F472328

General Info

Members Datasets Scaffolds Average Seq Length
647 485 409 86

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0154921|Ga0500616_0154921_398_655
Length 85
Sequence METKVLAAHVPLPLAEKVDQLAARLERSRGWIVKQALTAWIDQEERRRLTLEALADIDRGDVIDHQSVQAWADSLDSEKPLSLPR

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
6 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
7 2511231021 Pseudomonas sp. GM78 Isolate Nodule
8 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
9 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
10 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
11 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
12 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
13 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
14 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
15 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
16 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
17 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
18 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
19 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
20 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
21 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
22 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
23 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
24 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
25 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
26 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
27 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
28 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
29 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
30 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
31 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
32 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
33 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
34 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
35 2643221618 Ensifer sp. Root231 Isolate Unclassified
36 2643221626 Ensifer sp. Root31 Isolate Unclassified
37 2643221655 Ensifer sp. Root1252 Isolate Unclassified
38 2643221659 Ensifer sp. Root127 Isolate Unclassified
39 2643221712 Ensifer sp. Root258 Isolate Unclassified
40 2643221723 Ensifer sp. Root278 Isolate Unclassified
41 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
42 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
43 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
44 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
45 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
46 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
47 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
48 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
49 2791355260 Rhizobium sp. L9 Isolate Nodule
50 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
51 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
52 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
53 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
54 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
55 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
56 2802429633 Rhizobium anhuiense J3 Isolate Nodule
57 2802429634 Rhizobium anhuiense S10 Isolate Nodule
58 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
59 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
60 2802429637 Rhizobium anhuiense C15 Isolate Nodule
61 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
62 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
63 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
64 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
65 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
66 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
67 2844163670 Ensifer sp. 1H6 Isolate Unclassified
68 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
69 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
70 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
71 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
72 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
73 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
74 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
75 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
76 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
77 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
78 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
79 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
80 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
81 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
82 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
83 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
84 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
85 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
86 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
87 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
88 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
89 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
90 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
91 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
92 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
93 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
94 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
95 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
96 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
97 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
98 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
99 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
100 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
101 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
102 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
103 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
104 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
