 3300025981 Bacteria 49637
288 Ga0207640_10020925 3300025981 Bacteria 3890
289 Ga0207678_10000106 3300026067 Bacteria 68474
290 Ga0207702_10000135 3300026078 Bacteria 88092
291 Ga0207702_10144947 3300026078 Bacteria 2154
292 Ga0207674_10002847 3300026116 Bacteria 21514
293 Ga0207674_10318865 3300026116 Bacteria 1504
294 Ga0207674_10322449 3300026116 Bacteria 1494
295 Ga0207698_10119118 3300026142 Bacteria 2230
296 Ga0209281_1000564 3300027111 Bacteria 44570
297 Ga0209371_1000017 3300027312 Bacteria 625776
298 Ga0209371_1000033 3300027312 Bacteria 381084
299 Ga0209371_1002427 3300027312 Bacteria 10455
300 Ga0209371_1010357 3300027312 Bacteria 2878
301 Ga0209179_1023666 3300027512 Bacteria 1214
302 Ga0209813_10028227 3300027866 Bacteria 1635
303 Ga0268266_10001489 3300028379 Bacteria 27751
304 Ga0268266_10123553 3300028379 Bacteria 2306
305 Ga0268256_1000036 3300030500 Bacteria 370250
306 Ga0268256_1006645 3300030500 Bacteria 4261
307 Ga0268256_1011111 3300030500 Bacteria 2876
308 Ga0268256_1013853 3300030500 Bacteria 2419
309 Ga0307513_10103746 3300031456 Bacteria 2859
310 Ga0395900_0012297 3300037418 Bacteria 8755
311 Ga0395900_0094227 3300037418 Bacteria 3076
312 Ga0237819_00713 3300038705 Bacteria 10756
313 Ga0237819_01208 3300038705 Bacteria 7212
314 Ga0436360_0610154 3300039438 Bacteria 2550
315 Ga0436361_0180056 3300039447 Bacteria 930
316 Ga0436361_0259685 3300039447 Bacteria 2299
317 Ga0436361_0714089 3300039447 Bacteria 2834
318 Ga0436361_0936593 3300039447 Bacteria 36363
319 Ga0436361_0980770 3300039447 Bacteria 824
320 Ga0436361_1144899 3300039447 Bacteria 8838
321 Ga0436361_1163602 3300039447 Bacteria 7734
322 Ga0439438_014315 3300041405 Bacteria 2364
323 Ga0439447_007104 3300041407 Bacteria 3582
324 Ga0439466_0000009 3300041411 Bacteria 232657
325 Ga0451839_1439921 3300041496 Bacteria 3779
326 Ga0451841_0211792 3300041498 Bacteria 2656
327 Ga0451849_0573323 3300041505 Bacteria 2498
328 Ga0451853_1146243 3300041512 Bacteria 11705
329 Ga0439445_0077978 3300042004 Bacteria 923
330 Ga0439432_004444 3300042006 Bacteria 5122
331 Ga0439432_004975 3300042006 Bacteria 4811
332 Ga0439463_003955 3300042016 Bacteria 3732
333 Ga0450911_000082 3300042115 Bacteria 38325
334 Ga0439464_0023762 3300042439 Bacteria 1693
335 Ga0466986_0000407 3300044650 Bacteria 13848
336 Ga0453684_0000006 3300044712 Bacteria 1364191
337 Ga0466958_0002373 3300045836 Bacteria 9421
338 Ga0466967_0385598 3300045976 Bacteria 1361
339 Ga0495617_000053 3300046452 Bacteria 103718
340 Ga0495617_006511 3300046452 Bacteria 4090
341 Ga0495627_000004 3300046453 Bacteria 640612
342 Ga0495627_010610 3300046453 Bacteria 3340
343 Ga0495627_022012 3300046453 Bacteria 2102
344 Ga0495627_065050 3300046453 Bacteria 1072
345 Ga0495590_0000034 3300046457 Bacteria 129910
346 Ga0495591_000006 3300046458 Bacteria 390570
347 Ga0495591_000009 3300046458 Bacteria 331626
348 Ga0495591_012718 3300046458 Bacteria 3116
349 Ga0495591_033388 3300046458 Bacteria 1523
350 Ga0495638_0000072 3300046460 Bacteria 164926
351 Ga0495638_0016221 3300046460 Bacteria 4993
352 Ga0495638_0019996 3300046460 Bacteria 4426
353 Ga0495653_0000007 3300046463 Bacteria 314281
354 Ga0495653_0139138 3300046463 Bacteria 1709
355 Ga0495650_0000026 3300046471 Bacteria 476029
356 Ga0495650_0000246 3300046471 Bacteria 107109
357 Ga0495650_0000391 3300046471 Bacteria 74982
358 Ga0495650_0001279 3300046471 Bacteria 25850
359 Ga0495650_0004850 3300046471 Bacteria 9000
360 Ga0495605_0000008 3300046474 Bacteria 334602
361 Ga0495605_0000075 3300046474 Bacteria 128702
362 Ga0495605_0010856 3300046474 Bacteria 5087
363 Ga0495584_0006363 3300046491 Bacteria 6186
364 Ga0495585_0066691 3300046492 Bacteria 1970
365 Ga0495594_0001939 3300046499 Bacteria 10788
366 Ga0495596_0006771 3300046500 Bacteria 5235
367 Ga0495607_0005220 3300046501 Bacteria 9348
368 Ga0495607_0149807 3300046501 Bacteria 1195
369 Ga0495583_0000039 3300046506 Bacteria 241501
370 Ga0495583_0000148 3300046506 Bacteria 118749
371 Ga0495583_0000395 3300046506 Bacteria 66345
372 Ga0495606_0000135 3300046507 Bacteria 125830
373 Ga0495606_0001515 3300046507 Bacteria 30806
374 Ga0495606_0195269 3300046507 Bacteria 1157
375 Ga0495610_0000004 3300046512 Bacteria 1006135
376 Ga0495610_0000840 3300046512 Bacteria 28602
377 Ga0495610_0001860 3300046512 Bacteria 18288
378 Ga0495620_0000068 3300046515 Bacteria 86731
379 Ga0495630_0249655 3300046517 Bacteria 1355
380 Ga0495631_0001754 3300046518 Bacteria 12875
381 Ga0495632_0004527 3300046519 Bacteria 9425
382 Ga0495632_0040525 3300046519 Bacteria 2345
383 Ga0495637_0000049 3300046520 Bacteria 103081
384 Ga0495637_0019574 3300046520 Bacteria 3127
385 Ga0495643_0000135 3300046522 Bacteria 118587
386 Ga0495643_0154823 3300046522 Bacteria 1132
387 Ga0495648_0000037 3300046524 Bacteria 195401
388 Ga0495648_0000210 3300046524 Bacteria 68176
389 Ga0495648_0001734 3300046524 Bacteria 21077
390 Ga0495648_0001872 3300046524 Bacteria 20124
391 Ga0495648_0002256 3300046524 Bacteria 18028
392 Ga0495648_0004793 3300046524 Bacteria 11436
393 Ga0495648_0007703 3300046524 Bacteria 8586
394 Ga0495648_0012466 3300046524 Bacteria 6340
395 Ga0495648_0024592 3300046524 Bacteria 4097
396 Ga0495666_0061222 3300046526 Bacteria 1798
397 Ga0495642_0001233 3300046528 Bacteria 11738
398 Ga0495652_0005379 3300046529 Bacteria 12070
399 Ga0495654_0000005 3300046530 Bacteria 491381
400 Ga0495654_0000013 3300046530 Bacteria 327576
401 Ga0495654_0003143 3300046530 Bacteria 10241
402 Ga0495654_0027856 3300046530 Bacteria 2891
403 Ga0495587_0015865 3300046536 Bacteria 4693
404 Ga0495609_0000855 3300046538 Bacteria 22466
405 Ga0495609_0039486 3300046538 Bacteria 2124
406 Ga0495597_0000165 3300046542 Bacteria 58587
407 Ga0495597_0001792 3300046542 Bacteria 14747
408 Ga0495597_0006150 3300046542 Bacteria 6242
409 Ga0495645_0014201 3300046543 Bacteria 5647
410 Ga0495622_0000002 3300046557 Bacteria 321742
411 Ga0495622_0000040 3300046557 Bacteria 118542
412 Ga0495633_0000011 3300046558 Bacteria 268237
413 Ga0495633_0000121 3300046558 Bacteria 105197
414 Ga0495668_0001411 3300046616 Bacteria 23404
415 Ga0495668_0002685 3300046616 Bacteria 14275
416 Ga0495634_0002102 3300046642 Bacteria 16821
417 Ga0495611_0004572 3300046648 Bacteria 5958
418 Ga0495611_0038933 3300046648 Bacteria 2116
419 Ga0495625_0000023 3300046660 Bacteria 274067
420 Ga0495625_0000648 3300046660 Bacteria 50041
421 Ga0495625_0002351 3300046660 Bacteria 20624
422 Ga0495625_0068749 3300046660 Bacteria 2489
423 Ga0495635_0005123 3300046663 Bacteria 9117
424 Ga0495661_0000493 3300046665 Bacteria 41154
425 Ga0495661_0088141 3300046665 Bacteria 1772
426 Ga0495623_0004943 3300046679 Bacteria 8742
427 Ga0495646_0011497 3300046680 Bacteria 5619
428 Ga0495613_0087299 3300046689 Bacteria 2261
429 Ga0495670_0136315 3300046691 Bacteria 1281
430 Ga0495671_0000024 3300046692 Bacteria 246812
431 Ga0495671_0000130 3300046692 Bacteria 67815
432 Ga0495671_0024907 3300046692 Bacteria 3113
433 Ga0495671_0031410 3300046692 Bacteria 2715
434 Ga0495671_0055188 3300046692 Bacteria 1968
435 Ga0495649_0002130 3300046694 Bacteria 14169
436 Ga0495589_0002111 3300046794 Bacteria 11222
437 Ga0495589_0183398 3300046794 Bacteria 992
438 Ga0495660_0000486 3300046810 Bacteria 33132
439 Ga0495660_0000751 3300046810 Bacteria 24460
440 Ga0495660_0000910 3300046810 Bacteria 21821
441 Ga0495660_0001700 3300046810 Bacteria 14728
442 Ga0495660_0014282 3300046810 Bacteria 4599
443 Ga0495604_0011485 3300047317 Bacteria 7033
444 Ga0495674_0017071 3300047319 Bacteria 6761
445 Ga0495672_0000053 3300047320 Bacteria 233823
446 Ga0495672_0003564 3300047320 Bacteria 13245
447 Ga0495680_0028024 3300047322 Bacteria 4621
448 Ga0495683_0000425 3300047323 Bacteria 33780
449 Ga0495683_0009012 3300047323 Bacteria 5320
450 Ga0495687_000136 3300047443 Bacteria 113298
451 Ga0495675_0046321 3300047444 Bacteria 2768
452 Ga0495679_000043 3300047446 Bacteria 142160
453 Ga0495679_000145 3300047446 Bacteria 64494
454 Ga0495679_024959 3300047446 Bacteria 2005
455 Ga0495679_035601 3300047446 Bacteria 1576
456 Ga0495673_0000033 3300047469 Bacteria 354152
457 Ga0495673_0000109 3300047469 Bacteria 166877
458 Ga0495673_0000219 3300047469 Bacteria 84634
459 Ga0495673_0000298 3300047469 Bacteria 66410
460 Ga0495673_0001487 3300047469 Bacteria 18540
461 Ga0495673_0003597 3300047469 Bacteria 10165
462 Ga0495673_0007804 3300047469 Bacteria 6094
463 Ga0495673_0029627 3300047469 Bacteria 2581
464 Ga0495681_0001359 3300047470 Bacteria 18478
465 Ga0495681_0003343 3300047470 Bacteria 11158
466 Ga0495681_0003557 3300047470 Bacteria 10844
467 Ga0495686_0000043 3300047472 Bacteria 291565
468 Ga0495686_0005039 3300047472 Bacteria 10601
469 Ga0495686_0060138 3300047472 Bacteria 2362
470 Ga0495593_0067577 3300047673 Bacteria 1860
471 Ga0495593_0106200 3300047673 Bacteria 1436
472 Ga0495602_0137827 3300048088 Bacteria 1936
473 Ga0496100_0029456 3300048903 Bacteria 3396
474 Ga0496101_0000006 3300048904 Bacteria 329135
475 Ga0496101_0002329 3300048904 Bacteria 11634
476 Ga0496102_0000823 3300048905 Bacteria 30109
477 Ga0496102_0600762 3300048905 Bacteria 1023
478 Ga0496103_0005342 3300048906 Bacteria 7699
479 Ga0496105_0001631 3300048908 Bacteria 15959
480 Ga0496105_0177779 3300048908 Bacteria 1743
481 Ga0496110_0048536 3300048913 Bacteria 3722
482 Ga0496110_0347893 3300048913 Bacteria 1350
483 Ga0496110_0550924 3300048913 Bacteria 1048
484 Ga0496112_0081736 3300048915 Bacteria 3195
485 Ga0496113_0063092 3300048916 Bacteria 2800
486 Ga0496116_0001037 3300048919 Bacteria 33961
487 Ga0496116_0003129 3300048919 Bacteria 16611
488 Ga0496116_0017100 3300048919 Bacteria 5647
489 Ga0496116_0025454 3300048919 Bacteria 4349
490 Ga0496116_0030789 3300048919 Bacteria 3851
491 Ga0496116_0179133 3300048919 Bacteria 1137
492 Ga0496117_0000268 3300048920 Bacteria 98537
493 Ga0496117_0004107 3300048920 Bacteria 16315
494 Ga0496117_0022174 3300048920 Bacteria 5099
495 Ga0496117_0045298 3300048920 Bacteria 3179
496 Ga0496117_0055041 3300048920 Bacteria 2783
497 Ga0496117_0077259 3300048920 Bacteria 2204
498 Ga0496117_0092523 3300048920 Bacteria 1942
499 Ga0496117_0253478 3300048920 Bacteria 958
500 Ga0496118_0000470 3300048921 Bacteria 67037
501 Ga0496118_0002894 3300048921 Bacteria 22339
502 Ga0496118_0016275 3300048921 Bacteria 6829
503 Ga0496118_0024006 3300048921 Bacteria 5278
504 Ga0496118_0026815 3300048921 Bacteria 4896
505 Ga0496119_0000015 3300048922 Bacteria 312979
506 Ga0496119_0000162 3300048922 Bacteria 92734
507 Ga0496119_0012001 3300048922 Bacteria 7091
508 Ga0496120_0000029 3300048923 Bacteria 229859
509 Ga0496120_0000069 3300048923 Bacteria 165694
510 Ga0496120_0000107 3300048923 Bacteria 139739
511 Ga0496121_0000094 3300048924 Bacteria 212726
512 Ga0496121_0001088 3300048924 Bacteria 48017
513 Ga0496121_0001562 3300048924 Bacteria 38246
514 Ga0496121_0002972 3300048924 Bacteria 24695
515 Ga0496122_0001000 3300048925 Bacteria 50237
516 Ga0496122_0001194 3300048925 Bacteria 44317
517 Ga0496122_0014246 3300048925 Bacteria 7703
518 Ga0496122_0019652 3300048925 Bacteria 6158
519 Ga0496122_0029009 3300048925 Bacteria 4679
520 Ga0496122_0208012 3300048925 Bacteria 1136
521 Ga0496123_0000532 3300048926 Bacteria 65557
522 Ga0496123_0001099 3300048926 Bacteria 40612
523 Ga0496123_0005042 3300048926 Bacteria 13508
524 Ga0496123_0010262 3300048926 Bacteria 8307
525 Ga0496123_0016070 3300048926 Bacteria 6100
526 Ga0496123_0022268 3300048926 Bacteria 4890
527 Ga0496123_0043415 3300048926 Bacteria 3088
528 Ga0496124_0000022 3300048927 Bacteria 421020
529 Ga0496124_0000126 3300048927 Bacteria 159539
530 Ga0496124_0000216 3300048927 Bacteria 112485
531 Ga0496124_0000669 3300048927 Bacteria 56349
532 Ga0496124_0019824 3300048927 Bacteria 6240
533 Ga0496124_0025770 3300048927 Bacteria 5317
534 Ga0496124_0051943 3300048927 Bacteria 3485
535 Ga0496124_0093633 3300048927 Bacteria 2445
536 Ga0496124_0149537 3300048927 Unclassified 1834
537 Ga0496125_0001708 3300048928 Bacteria 30582
538 Ga0496125_0002955 3300048928 Bacteria 21369
539 Ga0496125_0003481 3300048928 Bacteria 19032
540 Ga0496125_0014982 3300048928 Bacteria 7528
541 Ga0496125_0016064 3300048928 Bacteria 7207
542 Ga0496125_0028394 3300048928 Bacteria 5054
543 Ga0496125_0032405 3300048928 Bacteria 4643
544 Ga0496125_0042251 3300048928 Bacteria 3885
545 Ga0496125_0046673 3300048928 Bacteria 3632
546 Ga0496125_0093894 3300048928 Bacteria 2237
547 Ga0496126_0006709 3300048929 Bacteria 12782
548 Ga0496126_0041067 3300048929 Bacteria 4285
549 Ga0496126_0126902 3300048929 Bacteria 2207
550 Ga0496126_0130040 3300048929 Bacteria 2176
551 Ga0496126_0539996 3300048929 Bacteria 927
552 Ga0495678_000012 3300049459 Bacteria 333905
553 Ga0495678_000018 3300049459 Bacteria 279747
554 Ga0495678_000216 3300049459 Bacteria 66661
555 Ga0495678_011895 3300049459 Bacteria 4147
556 Ga0495678_012536 3300049459 Bacteria 4015
557 Ga0495678_024465 3300049459 Bacteria 2607
558 Ga0495682_0000001 3300049460 Bacteria 1559116
559 Ga0501249_000945 3300049679 Bacteria 6362
560 nmdc:mga00v17_13063_c1 3300050491 Bacteria 4601
561 nmdc:mga00v17_79991_c1 3300050491 Bacteria 2039
562 nmdc:mga05p37_33924_c1 3300050507 Bacteria 5068
563 nmdc:mga08y16_489212_c1 3300050511 Bacteria 1251
564 nmdc:mga08x19_362918_c1 3300050514 Bacteria 1012
565 Ga0500644_0000010 3300053088 Bacteria 127225
566 Ga0500583_0000229 3300053092 Bacteria 20441
567 Ga0500607_000265 3300053121 Bacteria 49493
568 Ga0500618_004202 3300053125 Bacteria 4684
569 Ga0500618_006861 3300053125 Bacteria 3301
570 Ga0500568_0007231 3300053139 Bacteria 5471
571 Ga0500589_190257 3300053147 Bacteria 798