105 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
106 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
107 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
108 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
109 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
110 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
111 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
112 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
113 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
114 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
115 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
116 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
117 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
118 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
119 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
120 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
121 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
122 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
123 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
124 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
125 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
126 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
127 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
128 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
129 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
130 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
131 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
132 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
133 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
134 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
135 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
136 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
137 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
138 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
139 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
140 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
141 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
142 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
143 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
144 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
145 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
146 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
147 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
148 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
149 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
150 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
151 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
152 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
153 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
154 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
155 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
156 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
157 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
158 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
159 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
160 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
161 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
162 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
163 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
164 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
165 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
166 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
167 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
168 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
169 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
170 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
171 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
172 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
173 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
174 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
175 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
176 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
177 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
178 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
179 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
180 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
181 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
182 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
183 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
184 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
185 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
186 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
187 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
188 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
189 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
190 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
191 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
192 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
193 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
194 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
195 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
196 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
197 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
198 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
199 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
200 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
201 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
202 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
203 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
204 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
205 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
206 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
207 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
208 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
209 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
210 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
211 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
212 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
213 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
214 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
215 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
216 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
217 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
218 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
219 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
220 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
221 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
222 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
223 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
224 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
225 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
226 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
227 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
228 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
229 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
230 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
231 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
232 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
233 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
234 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
235 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
236 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
237 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
238 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
239 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
240 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
241 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
242 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
243 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
244 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
245 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
246 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
247 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
248 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
249 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
250 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
251 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
252 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
253 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
254 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
255 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
256 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
257 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
258 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
259 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
260 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
261 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
262 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
263 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
264 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
265 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
266 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
267 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
268 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
269 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
270 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
271 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
272 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
274 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
275 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
276 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
277 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
278 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
279 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
297 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
298 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
299 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
300 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
301 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
302 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
303 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
304 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
305 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
306 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
307 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
308 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
309 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
310 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
311 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
312 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
313 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
314 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
315 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
316 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
317 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
318 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
319 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
320 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
321 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
322 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
323 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
324 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
325 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
326 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
327 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