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046453 Ga0495627_065050 Ga0495627_065050_47_802 225
2 3300046460 Ga0495638_0019996 Ga0495638_0019996_2830_3585 225
3 3300047469 Ga0495673_0029627 Ga0495673_0029627_1470_2225 227
4 3300050511 nmdc:mga08y16_489212_c1 nmdc:mga08y16_489212_c1_12_707 229
5 3300048928 Ga0496125_0042251 Ga0496125_0042251_2597_3460 237
6 3300048920 Ga0496117_0022174 Ga0496117_0022174_1196_2059 240
7 3300048921 Ga0496118_0002894 Ga0496118_0002894_17999_18862 240
8 3300021441 Ga0213871_10016347 Ga0213871_100163472 242
9 3300039438 Ga0436360_0610154 Ga0436360_0610154_251_979 242
10 3300039447 Ga0436361_0259685 Ga0436361_0259685_1012_1740 242
11 3300009147 Ga0114129_10003070 Ga0114129_1000307024 243
12 3300027512 Ga0209179_1023666 Ga0209179_10236661 243
13 3300050507 nmdc:mga05p37_33924_c1 nmdc:mga05p37_33924_c1_2744_3475 243
14 iso_pu_bacteria 2818991440 2819563761 243
15 iso_pu_bacteria 2904463128 2904463928 243
16 3300007788 Ga0099795_10001072 Ga0099795_100010721 244
17 3300010159 Ga0099796_10003487 Ga0099796_100034873 244
18 iso_pu_bacteria 2511231025 2511382766 244
19 iso_pu_bacteria 2511231035 2511436685 244
20 iso_pu_bacteria 2876601092 2876604794 244
21 iso_pu_bacteria 8016733728 8016738766 244
22 iso_pu_bacteria 8019499862 8019500412 244
23 3300048927 Ga0496124_0093633 Ga0496124_0093633_105_842 245
24 iso_pu_bacteria 2511231010 2511290295 245
25 iso_pu_bacteria 2511231018 2511339790 245
26 iso_pu_bacteria 2511231019 2511346844 245
27 iso_pu_bacteria 2511231026 2511384119 245
28 iso_pu_bacteria 2547132181 2547694314 245
29 iso_pu_bacteria 2561511199 2562466385 245
30 iso_pu_bacteria 2585427591 2585828471 245
31 iso_pu_bacteria 2585427592 2585832987 245
32 iso_pu_bacteria 2599185178 2599448411 245
33 iso_pu_bacteria 2599185292 2599902721 245
34 iso_pu_bacteria 2600255318 2601799456 245
35 iso_pu_bacteria 2603880185 2606078310 245
36 iso_pu_bacteria 2603880199 2606130418 245
37 iso_pu_bacteria 2623620443 2624480427 245
38 iso_pu_bacteria 2643221569 2643861791 245
39 iso_pu_bacteria 2643221594 2643981876 245
40 iso_pu_bacteria 2713897149 2715759336 245
41 iso_pu_bacteria 2738541297 2738825685 245
42 iso_pu_bacteria 2738541357 2739149482 245
43 iso_pu_bacteria 2738543003 2739191401 245
44 iso_pu_bacteria 2738543013 2739252097 245
45 iso_pu_bacteria 2738543026 2739317878 245
46 iso_pu_bacteria 2738543029 2739336119 245
47 iso_pu_bacteria 2747842428 2747947359 245
48 iso_pu_bacteria 2765235838 2765567735 245
49 iso_pu_bacteria 2765235840 2765580957 245
50 iso_pu_bacteria 2791354903 2791924677 245
51 iso_pu_bacteria 2791355010 2792312197 245
52 iso_pu_bacteria 2808606395 2809033941 245
53 iso_pu_bacteria 2818991445 2819595280 245
54 iso_pu_bacteria 2818991446 2819598585 245
55 iso_pu_bacteria 2818991449 2819618539 245
56 iso_pu_bacteria 2821131069 2821134311 245
57 iso_pu_bacteria 2838054893 2838061781 245
58 iso_pu_bacteria 2839094727 2839099686 245
59 iso_pu_bacteria 2842780639 2842783134 245
60 iso_pu_bacteria 2844528606 2844530924 245
61 iso_pu_bacteria 2855730933 2855732599 245
62 iso_pu_bacteria 2855767633 2855769307 245
63 iso_pu_bacteria 2857553236 2857558551 245
64 iso_pu_bacteria 2860339153 2860339943 245
65 iso_pu_bacteria 2865014394 2865015296 245
66 iso_pu_bacteria 2878029506 2878032361 245
67 iso_pu_bacteria 2881412998 2881414800 245
68 iso_pu_bacteria 2884811622 2884812643 245
69 iso_pu_bacteria 2884836552 2884841123 245
70 iso_pu_bacteria 2884852848 2884855998 245
71 iso_pu_bacteria 2896154374 2896157077 245
72 iso_pu_bacteria 2902682994 2902688113 245
73 iso_pu_bacteria 2904601388 2904606510 245
74 iso_pu_bacteria 2919046199 2919051141 245
75 iso_pu_bacteria 2919063839 2919065281 245
76 iso_pu_bacteria 2928037797 2928043745 245
77 iso_pu_bacteria 2928044640 2928050670 245
78 iso_pu_bacteria 2928051484 2928056396 245
79 iso_pu_bacteria 2928051484 2928057022 245
80 iso_pu_bacteria 2928058823 2928060480 245
81 iso_pu_bacteria 2928064002 2928070654 245
82 iso_pu_bacteria 2928130867 2928132862 245
83 iso_pu_bacteria 2931396565 2931400164 245
84 iso_pu_bacteria 2941479691 2941484475 245
85 iso_pu_bacteria 2945951305 2945952953 245
86 iso_pu_bacteria 3005452660 3005456739 245
87 iso_pu_bacteria 3007619802 3007623156 245
88 iso_pu_bacteria 3007718800 3007720606 245
89 iso_pu_bacteria 8054302542 8054306599 245
90 iso_pu_bacteria 2939589442 2939592019 246
91 iso_pu_bacteria 2974307012 2974309809 246
92 iso_pu_bacteria 2984514374 2984514976 246
93 3300003763 Ga0055529_1000076 Ga0055529_100007693 247
94 3300003771 Ga0055526_1000001 Ga0055526_1000001346 247
95 3300025272 Ga0209455_1000073 Ga0209455_100007394 247
96 3300025295 Ga0209564_1000002 Ga0209564_1000002221 247
97 3300041496 Ga0451839_1439921 Ga0451839_1439921_2230_2976 247
98 3300041498 Ga0451841_0211792 Ga0451841_0211792_176_922 247
99 3300041505 Ga0451849_0573323 Ga0451849_0573323_1028_1774 247
100 3300041512 Ga0451853_1146243 Ga0451853_1146243_1800_2546 247
101 3300046457 Ga0495590_0000034 Ga0495590_0000034_76665_77408 247
102 3300046460 Ga0495638_0000072 Ga0495638_0000072_81171_81914 247
103 3300046471 Ga0495650_0001279 Ga0495650_0001279_21351_22094 247
104 3300046501 Ga0495607_0005220 Ga0495607_0005220_8564_9307 247
105 3300046506 Ga0495583_0000148 Ga0495583_0000148_81074_81817 247
106 3300046507 Ga0495606_0001515 Ga0495606_0001515_10669_11412 247
107 3300046522 Ga0495643_0000135 Ga0495643_0000135_36399_37142 247
108 3300046524 Ga0495648_0000037 Ga0495648_0000037_113583_114326 247
109 3300046524 Ga0495648_0024592 Ga0495648_0024592_226_972 247
110 3300046528 Ga0495642_0001233 Ga0495642_0001233_4683_5426 247
111 3300046538 Ga0495609_0039486 Ga0495609_0039486_31_774 247
112 3300046542 Ga0495597_0000165 Ga0495597_0000165_36709_37452 247
113 3300046557 Ga0495622_0000040 Ga0495622_0000040_36728_37471 247
114 3300046558 Ga0495633_0000121 Ga0495633_0000121_45365_46108 247
115 3300046616 Ga0495668_0001411 Ga0495668_0001411_20352_21095 247
116 3300046660 Ga0495625_0000023 Ga0495625_0000023_265649_266392 247
117 3300047472 Ga0495686_0000043 Ga0495686_0000043_28531_29280 247
118 3300049459 Ga0495678_011895 Ga0495678_011895_562_1305 247
119 3300049459 Ga0495678_012536 Ga0495678_012536_562_1305 247
120 3300003791 Ga0055530_10000682 Ga0055530_1000068214 248
121 3300003856 Ga0058692_1000046 Ga0058692_100004611 248
122 3300003856 Ga0058692_1009516 Ga0058692_10095162 248
123 3300003856 Ga0058692_1009557 Ga0058692_10095573 248
124 3300005518 Ga0070699_100070997 Ga0070699_1000709971 248
125 3300006028 Ga0070717_10714426 Ga0070717_107144261 248
126 3300006051 Ga0075364_10038380 Ga0075364_100383803 248
127 3300009011 Ga0105251_10111070 Ga0105251_101110702 248
128 3300009036 Ga0105244_10008796 Ga0105244_100087965 248
129 3300009036 Ga0105244_10014434 Ga0105244_100144344 248
130 3300009092 Ga0105250_10007044 Ga0105250_100070442 248
131 3300011119 Ga0105246_10001928 Ga0105246_100019289 248
132 3300011119 Ga0105246_10008064 Ga0105246_100080642 248
133 3300013100 Ga0157373_10000689 Ga0157373_1000068911 248
134 3300013102 Ga0157371_10000882 Ga0157371_1000088217 248
135 3300025272 Ga0209455_1001217 Ga0209455_100121711 248
136 3300025298 Ga0209050_1000417 Ga0209050_100041738 248
137 3300025711 Ga0207696_1000113 Ga0207696_100011378 248
138 3300025735 Ga0207713_1068798 Ga0207713_10687982 248
139 3300025910 Ga0207684_10065791 Ga0207684_100657912 248
140 3300027312 Ga0209371_1000017 Ga0209371_100001797 248
141 3300027312 Ga0209371_1000033 Ga0209371_1000033165 248
142 3300027312 Ga0209371_1002427 Ga0209371_10024279 248
143 3300030500 Ga0268256_1000036 Ga0268256_1000036161 248
144 3300030500 Ga0268256_1006645 Ga0268256_10066455 248
145 3300031456 Ga0307513_10103746 Ga0307513_101037462 248
146 3300044712 Ga0453684_0000006 Ga0453684_0000006_18190_18939 248
147 3300046458 Ga0495591_000006 Ga0495591_000006_218549_219295 248
148 3300046524 Ga0495648_0004793 Ga0495648_0004793_1727_2473 248
149 3300046530 Ga0495654_0000013 Ga0495654_0000013_273032_273778 248
150 3300046648 Ga0495611_0038933 Ga0495611_0038933_1225_1971 248
151 3300046660 Ga0495625_0000648 Ga0495625_0000648_8430_9176 248
152 3300046689 Ga0495613_0087299 Ga0495613_0087299_30_776 248
153 3300046794 Ga0495589_0183398 Ga0495589_0183398_210_956 248
154 3300047443 Ga0495687_000136 Ga0495687_000136_23872_24618 248
155 3300048904 Ga0496101_0000006 Ga0496101_0000006_238006_238803 248
156 3300048920 Ga0496117_0092523 Ga0496117_0092523_103_900 248
157 3300048922 Ga0496119_0012001 Ga0496119_0012001_4385_5182 248
158 3300048923 Ga0496120_0000069 Ga0496120_0000069_89188_89985 248
159 3300048925 Ga0496122_0014246 Ga0496122_0014246_6300_7097 248
160 3300048926 Ga0496123_0005042 Ga0496123_0005042_10703_11500 248
161 3300048927 Ga0496124_0051943 Ga0496124_0051943_25_822 248
162 3300048929 Ga0496126_0041067 Ga0496126_0041067_3194_3991 248
163 3300049459 Ga0495678_000216 Ga0495678_000216_38839_39585 248
164 3300050491 nmdc:mga00v17_79991_c1 nmdc:mga00v17_79991_c1_1259_2005 248
165 3300053092 Ga0500583_0000229 Ga0500583_0000229_5092_5838 248
166 iso_pu_bacteria 2857564685 2857566083 248
167 3300001915 JGI24741J21665_1000149 JGI24741J21665_10001494 249
168 3300001979 JGI24740J21852_10000253 JGI24740J21852_100002538 249
169 3300002704 JGI25155J39150_1000366 JGI25155J39150_10003666 249
170 3300002704 JGI25155J39150_1000384 JGI25155J39150_10003842 249
171 3300002705 JGI25156J39149_1000649 JGI25156J39149_10006498 249
172 3300002705 JGI25156J39149_1003944 JGI25156J39149_10039444 249
173 3300002705 JGI25156J39149_1007255 JGI25156J39149_10072552 249
174 3300002737 JGI25162J39368_1000045 JGI25162J39368_1000045149 249
175 3300002738 JGI25154J39366_1000534 JGI25154J39366_10005348 249
176 3300002741 JGI25157J39369_1000665 JGI25157J39369_10006658 249
177 3300002771 JGI25163J39215_1000153 JGI25163J39215_10001533 249
178 3300002772 JGI25164J39214_1000068 JGI25164J39214_100006884 249
179 3300002773 JGI25152J39213_1000033 JGI25152J39213_100003371 249
180 3300002773 JGI25152J39213_1000059 JGI25152J39213_10000592 249
181 3300002773 JGI25152J39213_1001371 JGI25152J39213_100137110 249
182 3300002773 JGI25152J39213_1008458 JGI25152J39213_10084582 249
183 3300002774 JGI25150J39212_1000310 JGI25150J39212_100031012 249
184 3300002774 JGI25150J39212_1004214 JGI25150J39212_10042143 249
185 3300003187 JGI25151J46595_10000125 JGI25151J46595_1000012548 249
186 3300003187 JGI25151J46595_10000142 JGI25151J46595_1000014212 249
187 3300003214 JGI25165J46597_1000086 JGI25165J46597_1000086149 249
188 3300003215 JGI25153J46596_10000107 JGI25153J46596_1000010771 249
189 3300003215 JGI25153J46596_10011490 JGI25153J46596_100114902 249
190 3300003322 rootL2_10195311 rootL2_101953115 249
191 3300003751 Ga0055538_1000053 Ga0055538_100005380 249
192 3300003751 Ga0055538_1002465 Ga0055538_10024652 249
193 3300003751 Ga0055538_1005827 Ga0055538_10058271 249
194 3300003752 Ga0055539_1000073 Ga0055539_100007365 249
195 3300003752 Ga0055539_1000078 Ga0055539_100007880 249
196 3300003756 Ga0055533_1000084 Ga0055533_100008480 249
197 3300003756 Ga0055533_1002943 Ga0055533_10029434 249
198 3300003758 Ga0055532_1000090 Ga0055532_100009028 249
199 3300003758 Ga0055532_1000453 Ga0055532_100045311 249
200 3300003759 Ga0055525_1000112 Ga0055525_100011242 249
201 3300003759 Ga0055525_1000387 Ga0055525_10003874 249
202 3300003761 Ga0055535_1000085 Ga0055535_100008528 249
203 3300003761 Ga0055535_1000266 Ga0055535_100026634 249
204 3300003762 Ga0055542_1000028 Ga0055542_100002834 249
205 3300003763 Ga0055529_1000134 Ga0055529_100013478 249
206 3300003771 Ga0055526_1000930 Ga0055526_10009302 249
207 3300003773 Ga0055537_1000017 Ga0055537_100001751 249
208 3300003773 Ga0055537_1000601 Ga0055537_10006012 249
209 3300003773 Ga0055537_1011205 Ga0055537_10112052 249
210 3300003775 Ga0055524_1010020 Ga0055524_10100202 249
211 3300003781 Ga0055536_1000013 Ga0055536_1000013164 249
212 3300003781 Ga0055536_1001445 Ga0055536_10014459 249
213 3300003781 Ga0055536_1007380 Ga0055536_10073802 249
214 3300003781 Ga0055536_1016734 Ga0055536_10167343 249
215 3300003784 Ga0055534_1000422 Ga0055534_100042223 249
216 3300003784 Ga0055534_1000517 Ga0055534_100051717 249
217 3300003790 Ga0055528_1000182 Ga0055528_10001828 249
218 3300003790 Ga0055528_1002641 Ga0055528_10026415 249
219 3300003791 Ga0055530_10000110 Ga0055530_1000011015 249
220 3300003791 Ga0055530_10002989 Ga0055530_1000298911 249
221 3300003792 Ga0055540_1000008 Ga0055540_1000008211 249
222 3300003794 Ga0055531_10000182 Ga0055531_1000018270 249
223 3300003794 Ga0055531_10002778 Ga0055531_100027788 249
224 3300003794 Ga0055531_10005527 Ga0055531_100055276 249
225 3300003841 Ga0055541_1000055 Ga0055541_100005542 249
226 3300003841 Ga0055541_1004043 Ga0055541_10040432 249
227 3300003841 Ga0055541_1015050 Ga0055541_10150501 249
228 3300004625 Ga0055543_1000251 Ga0055543_100025150 249
229 3300005262 Ga0065165_1031028 Ga0065165_10310282 249
230 3300005344 Ga0070661_100000141 Ga0070661_10000014123 249
231 3300005353 Ga0070669_100038466 Ga0070669_1000384663 249
232 3300005356 Ga0070674_100054535 Ga0070674_1000545353 249
233 3300005455 Ga0070663_100000034 Ga0070663_10000003437 249
234 3300005539 Ga0068853_100482060 Ga0068853_1004820602 249
235 3300005548 Ga0070665_100019693 Ga0070665_1000196936 249
236 3300005563 Ga0068855_100002732 Ga0068855_1000027323 249
237 3300005564 Ga0070664_100000057 Ga0070664_10000005738 249
238 3300005577 Ga0068857_100202125 Ga0068857_1002021252 249
239 3300005577 Ga0068857_100294877 Ga0068857_1002948772 249
240 3300005577 Ga0068857_100688019 Ga0068857_1006880192 249
241 3300005578 Ga0068854_100000299 Ga0068854_10000029924 249
242 3300005578 Ga0068854_100001474 Ga0068854_10000147412 249
243 3300005614 Ga0068856_100004528 Ga0068856_1000045281 249
244 3300005616 Ga0068852_100006625 Ga0068852_1000066259 249
245 3300006042 Ga0075368_10051601 Ga0075368_100516012 249
246 3300006051 Ga0075364_10196136 Ga0075364_101961362 249
247 3300006178 Ga0075367_10039648 Ga0075367_100396483 249
248 3300006353 Ga0075370_10007730 Ga0075370_100077303 249
249 3300006353 Ga0075370_10098827 Ga0075370_100988272 249
250 3300006946 Ga0079104_1000588 Ga0079104_100058819 249
251 3300006946 Ga0079104_1006426 Ga0079104_10064262 249
252 3300009011 Ga0105251_10002126 Ga0105251_1000212612 249
253 3300009036 Ga0105244_10001727 Ga0105244_1000172718 249
254 3300009036 Ga0105244_10002986 Ga0105244_1000298611 249
255 3300009036 Ga0105244_10022260 Ga0105244_100222604 249
256 3300009036 Ga0105244_10035782 Ga0105244_100357822 249
257 3300009036 Ga0105244_10082403 Ga0105244_100824032 249
258 3300009092 Ga0105250_10037889 Ga0105250_100378893 249
259 3300009093 Ga0105240_10005332 Ga0105240_1000533210 249
260 3300009093 Ga0105240_10009982 Ga0105240_100099823 249
261 3300009093 Ga0105240_10043342 Ga0105240_100433424 249
262 3300009093 Ga0105240_10089465 Ga0105240_100894652 249
263 3300009094 Ga0111539_10506466 Ga0111539_105064662 249
264 3300009148 Ga0105243_10000060 Ga0105243_10000060130 249
265 3300009177 Ga0105248_10001874 Ga0105248_100018747 249
266 3300009545 Ga0105237_10002344 Ga0105237_1000234412 249
267 3300009545 Ga0105237_10017153 Ga0105237_100171533 249
268 3300009545 Ga0105237_10153147 Ga0105237_101531473 249
269 3300009551 Ga0105238_10074582 Ga0105238_100745823 249
270 3300009551 Ga0105238_10483004 Ga0105238_104830041 249
271 3300009553 Ga0105249_10052161 Ga0105249_100521614 249
272 3300011119 Ga0105246_10002304 Ga0105246_100023043 249
273 3300011119 Ga0105246_10260262 Ga0105246_102602621 249