328 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
329 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
330 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
331 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
332 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
333 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
334 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
335 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
336 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
337 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
338 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
339 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
340 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
341 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
342 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
343 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
344 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
345 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
346 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
347 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
348 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
349 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
350 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
351 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
352 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
353 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
354 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
355 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
356 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
357 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
358 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
359 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
360 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
361 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
362 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
363 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
364 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
365 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
366 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
367 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
368 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
369 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
370 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
371 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
372 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
373 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
374 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
375 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
376 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
377 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
378 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
379 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
380 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
381 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
382 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
383 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
384 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
385 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
386 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
387 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
388 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
389 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
390 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
391 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
392 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
393 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
394 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
395 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
396 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
397 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
398 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
399 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
400 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
401 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
402 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
403 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
404 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
405 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
406 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
407 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
408 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
409 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
410 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
411 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
412 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
413 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
414 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
415 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
416 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
417 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
418 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
419 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
420 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
421 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
422 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
423 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
424 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
433 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
434 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
435 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
436 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
437 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
438 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
439 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
440 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
441 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
442 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
444 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
445 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
446 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
447 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
448 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
449 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
450 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
451 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
452 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
453 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
454 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
455 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
456 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
457 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
458 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
459 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
460 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
461 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
462 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
463 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
464 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
465 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
466 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
467 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
468 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
469 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
470 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
471 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
472 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
473 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
474 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
475 8004592986 Serratia sp. S119 Isolate Unclassified
476 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
477 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
478 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
479 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
480 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
481 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
482 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
483 8018176218 Rhizobium sp. N122 Isolate Nodule
484 8024501048 Rhizobium sp. H4 Isolate Nodule
485 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 62.29
Metatranscriptomes 0.93
Isolates 36.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.37
Nodule 35.86
Rhizoplane 1.39
Rhizosphere 38.18
Stem 0
Stem Tuber 0.15
Unclassified 10.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10210669 3300001989 Bacteria 570
2 JGI25158J39367_1001169 3300002739 Bacteria 4744
3 JGI25152J39213_1006849 3300002773 Bacteria 3022
4 JGI25150J39212_1038013 3300002774 Bacteria 632
5 JGI25159J45721_1000030 3300002987 Bacteria 102429
6 JGI25151J46595_10000825 3300003187 Bacteria 24670
7 JGI25151J46595_10001066 3300003187 Bacteria 20469
8 JGI25151J46595_10083486 3300003187 Bacteria 915
9 JGI25153J46596_10005661 3300003215 Bacteria 6520
10 JGI25160J50197_1000075 3300003354 Bacteria 102429
11 JGI25160J50197_1003916 3300003354 Bacteria 6515
12 JGI25160J50197_1031923 3300003354 Bacteria 1347
13 JGI25161J50226_1001805 3300003374 Bacteria 6012
14 JGI25161J50226_1003820 3300003374 Bacteria 3318
15 Ga0055526_1001290 3300003771 Bacteria 17969
16 Ga0055526_1002641 3300003771 Bacteria 11971
17 Ga0055524_1029872 3300003775 Bacteria 1600
18 Ga0055524_1040417 3300003775 Bacteria 1190
19 Ga0055536_1003181 3300003781 Bacteria 8897
20 Ga0055528_1026147 3300003790 Bacteria 1689
21 Ga0055530_10010182 3300003791 Bacteria 3508
22 Ga0055540_1038360 3300003792 Bacteria 1050
23 Ga0055540_1061293 3300003792 Bacteria 752
24 Ga0055531_10010187 3300003794 Bacteria 4705
25 Ga0055543_1000168 3300004625 Bacteria 54974
26 Ga0055543_1000477 3300004625 Bacteria 23520
27 Ga0065165_1000206 3300005262 Bacteria 102467
28 Ga0065165_1059809 3300005262 Bacteria 1047
29 Ga0070660_100100002 3300005339 Bacteria 2296
30 Ga0070713_101951598 3300005436 Bacteria 569
31 Ga0070708_101050510 3300005445 Bacteria 763
32 Ga0070663_100206924 3300005455 Unclassified 1534
33 Ga0070663_100310146 3300005455 Bacteria 1266
34 Ga0070681_10772625 3300005458 Bacteria 877
35 Ga0070681_11448196 3300005458 Unclassified 611
36 Ga0070679_100396009 3300005530 Bacteria 1327
37 Ga0070696_100876320 3300005546 Unclassified 743
38 Ga0070704_102142095 3300005549 Unclassified 520
39 Ga0068855_100114672 3300005563 Bacteria 3089
40 Ga0068857_100262374 3300005577 Bacteria 1586
41 Ga0068857_100818806 3300005577 Bacteria 890
42 Ga0068854_101382413 3300005578 Bacteria 636
43 Ga0070702_100357140 3300005615 Bacteria 1031
44 Ga0068858_101965497 3300005842 Bacteria 578
45 Ga0075365_10045989 3300006038 Bacteria 2866
46 Ga0075365_10056601 3300006038 Bacteria 2607
47 Ga0075368_10236372 3300006042 Bacteria 779
48 Ga0075363_100013508 3300006048 Bacteria 3961
49 Ga0075362_10030747 3300006177 Bacteria 2319
50 Ga0075367_10092397 3300006178 Bacteria 1842
51 Ga0075367_10124553 3300006178 Bacteria 1590
52 Ga0075369_10020997 3300006186 Bacteria 2678
53 Ga0075369_10028614 3300006186 Bacteria 2336
54 Ga0075366_10036818 3300006195 Bacteria 2885
55 Ga0075370_10000447 3300006353 Bacteria 15399
56 Ga0079104_1014054 3300006946 Bacteria 2433
57 Ga0079104_1041534 3300006946 Bacteria 1070
58 Ga0079104_1061103 3300006946 Bacteria 811
59 Ga0099826_10462000 3300006948 Bacteria 602
60 Ga0105251_10085116 3300009011 Bacteria 1458
61 Ga0105250_10468014 3300009092 Bacteria 568
62 Ga0105247_11642167 3300009101 Bacteria 529
63 Ga0105243_10321419 3300009148 Bacteria 1410