274 3300013100 Ga0157373_10011967 Ga0157373_100119674 249
275 3300013100 Ga0157373_10061280 Ga0157373_100612802 249
276 3300013100 Ga0157373_10085992 Ga0157373_100859922 249
277 3300013102 Ga0157371_10000323 Ga0157371_1000032330 249
278 3300013102 Ga0157371_10001987 Ga0157371_100019877 249
279 3300013102 Ga0157371_10020930 Ga0157371_100209306 249
280 3300013104 Ga0157370_10000038 Ga0157370_1000003829 249
281 3300013104 Ga0157370_10060812 Ga0157370_100608122 249
282 3300013104 Ga0157370_10162226 Ga0157370_101622262 249
283 3300013104 Ga0157370_10257696 Ga0157370_102576961 249
284 3300013105 Ga0157369_10116072 Ga0157369_101160722 249
285 3300013105 Ga0157369_10130059 Ga0157369_101300592 249
286 3300013105 Ga0157369_10398218 Ga0157369_103982182 249
287 3300013307 Ga0157372_10000776 Ga0157372_1000077614 249
288 3300013307 Ga0157372_10012224 Ga0157372_100122248 249
289 3300013307 Ga0157372_10043233 Ga0157372_100432335 249
290 3300014497 Ga0182008_10021417 Ga0182008_100214173 249
291 3300015261 Ga0182006_1002101 Ga0182006_10021015 249
292 3300015261 Ga0182006_1002886 Ga0182006_10028867 249
293 3300015261 Ga0182006_1006256 Ga0182006_10062565 249
294 3300015261 Ga0182006_1024252 Ga0182006_10242522 249
295 3300015261 Ga0182006_1033655 Ga0182006_10336552 249
296 3300015265 Ga0182005_1003975 Ga0182005_10039757 249
297 3300015265 Ga0182005_1009668 Ga0182005_10096682 249
298 3300015265 Ga0182005_1022471 Ga0182005_10224712 249
299 3300020610 Ga0154015_1552384 Ga0154015_15523845 249
300 3300021361 Ga0213872_10001382 Ga0213872_100013823 249
301 3300021361 Ga0213872_10004287 Ga0213872_100042875 249
302 3300021361 Ga0213872_10005115 Ga0213872_100051154 249
303 3300025206 Ga0209435_100080 Ga0209435_10008010 249
304 3300025207 Ga0209760_100019 Ga0209760_10001922 249
305 3300025208 Ga0209436_107749 Ga0209436_1077492 249
306 3300025224 Ga0209784_100006 Ga0209784_100006125 249
307 3300025224 Ga0209784_100035 Ga0209784_10003542 249
308 3300025224 Ga0209784_102348 Ga0209784_1023482 249
309 3300025225 Ga0209566_100002 Ga0209566_100002125 249
310 3300025225 Ga0209566_100040 Ga0209566_10004042 249
311 3300025225 Ga0209566_102892 Ga0209566_1028922 249
312 3300025226 Ga0209674_100057 Ga0209674_10005742 249
313 3300025226 Ga0209674_100097 Ga0209674_100097125 249
314 3300025226 Ga0209674_103486 Ga0209674_1034862 249
315 3300025228 Ga0209672_100208 Ga0209672_10020832 249
316 3300025228 Ga0209672_100619 Ga0209672_10061915 249
317 3300025228 Ga0209672_106111 Ga0209672_1061112 249
318 3300025229 Ga0209147_100004 Ga0209147_1000041266 249
319 3300025229 Ga0209147_100018 Ga0209147_100018375 249
320 3300025229 Ga0209147_101308 Ga0209147_1013085 249
321 3300025230 Ga0209563_100041 Ga0209563_100041347 249
322 3300025230 Ga0209563_100059 Ga0209563_10005942 249
323 3300025231 Ga0207427_100011 Ga0207427_10001122 249
324 3300025231 Ga0207427_100362 Ga0207427_10036226 249
325 3300025233 Ga0209437_100044 Ga0209437_10004422 249
326 3300025233 Ga0209437_100117 Ga0209437_10011797 249
327 3300025242 Ga0209258_100028 Ga0209258_100028375 249
328 3300025242 Ga0209258_100067 Ga0209258_100067217 249
329 3300025242 Ga0209258_100788 Ga0209258_10078810 249
330 3300025245 Ga0207425_1000042 Ga0207425_1000042178 249
331 3300025245 Ga0207425_1000064 Ga0207425_1000064102 249
332 3300025245 Ga0207425_1000437 Ga0207425_100043723 249
333 3300025245 Ga0207425_1000791 Ga0207425_100079126 249
334 3300025246 Ga0209646_1000481 Ga0209646_100048111 249
335 3300025250 Ga0209026_1000729 Ga0209026_100072910 249
336 3300025253 Ga0209677_100007 Ga0209677_100007125 249
337 3300025253 Ga0209677_100036 Ga0209677_10003642 249
338 3300025254 Ga0209148_1000067 Ga0209148_1000067260 249
339 3300025256 Ga0209759_1000440 Ga0209759_100044010 249
340 3300025256 Ga0209759_1000665 Ga0209759_100066515 249
341 3300025256 Ga0209759_1005157 Ga0209759_10051573 249
342 3300025258 Ga0209129_1000041 Ga0209129_100004144 249
343 3300025258 Ga0209129_1000058 Ga0209129_1000058184 249
344 3300025258 Ga0209129_1000101 Ga0209129_1000101102 249
345 3300025258 Ga0209129_1002473 Ga0209129_10024734 249
346 3300025261 Ga0209233_1000057 Ga0209233_100005722 249
347 3300025263 Ga0209565_1000027 Ga0209565_1000027200 249
348 3300025263 Ga0209565_1000031 Ga0209565_1000031116 249
349 3300025263 Ga0209565_1003184 Ga0209565_10031843 249
350 3300025272 Ga0209455_1000107 Ga0209455_100010775 249
351 3300025272 Ga0209455_1011945 Ga0209455_10119452 249
352 3300025273 Ga0209673_1000031 Ga0209673_1000031190 249
353 3300025273 Ga0209673_1000164 Ga0209673_1000164103 249
354 3300025273 Ga0209673_1000814 Ga0209673_100081430 249
355 3300025273 Ga0209673_1041467 Ga0209673_10414671 249
356 3300025284 Ga0209130_1000025 Ga0209130_1000025241 249
357 3300025284 Ga0209130_1000468 Ga0209130_100046830 249
358 3300025284 Ga0209130_1020413 Ga0209130_10204131 249
359 3300025291 Ga0209675_1000015 Ga0209675_1000015215 249
360 3300025291 Ga0209675_1000064 Ga0209675_1000064173 249
361 3300025291 Ga0209675_1007717 Ga0209675_10077171 249
362 3300025291 Ga0209675_1009594 Ga0209675_10095944 249
363 3300025291 Ga0209675_1010742 Ga0209675_10107425 249
364 3300025292 Ga0209676_1000002 Ga0209676_10000021361 249
365 3300025292 Ga0209676_1000125 Ga0209676_100012514 249
366 3300025292 Ga0209676_1002297 Ga0209676_10022979 249
367 3300025292 Ga0209676_1007184 Ga0209676_10071845 249
368 3300025292 Ga0209676_1028656 Ga0209676_10286562 249
369 3300025292 Ga0209676_1043034 Ga0209676_10430342 249
370 3300025294 Ga0209025_1000048 Ga0209025_1000048144 249
371 3300025294 Ga0209025_1000057 Ga0209025_1000057124 249
372 3300025294 Ga0209025_1000075 Ga0209025_1000075108 249
373 3300025294 Ga0209025_1021207 Ga0209025_10212072 249
374 3300025294 Ga0209025_1035103 Ga0209025_10351032 249
375 3300025295 Ga0209564_1000029 Ga0209564_1000029190 249
376 3300025295 Ga0209564_1000037 Ga0209564_1000037154 249
377 3300025295 Ga0209564_1000040 Ga0209564_1000040283 249
378 3300025295 Ga0209564_1000833 Ga0209564_100083330 249
379 3300025297 Ga0209758_1000043 Ga0209758_1000043250 249
380 3300025297 Ga0209758_1000050 Ga0209758_1000050156 249
381 3300025297 Ga0209758_1000056 Ga0209758_1000056144 249
382 3300025297 Ga0209758_1029810 Ga0209758_10298102 249
383 3300025298 Ga0209050_1000006 Ga0209050_1000006209 249
384 3300025298 Ga0209050_1000012 Ga0209050_1000012770 249
385 3300025298 Ga0209050_1001644 Ga0209050_10016448 249
386 3300025298 Ga0209050_1018450 Ga0209050_10184503 249
387 3300025299 Ga0209256_1000023 Ga0209256_1000023156 249
388 3300025299 Ga0209256_1000764 Ga0209256_100076430 249
389 3300025299 Ga0209256_1000795 Ga0209256_100079533 249
390 3300025299 Ga0209256_1015339 Ga0209256_10153392 249
391 3300025302 Ga0207426_1000118 Ga0207426_1000118230 249
392 3300025302 Ga0207426_1000667 Ga0207426_100066730 249
393 3300025303 Ga0209051_1000001 Ga0209051_10000011361 249
394 3300025303 Ga0209051_1000332 Ga0209051_100033214 249
395 3300025303 Ga0209051_1000596 Ga0209051_100059644 249
396 3300025303 Ga0209051_1042992 Ga0209051_10429921 249
397 3300025304 Ga0209257_1000029 Ga0209257_1000029209 249
398 3300025304 Ga0209257_1001127 Ga0209257_100112718 249
399 3300025304 Ga0209257_1002697 Ga0209257_10026979 249
400 3300025304 Ga0209257_1005074 Ga0209257_10050742 249
401 3300025304 Ga0209257_1017550 Ga0209257_10175503 249
402 3300025321 Ga0207656_10007589 Ga0207656_100075893 249
403 3300025711 Ga0207696_1004605 Ga0207696_10046054 249
404 3300025711 Ga0207696_1007987 Ga0207696_10079873 249
405 3300025711 Ga0207696_1018885 Ga0207696_10188852 249
406 3300025728 Ga0207655_1000076 Ga0207655_100007667 249
407 3300025728 Ga0207655_1003284 Ga0207655_100328411 249
408 3300025728 Ga0207655_1007697 Ga0207655_10076977 249
409 3300025735 Ga0207713_1000001 Ga0207713_10000011107 249
410 3300025735 Ga0207713_1000271 Ga0207713_100027158 249
411 3300025735 Ga0207713_1000924 Ga0207713_100092412 249
412 3300025913 Ga0207695_10002492 Ga0207695_100024929 249
413 3300025913 Ga0207695_10004475 Ga0207695_100044759 249
414 3300025913 Ga0207695_10047597 Ga0207695_100475973 249
415 3300025913 Ga0207695_10091178 Ga0207695_100911782 249
416 3300025914 Ga0207671_10019159 Ga0207671_100191594 249
417 3300025914 Ga0207671_10109259 Ga0207671_101092592 249
418 3300025920 Ga0207649_10000111 Ga0207649_1000011137 249
419 3300025923 Ga0207681_10025465 Ga0207681_100254653 249
420 3300025931 Ga0207644_10307320 Ga0207644_103073202 249
421 3300025935 Ga0207709_10000004 Ga0207709_10000004128 249
422 3300025945 Ga0207679_10000105 Ga0207679_1000010529 249
423 3300025949 Ga0207667_10004150 Ga0207667_1000415011 249
424 3300025961 Ga0207712_10026115 Ga0207712_100261153 249
425 3300025981 Ga0207640_10000154 Ga0207640_1000015427 249
426 3300025981 Ga0207640_10020925 Ga0207640_100209254 249
427 3300026067 Ga0207678_10000106 Ga0207678_1000010637 249
428 3300026078 Ga0207702_10000135 Ga0207702_1000013559 249
429 3300026078 Ga0207702_10144947 Ga0207702_101449472 249
430 3300026116 Ga0207674_10002847 Ga0207674_100028475 249
431 3300026116 Ga0207674_10318865 Ga0207674_103188651 249
432 3300026116 Ga0207674_10322449 Ga0207674_103224492 249
433 3300026142 Ga0207698_10119118 Ga0207698_101191181 249
434 3300027111 Ga0209281_1000564 Ga0209281_100056424 249
435 3300027312 Ga0209371_1010357 Ga0209371_10103571 249
436 3300027866 Ga0209813_10028227 Ga0209813_100282272 249
437 3300028379 Ga0268266_10001489 Ga0268266_100014899 249
438 3300028379 Ga0268266_10123553 Ga0268266_101235532 249
439 3300030500 Ga0268256_1011111 Ga0268256_10111111 249
440 3300030500 Ga0268256_1013853 Ga0268256_10138532 249
441 3300037418 Ga0395900_0012297 Ga0395900_0012297_2111_2872 249
442 3300037418 Ga0395900_0094227 Ga0395900_0094227_479_1228 249
443 3300038705 Ga0237819_00713 Ga0237819_00713_9717_10466 249
444 3300038705 Ga0237819_01208 Ga0237819_01208_1456_2205 249
445 3300039447 Ga0436361_0180056 Ga0436361_0180056_136_885 249
446 3300039447 Ga0436361_0714089 Ga0436361_0714089_746_1507 249
447 3300039447 Ga0436361_0936593 Ga0436361_0936593_16888_17637 249
448 3300039447 Ga0436361_0980770 Ga0436361_0980770_41_808 249
449 3300039447 Ga0436361_1144899 Ga0436361_1144899_6400_7149 249
450 3300039447 Ga0436361_1163602 Ga0436361_1163602_2993_3742 249
451 3300041405 Ga0439438_014315 Ga0439438_014315_426_1175 249
452 3300041407 Ga0439447_007104 Ga0439447_007104_2188_2937 249
453 3300041411 Ga0439466_0000009 Ga0439466_0000009_130188_130937 249
454 3300042004 Ga0439445_0077978 Ga0439445_0077978_56_808 249
455 3300042006 Ga0439432_004444 Ga0439432_004444_913_1662 249
456 3300042006 Ga0439432_004975 Ga0439432_004975_1413_2165 249
457 3300042016 Ga0439463_003955 Ga0439463_003955_99_848 249
458 3300042115 Ga0450911_000082 Ga0450911_000082_33543_34295 249
459 3300042439 Ga0439464_0023762 Ga0439464_0023762_698_1447 249
460 3300044650 Ga0466986_0000407 Ga0466986_0000407_11036_11797 249
461 3300045836 Ga0466958_0002373 Ga0466958_0002373_625_1533 249
462 3300045976 Ga0466967_0385598 Ga0466967_0385598_460_1221 249
463 3300046452 Ga0495617_000053 Ga0495617_000053_12526_13275 249
464 3300046452 Ga0495617_006511 Ga0495617_006511_1008_1844 249
465 3300046453 Ga0495627_000004 Ga0495627_000004_318586_319335 249
466 3300046453 Ga0495627_010610 Ga0495627_010610_1396_2145 249
467 3300046453 Ga0495627_022012 Ga0495627_022012_1229_1978 249
468 3300046458 Ga0495591_000009 Ga0495591_000009_170679_171440 249
469 3300046458 Ga0495591_012718 Ga0495591_012718_2293_3042 249
470 3300046458 Ga0495591_033388 Ga0495591_033388_144_893 249
471 3300046460 Ga0495638_0016221 Ga0495638_0016221_3058_3807 249
472 3300046463 Ga0495653_0000007 Ga0495653_0000007_100881_101630 249
473 3300046463 Ga0495653_0139138 Ga0495653_0139138_895_1686 249
474 3300046471 Ga0495650_0000026 Ga0495650_0000026_43974_44732 249
475 3300046471 Ga0495650_0000246 Ga0495650_0000246_39001_39765 249
476 3300046471 Ga0495650_0000391 Ga0495650_0000391_70177_70926 249
477 3300046471 Ga0495650_0004850 Ga0495650_0004850_3899_4648 249
478 3300046474 Ga0495605_0000008 Ga0495605_0000008_324682_325431 249
479 3300046474 Ga0495605_0000075 Ga0495605_0000075_56201_56962 249
480 3300046474 Ga0495605_0010856 Ga0495605_0010856_1342_2100 249
481 3300046491 Ga0495584_0006363 Ga0495584_0006363_2253_3002 249
482 3300046492 Ga0495585_0066691 Ga0495585_0066691_664_1413 249
483 3300046499 Ga0495594_0001939 Ga0495594_0001939_6606_7355 249
484 3300046500 Ga0495596_0006771 Ga0495596_0006771_2472_3221 249
485 3300046501 Ga0495607_0149807 Ga0495607_0149807_192_941 249
486 3300046506 Ga0495583_0000039 Ga0495583_0000039_8844_9593 249
487 3300046506 Ga0495583_0000395 Ga0495583_0000395_26115_26867 249
488 3300046507 Ga0495606_0000135 Ga0495606_0000135_85462_86211 249
489 3300046507 Ga0495606_0195269 Ga0495606_0195269_317_1066 249
490 3300046512 Ga0495610_0000004 Ga0495610_0000004_978336_979085 249
491 3300046512 Ga0495610_0000840 Ga0495610_0000840_26823_27572 249
492 3300046512 Ga0495610_0001860 Ga0495610_0001860_12961_13710 249
493 3300046515 Ga0495620_0000068 Ga0495620_0000068_9174_9923 249
494 3300046517 Ga0495630_0249655 Ga0495630_0249655_490_1281 249
495 3300046518 Ga0495631_0001754 Ga0495631_0001754_10452_11201 249
496 3300046519 Ga0495632_0004527 Ga0495632_0004527_7319_8074 249
497 3300046519 Ga0495632_0040525 Ga0495632_0040525_1218_1967 249
498 3300046520 Ga0495637_0000049 Ga0495637_0000049_15653_16402 249
499 3300046520 Ga0495637_0019574 Ga0495637_0019574_732_1481 249
500 3300046522 Ga0495643_0154823 Ga0495643_0154823_66_962 249
501 3300046524 Ga0495648_0000210 Ga0495648_0000210_26625_27377 249
502 3300046524 Ga0495648_0001734 Ga0495648_0001734_3096_3845 249
503 3300046524 Ga0495648_0001872 Ga0495648_0001872_4104_4853 249
504 3300046524 Ga0495648_0002256 Ga0495648_0002256_11724_12488 249
505 3300046524 Ga0495648_0007703 Ga0495648_0007703_4092_4841 249
506 3300046524 Ga0495648_0012466 Ga0495648_0012466_2235_2984 249
507 3300046526 Ga0495666_0061222 Ga0495666_0061222_323_1114 249
508 3300046529 Ga0495652_0005379 Ga0495652_0005379_5472_6221 249
509 3300046530 Ga0495654_0000005 Ga0495654_0000005_314219_314968 249
510 3300046530 Ga0495654_0003143 Ga0495654_0003143_5334_6083 249
511 3300046530 Ga0495654_0027856 Ga0495654_0027856_657_1406 249
512 3300046536 Ga0495587_0015865 Ga0495587_0015865_1738_2529 249
513 3300046538 Ga0495609_0000855 Ga0495609_0000855_8860_9609 249
514 3300046542 Ga0495597_0001792 Ga0495597_0001792_6053_6802 249
515 3300046542 Ga0495597_0006150 Ga0495597_0006150_2411_3160 249
516 3300046543 Ga0495645_0014201 Ga0495645_0014201_3995_4744 249
517 3300046557 Ga0495622_0000002 Ga0495622_0000002_263844_264593 249
518 3300046558 Ga0495633_0000011 Ga0495633_0000011_258629_259378 249
519 3300046616 Ga0495668_0002685 Ga0495668_0002685_11991_12740 249
520 3300046642 Ga0495634_0002102 Ga0495634_0002102_6659_7450 249
521 3300046648 Ga0495611_0004572 Ga0495611_0004572_3231_3980 249
522 3300046660 Ga0495625_0002351 Ga0495625_0002351_11294_12085 249
523 3300046660 Ga0495625_0068749 Ga0495625_0068749_726_1475 249
524 3300046663 Ga0495635_0005123 Ga0495635_0005123_2557_3348 249
525 3300046665 Ga0495661_0000493 Ga0495661_0000493_8990_9739 249
526 3300046665 Ga0495661_0088141 Ga0495661_0088141_586_1347 249
527 3300046679 Ga0495623_0004943 Ga0495623_0004943_5613_6404 249
528 3300046680 Ga0495646_0011497 Ga0495646_0011497_3151_3942 249
529 3300046691 Ga0495670_0136315 Ga0495670_0136315_96_845 249
530 3300046692 Ga0495671_0000024 Ga0495671_0000024_237486_238235 249
531 3300046692 Ga0495671_0000130 Ga0495671_0000130_39621_40373 249