64 Ga0105248_10071986 3300009177 Bacteria 3885
65 Ga0105238_10091650 3300009551 Bacteria 3026
66 Ga0105249_10288239 3300009553 Bacteria 1642
67 Ga0105249_11038323 3300009553 Bacteria 889
68 Ga0123340_1019400 3300009763 Bacteria 5428
69 Ga0123341_1000002 3300009765 Bacteria 191257
70 Ga0123341_1035449 3300009765 Bacteria 3499
71 Ga0123342_1026000 3300009766 Bacteria 3453
72 Ga0105239_10279656 3300010375 Bacteria 1879
73 Ga0105239_11935531 3300010375 Bacteria 684
74 Ga0105239_12086157 3300010375 Bacteria 659
75 Ga0105246_10630473 3300011119 Bacteria 930
76 Ga0157373_10000942 3300013100 Bacteria 22523
77 Ga0157373_11244143 3300013100 Unclassified 562
78 Ga0157370_10994742 3300013104 Bacteria 759
79 Ga0157369_12582372 3300013105 Bacteria 514
80 Ga0163162_10052858 3300013306 Bacteria 4081
81 Ga0163163_10709956 3300014325 Bacteria 1069
82 Ga0157380_11779406 3300014326 Bacteria 675
83 Ga0182008_10094142 3300014497 Bacteria 1478
84 Ga0182006_1122088 3300015261 Bacteria 904
85 Ga0182007_10147068 3300015262 Bacteria 799
86 Ga0182005_1034416 3300015265 Bacteria 1378
87 Ga0163161_10105547 3300017792 Bacteria 2101
88 Ga0213872_10000092 3300021361 Bacteria 83677
89 Ga0228711_1011003 3300022739 Bacteria 11680
90 Ga0228711_1028456 3300022739 Bacteria 3225
91 Ga0228710_1002177 3300022740 Bacteria 30635
92 Ga0228710_1023418 3300022740 Bacteria 4499
93 Ga0209436_103109 3300025208 Bacteria 4565
94 Ga0207425_1015667 3300025245 Bacteria 1696
95 Ga0207425_1031798 3300025245 Bacteria 1049
96 Ga0209129_1000353 3300025258 Bacteria 38674
97 Ga0209673_1000760 3300025273 Bacteria 43954
98 Ga0209130_1000154 3300025284 Bacteria 102645
99 Ga0209130_1000693 3300025284 Bacteria 30142
100 Ga0209676_1001353 3300025292 Bacteria 24341
101 Ga0209025_1000032 3300025294 Bacteria 416141
102 Ga0209025_1000190 3300025294 Bacteria 153726
103 Ga0209025_1002324 3300025294 Bacteria 20545
104 Ga0209564_1000025 3300025295 Bacteria 520535
105 Ga0209564_1002550 3300025295 Bacteria 14020
106 Ga0209758_1000245 3300025297 Bacteria 111769
107 Ga0209758_1005765 3300025297 Bacteria 9300
108 Ga0209050_1000198 3300025298 Bacteria 134820
109 Ga0209050_1005931 3300025298 Bacteria 7444
110 Ga0209256_1000907 3300025299 Bacteria 36321
111 Ga0209256_1001032 3300025299 Bacteria 32691
112 Ga0207426_1000080 3300025302 Bacteria 304917
113 Ga0207426_1000109 3300025302 Bacteria 238665
114 Ga0207426_1000286 3300025302 Bacteria 102853
115 Ga0209051_1002477 3300025303 Bacteria 13187
116 Ga0209051_1006613 3300025303 Bacteria 6498
117 Ga0209051_1025986 3300025303 Bacteria 2370
118 Ga0209257_1006839 3300025304 Bacteria 7161
119 Ga0207697_10013575 3300025315 Bacteria 3398
120 Ga0207656_10673226 3300025321 Bacteria 529
121 Ga0207696_1093091 3300025711 Bacteria 825
122 Ga0207713_1136656 3300025735 Bacteria 804
123 Ga0207705_10000826 3300025909 Bacteria 25319
124 Ga0207707_10658880 3300025912 Bacteria 882
125 Ga0207657_10036215 3300025919 Bacteria 4419
126 Ga0207694_10115445 3300025924 Bacteria 2139
127 Ga0207669_10932702 3300025937 Bacteria 727
128 Ga0207711_10029927 3300025941 Bacteria 4593
129 Ga0207667_10011900 3300025949 Bacteria 10077
130 Ga0207712_10913469 3300025961 Bacteria 776
131 Ga0207703_10000135 3300026035 Bacteria 89779
132 Ga0207678_10436639 3300026067 Unclassified 1137
133 Ga0207678_11602135 3300026067 Unclassified 573
134 Ga0207674_10126223 3300026116 Bacteria 2524
135 Ga0207674_10588248 3300026116 Bacteria 1075
136 Ga0209281_1000793 3300027111 Bacteria 29754
137 Ga0209281_1010465 3300027111 Bacteria 2122
138 Ga0209281_1020573 3300027111 Bacteria 1288
139 Ga0209282_1000428 3300027666 Bacteria 20688
140 Ga0209282_1036358 3300027666 Bacteria 2973
141 Ga0209282_1049475 3300027666 Bacteria 2425
142 Ga0265323_10148236 3300028653 Bacteria 752
143 Ga0265330_10039241 3300031235 Plasmid 2104
144 Ga0265331_10399743 3300031250 Bacteria 616
145 Ga0265327_10193647 3300031251 Unclassified 924
146 Ga0307408_101554921 3300031548 Bacteria 627
147 Ga0307508_10285438 3300031616 Unclassified 1244
148 Ga0307516_10292866 3300031730 Bacteria 1306
149 Ga0307406_11196469 3300031901 Bacteria 660
150 Ga0307407_10512270 3300031903 Bacteria 881
151 Ga0315914_1002657 3300031967 Bacteria 27357
152 Ga0315914_1033585 3300031967 Bacteria 2301
153 Ga0315914_1039627 3300031967 Bacteria 1645
154 Ga0307409_102132773 3300031995 Bacteria 590
155 Ga0307416_101201828 3300032002 Bacteria 864
156 Ga0307416_102301260 3300032002 Bacteria 639
157 Ga0307414_11370519 3300032004 Bacteria 657
158 Ga0315913_1001246 3300033430 Bacteria 27362
159 Ga0315913_1051423 3300033430 Bacteria 1636
160 Ga0315915_1001267 3300033464 Bacteria 30148
161 Ga0315915_1001646 3300033464 Bacteria 27330
162 Ga0315915_1044842 3300033464 Bacteria 1917
163 Ga0395900_0147531 3300037418 Bacteria 2405
164 Ga0395898_0635369 3300037466 Bacteria 1010
165 Ga0395905_0034216 3300037471 Bacteria 4771
166 Ga0395905_0181134 3300037471 Bacteria 1978
167 Ga0395901_0046823 3300038443 Bacteria 4493
168 Ga0436361_0586967 3300039447 Bacteria 58194
169 Ga0451797_1461245 3300041453 Bacteria 625
170 Ga0451800_0259518 3300041459 Bacteria 1023
171 Ga0451833_1408807 3300041491 Bacteria 3984
172 Ga0451835_0260446 3300041492 Bacteria 2121
173 Ga0451837_0249919 3300041494 Bacteria 1475
174 Ga0451837_0694308 3300041494 Bacteria 4576
175 Ga0451839_0027569 3300041496 Bacteria 3621
176 Ga0451839_0129601 3300041496 Bacteria 1163
177 Ga0451840_13009 3300041497 Bacteria 549
178 Ga0451841_1006338 3300041498 Bacteria 1644
179 Ga0451841_1272860 3300041498 Bacteria 1615
180 Ga0451845_0574853 3300041501 Bacteria 1563
181 Ga0451845_0608733 3300041501 Bacteria 3541
182 Ga0451846_29071 3300041502 Bacteria 1006
183 Ga0451847_0210948 3300041503 Bacteria 2543
184 Ga0451847_0362927 3300041503 Bacteria 1083
185 Ga0451849_0062759 3300041505 Bacteria 1123
186 Ga0451849_0388269 3300041505 Bacteria 1498
187 Ga0451850_20411 3300041506 Bacteria 657
188 Ga0451851_0161468 3300041507 Bacteria 1900
189 Ga0451851_0611608 3300041507 Bacteria 1470