532 3300046692 Ga0495671_0024907 Ga0495671_0024907_2226_2975 249
533 3300046692 Ga0495671_0031410 Ga0495671_0031410_1949_2698 249
534 3300046692 Ga0495671_0055188 Ga0495671_0055188_96_845 249
535 3300046694 Ga0495649_0002130 Ga0495649_0002130_9130_9879 249
536 3300046794 Ga0495589_0002111 Ga0495589_0002111_7383_8132 249
537 3300046810 Ga0495660_0000486 Ga0495660_0000486_17708_18457 249
538 3300046810 Ga0495660_0000751 Ga0495660_0000751_12463_13212 249
539 3300046810 Ga0495660_0000910 Ga0495660_0000910_6163_6912 249
540 3300046810 Ga0495660_0001700 Ga0495660_0001700_8931_9680 249
541 3300046810 Ga0495660_0014282 Ga0495660_0014282_1825_2574 249
542 3300047317 Ga0495604_0011485 Ga0495604_0011485_683_1474 249
543 3300047319 Ga0495674_0017071 Ga0495674_0017071_2672_3463 249
544 3300047320 Ga0495672_0000053 Ga0495672_0000053_80086_80835 249
545 3300047320 Ga0495672_0003564 Ga0495672_0003564_6425_7174 249
546 3300047322 Ga0495680_0028024 Ga0495680_0028024_2934_3725 249
547 3300047323 Ga0495683_0000425 Ga0495683_0000425_24009_24758 249
548 3300047323 Ga0495683_0009012 Ga0495683_0009012_2266_3024 249
549 3300047444 Ga0495675_0046321 Ga0495675_0046321_1924_2715 249
550 3300047446 Ga0495679_000043 Ga0495679_000043_132552_133301 249
551 3300047446 Ga0495679_000145 Ga0495679_000145_48356_49105 249
552 3300047446 Ga0495679_024959 Ga0495679_024959_370_1119 249
553 3300047446 Ga0495679_035601 Ga0495679_035601_354_1103 249
554 3300047469 Ga0495673_0000033 Ga0495673_0000033_342619_343401 249
555 3300047469 Ga0495673_0000109 Ga0495673_0000109_128795_129544 249
556 3300047469 Ga0495673_0000219 Ga0495673_0000219_12958_13707 249
557 3300047469 Ga0495673_0000298 Ga0495673_0000298_39544_40296 249
558 3300047469 Ga0495673_0001487 Ga0495673_0001487_16875_17630 249
559 3300047469 Ga0495673_0003597 Ga0495673_0003597_223_984 249
560 3300047469 Ga0495673_0007804 Ga0495673_0007804_3112_3861 249
561 3300047470 Ga0495681_0001359 Ga0495681_0001359_11383_12132 249
562 3300047470 Ga0495681_0003343 Ga0495681_0003343_2264_3013 249
563 3300047470 Ga0495681_0003557 Ga0495681_0003557_5556_6305 249
564 3300047472 Ga0495686_0005039 Ga0495686_0005039_2177_2944 249
565 3300047472 Ga0495686_0060138 Ga0495686_0060138_984_1733 249
566 3300047673 Ga0495593_0067577 Ga0495593_0067577_743_1534 249
567 3300047673 Ga0495593_0106200 Ga0495593_0106200_156_917 249
568 3300048088 Ga0495602_0137827 Ga0495602_0137827_1013_1804 249
569 3300048903 Ga0496100_0029456 Ga0496100_0029456_2139_2888 249
570 3300048904 Ga0496101_0002329 Ga0496101_0002329_5775_6524 249
571 3300048905 Ga0496102_0000823 Ga0496102_0000823_22537_23328 249
572 3300048905 Ga0496102_0600762 Ga0496102_0600762_155_904 249
573 3300048906 Ga0496103_0005342 Ga0496103_0005342_4134_4925 249
574 3300048908 Ga0496105_0001631 Ga0496105_0001631_5089_5838 249
575 3300048908 Ga0496105_0177779 Ga0496105_0177779_873_1622 249
576 3300048913 Ga0496110_0048536 Ga0496110_0048536_2321_3082 249
577 3300048913 Ga0496110_0347893 Ga0496110_0347893_99_848 249
578 3300048913 Ga0496110_0550924 Ga0496110_0550924_103_852 249
579 3300048915 Ga0496112_0081736 Ga0496112_0081736_2167_2916 249
580 3300048916 Ga0496113_0063092 Ga0496113_0063092_1976_2725 249
581 3300048919 Ga0496116_0001037 Ga0496116_0001037_16969_17775 249
582 3300048919 Ga0496116_0003129 Ga0496116_0003129_11381_12172 249
583 3300048919 Ga0496116_0017100 Ga0496116_0017100_2585_3376 249
584 3300048919 Ga0496116_0025454 Ga0496116_0025454_913_1665 249
585 3300048919 Ga0496116_0030789 Ga0496116_0030789_2752_3501 249
586 3300048919 Ga0496116_0179133 Ga0496116_0179133_130_879 249
587 3300048920 Ga0496117_0000268 Ga0496117_0000268_75651_76400 249
588 3300048920 Ga0496117_0004107 Ga0496117_0004107_14681_15430 249
589 3300048920 Ga0496117_0045298 Ga0496117_0045298_1376_2179 249
590 3300048920 Ga0496117_0055041 Ga0496117_0055041_1932_2723 249
591 3300048920 Ga0496117_0077259 Ga0496117_0077259_201_956 249
592 3300048920 Ga0496117_0253478 Ga0496117_0253478_22_771 249
593 3300048921 Ga0496118_0000470 Ga0496118_0000470_38962_39717 249
594 3300048921 Ga0496118_0016275 Ga0496118_0016275_2604_3353 249
595 3300048921 Ga0496118_0024006 Ga0496118_0024006_1929_2720 249
596 3300048921 Ga0496118_0026815 Ga0496118_0026815_2774_3565 249
597 3300048922 Ga0496119_0000015 Ga0496119_0000015_143211_143984 249
598 3300048922 Ga0496119_0000162 Ga0496119_0000162_24074_24823 249
599 3300048923 Ga0496120_0000029 Ga0496120_0000029_85876_86649 249
600 3300048923 Ga0496120_0000107 Ga0496120_0000107_65742_66491 249
601 3300048924 Ga0496121_0000094 Ga0496121_0000094_97779_98528 249
602 3300048924 Ga0496121_0001088 Ga0496121_0001088_12853_13605 249
603 3300048924 Ga0496121_0001562 Ga0496121_0001562_1893_2642 249
604 3300048924 Ga0496121_0002972 Ga0496121_0002972_20503_21252 249
605 3300048925 Ga0496122_0001000 Ga0496122_0001000_37518_38270 249
606 3300048925 Ga0496122_0001194 Ga0496122_0001194_31824_32615 249
607 3300048925 Ga0496122_0019652 Ga0496122_0019652_4350_5099 249
608 3300048925 Ga0496122_0029009 Ga0496122_0029009_320_1072 249
609 3300048925 Ga0496122_0208012 Ga0496122_0208012_374_1123 249
610 3300048926 Ga0496123_0000532 Ga0496123_0000532_53064_53855 249
611 3300048926 Ga0496123_0001099 Ga0496123_0001099_30129_30881 249
612 3300048926 Ga0496123_0010262 Ga0496123_0010262_5046_5795 249
613 3300048926 Ga0496123_0016070 Ga0496123_0016070_5202_5951 249
614 3300048926 Ga0496123_0022268 Ga0496123_0022268_3227_3979 249
615 3300048926 Ga0496123_0043415 Ga0496123_0043415_1168_1917 249
616 3300048927 Ga0496124_0000022 Ga0496124_0000022_191791_192540 249
617 3300048927 Ga0496124_0000126 Ga0496124_0000126_55421_56170 249
618 3300048927 Ga0496124_0000216 Ga0496124_0000216_48772_49521 249
619 3300048927 Ga0496124_0000669 Ga0496124_0000669_31044_31793 249
620 3300048927 Ga0496124_0019824 Ga0496124_0019824_4129_4878 249
621 3300048927 Ga0496124_0025770 Ga0496124_0025770_2082_2834 249
622 3300048927 Ga0496124_0149537 Ga0496124_0149537_429_1181 249
623 3300048928 Ga0496125_0001708 Ga0496125_0001708_6864_7625 249
624 3300048928 Ga0496125_0002955 Ga0496125_0002955_9130_9921 249
625 3300048928 Ga0496125_0003481 Ga0496125_0003481_7726_8475 249
626 3300048928 Ga0496125_0014982 Ga0496125_0014982_4261_5010 249
627 3300048928 Ga0496125_0016064 Ga0496125_0016064_3996_4748 249
628 3300048928 Ga0496125_0028394 Ga0496125_0028394_4183_4935 249
629 3300048928 Ga0496125_0032405 Ga0496125_0032405_1294_2043 249
630 3300048928 Ga0496125_0046673 Ga0496125_0046673_2077_2826 249
631 3300048928 Ga0496125_0093894 Ga0496125_0093894_1105_1908 249
632 3300048929 Ga0496126_0006709 Ga0496126_0006709_9997_10779 249
633 3300048929 Ga0496126_0126902 Ga0496126_0126902_1128_1919 249
634 3300048929 Ga0496126_0130040 Ga0496126_0130040_1234_1986 249
635 3300048929 Ga0496126_0539996 Ga0496126_0539996_153_902 249
636 3300049459 Ga0495678_000012 Ga0495678_000012_254917_255666 249
637 3300049459 Ga0495678_000018 Ga0495678_000018_269986_270735 249
638 3300049459 Ga0495678_024465 Ga0495678_024465_861_1616 249
639 3300049460 Ga0495682_0000001 Ga0495682_0000001_1017012_1017770 249
640 3300049679 Ga0501249_000945 Ga0501249_000945_5092_5850 249
641 3300050491 nmdc:mga00v17_13063_c1 nmdc:mga00v17_13063_c1_2391_3143 249
642 3300050514 nmdc:mga08x19_362918_c1 nmdc:mga08x19_362918_c1_62_811 249
643 3300053088 Ga0500644_0000010 Ga0500644_0000010_16918_17673 249
644 3300053121 Ga0500607_000265 Ga0500607_000265_28677_29432 249
645 3300053125 Ga0500618_004202 Ga0500618_004202_2896_3651 249
646 3300053125 Ga0500618_006861 Ga0500618_006861_1398_2294 249
647 3300053139 Ga0500568_0007231 Ga0500568_0007231_640_1392 249
648 3300053147 Ga0500589_190257 Ga0500589_190257_11_763 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

60

249

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

66

299

0.94

PF08659

KR

KR domain

61

237

0.9

PF23441

53

299

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fgs-assembly1.cif.gz_D crystal structure of a probable dehydrogenase protein 0.9898 3 249
4fgs-assembly1.cif.gz_B crystal structure of a probable dehydrogenase protein 0.9897 3 249
4i5e-assembly1.cif.gz_B crystal structure of ralstonia sp. alcohol dehydrogenase in complex with nadp+ 0.9872 3 249
4bmn-assembly1.cif.gz_B apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9872 1 249
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.987 3 249
ID Description Score Start End Superfamily
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9717 2 178 3.40.50.720
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9707 1 249 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9615 2 77 3.40.50.720
af_A0A0N7KIR0_69_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9592 3 158 3.40.50.720
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9583 1 249 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7I6ZDT7-F1-model_v4 deleted 0.9947 35 249
AF-A0A7X2LCH3-F1-model_v4 SDR family oxidoreductase 0.9934 59 249
AF-A0A6S7ABP8-F1-model_v4 Diacetyl reductase [(S)-acetoin forming] (EC 1.1.1.304) 0.9924 1 249 GO:0052588
AF-A0A2V6STH1-F1-model_v4 Oxidoreductase 0.992 3 183 GO:0016491
AF-A0A4R7QM76-F1-model_v4 deleted 0.9911 3 189

Feature Viewer

pLDDT pTM Quality
95.73 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map