190 Ga0451843_0388296 3300041509 Bacteria 1886
191 Ga0451843_1376257 3300041509 Bacteria 1545
192 Ga0451854_15176 3300041510 Bacteria 531
193 Ga0451854_24022 3300041510 Bacteria 514
194 Ga0451855_0881404 3300041511 Bacteria 934
195 Ga0451855_1865224 3300041511 Bacteria 1345
196 Ga0451855_2004194 3300041511 Bacteria 2432
197 Ga0451853_1108787 3300041512 Bacteria 2018
198 Ga0451853_1204410 3300041512 Bacteria 1889
199 Ga0451853_3158512 3300041512 Bacteria 1279
200 Ga0452268_42669 3300041907 Bacteria 505
201 Ga0439449_0141793 3300042007 Bacteria 895
202 Ga0439463_000146 3300042016 Bacteria 18161
203 Ga0450907_040166 3300042146 Unclassified 801
204 Ga0451577_0044566 3300042876 Bacteria 3971
205 Ga0439440_0018378 3300042993 Bacteria 1547
206 Ga0453683_0054339 3300044673 Bacteria 2506
207 Ga0453684_0308237 3300044712 Bacteria 1797
208 Ga0451576_0002517 3300045051 Bacteria 27167
209 Ga0451576_0408943 3300045051 Unclassified 1423
210 Ga0495617_056781 3300046452 Bacteria 1298
211 Ga0495617_130071 3300046452 Bacteria 808
212 Ga0495627_004714 3300046453 Bacteria 5635
213 Ga0495603_0003848 3300046455 Bacteria 8939
214 Ga0495591_007611 3300046458 Bacteria 4572
215 Ga0495629_0009186 3300046459 Bacteria 7239
216 Ga0495638_0137940 3300046460 Bacteria 1426
217 Ga0495638_0241785 3300046460 Bacteria 999
218 Ga0495638_0606113 3300046460 Unclassified 537
219 Ga0495653_0056409 3300046463 Bacteria 2994
220 Ga0495653_0447097 3300046463 Bacteria 813
221 Ga0495580_0692359 3300046472 Unclassified 667
222 Ga0495582_0068441 3300046473 Bacteria 1962
223 Ga0495605_0000008 3300046474 Bacteria 334602
224 Ga0495605_0268874 3300046474 Bacteria 726
225 Ga0495664_0720235 3300046477 Unclassified 589
226 Ga0495585_0028370 3300046492 Bacteria 3192
227 Ga0495594_0001037 3300046499 Bacteria 14463
228 Ga0495594_0413163 3300046499 Unclassified 767
229 Ga0495594_0498016 3300046499 Bacteria 692
230 Ga0495594_0771653 3300046499 Bacteria 542
231 Ga0495596_0077453 3300046500 Bacteria 1291
232 Ga0495607_0051428 3300046501 Bacteria 2393
233 Ga0495607_0090872 3300046501 Bacteria 1654
234 Ga0495583_0000039 3300046506 Bacteria 241501
235 Ga0495583_0343779 3300046506 Bacteria 589
236 Ga0495606_0018287 3300046507 Bacteria 5262
237 Ga0495610_0017957 3300046512 Bacteria 4012
238 Ga0495610_0030102 3300046512 Bacteria 2849
239 Ga0495620_0000031 3300046515 Bacteria 120343
240 Ga0495620_0016725 3300046515 Bacteria 3673
241 Ga0495620_0080934 3300046515 Bacteria 1314
242 Ga0495628_0434006 3300046516 Bacteria 956
243 Ga0495630_0152408 3300046517 Bacteria 1759
244 Ga0495630_0176122 3300046517 Bacteria 1630
245 Ga0495631_0000777 3300046518 Bacteria 20493
246 Ga0495631_0211270 3300046518 Bacteria 829
247 Ga0495632_0276030 3300046519 Bacteria 749
248 Ga0495637_0006053 3300046520 Bacteria 6107
249 Ga0495648_0004346 3300046524 Bacteria 12136
250 Ga0495648_0055864 3300046524 Bacteria 2378
251 Ga0495663_0137431 3300046525 Bacteria 828
252 Ga0495666_0020024 3300046526 Bacteria 3318
253 Ga0495666_0043881 3300046526 Bacteria 2159
254 Ga0495666_0144296 3300046526 Bacteria 1108
255 Ga0495642_0168561 3300046528 Unclassified 951
256 Ga0495652_0260075 3300046529 Bacteria 1282
257 Ga0495654_0000220 3300046530 Bacteria 53505
258 Ga0495665_0012047 3300046531 Bacteria 4680
259 Ga0495665_0141447 3300046531 Bacteria 1257
260 Ga0495665_0340391 3300046531 Unclassified 764
261 Ga0495586_0033363 3300046535 Bacteria 2762
262 Ga0495586_0098184 3300046535 Bacteria 1623
263 Ga0495587_0016920 3300046536 Bacteria 4535
264 Ga0495587_0706083 3300046536 Bacteria 553
265 Ga0495609_0000031 3300046538 Bacteria 213813
266 Ga0495609_0131783 3300046538 Bacteria 1070
267 Ga0495597_0002062 3300046542 Bacteria 13405
268 Ga0495622_0016536 3300046557 Bacteria 3436
269 Ga0495622_0107381 3300046557 Bacteria 1278
270 Ga0495622_0157223 3300046557 Bacteria 1026
271 Ga0495622_0178323 3300046557 Bacteria 953
272 Ga0495633_0000011 3300046558 Bacteria 268237
273 Ga0495633_0046855 3300046558 Bacteria 2044
274 Ga0495667_0253982 3300046559 Bacteria 1119
275 Ga0495656_0106141 3300046615 Bacteria 1307
276 Ga0495611_0119267 3300046648 Bacteria 1230
277 Ga0495625_0064330 3300046660 Bacteria 2587
278 Ga0495625_0089163 3300046660 Bacteria 2135
279 Ga0495625_0353108 3300046660 Bacteria 929
280 Ga0495635_0703520 3300046663 Bacteria 655
281 Ga0495659_0111815 3300046664 Bacteria 1067
282 Ga0495661_0000021 3300046665 Bacteria 194581
283 Ga0495661_0012708 3300046665 Bacteria 5682
284 Ga0495661_0239702 3300046665 Bacteria 931
285 Ga0495588_0030975 3300046674 Bacteria 2690
286 Ga0495588_0080907 3300046674 Bacteria 1695
287 Ga0495588_0100252 3300046674 Bacteria 1521
288 Ga0495588_0267631 3300046674 Bacteria 900
289 Ga0495588_0524910 3300046674 Bacteria 620
290 Ga0495623_0047895 3300046679 Bacteria 2712
291 Ga0495623_0165594 3300046679 Bacteria 1295
292 Ga0495613_0047532 3300046689 Bacteria 3170
293 Ga0495624_0046077 3300046690 Bacteria 2773
294 Ga0495624_0117813 3300046690 Bacteria 1632
295 Ga0495670_0005064 3300046691 Bacteria 6483
296 Ga0495670_0091586 3300046691 Bacteria 1556
297 Ga0495671_0031513 3300046692 Bacteria 2711
298 Ga0495671_0116824 3300046692 Bacteria 1302
299 Ga0495589_0000960 3300046794 Bacteria 17602
300 Ga0495600_0089212 3300046809 Bacteria 2011
301 Ga0495660_0003828 3300046810 Bacteria 9210
302 Ga0495660_0062179 3300046810 Bacteria 2002
303 Ga0495581_0046397 3300047315 Bacteria 2510
304 Ga0495581_0073340 3300047315 Bacteria 1980
305 Ga0495581_0455865 3300047315 Unclassified 744
306 Ga0495604_0029224 3300047317 Bacteria 4384
307 Ga0495604_0280978 3300047317 Bacteria 1124
308 Ga0495680_0025822 3300047322 Bacteria 4856
309 Ga0495683_0000008 3300047323 Bacteria 241577
310 Ga0495675_0229222 3300047444 Bacteria 1121
311 Ga0495675_0287823 3300047444 Bacteria 978
312 Ga0495679_000043 3300047446 Bacteria 142160
313 Ga0495673_0010228 3300047469 Bacteria 5118
314 Ga0495673_0013902 3300047469 Bacteria 4205
315 Ga0495673_0056525 3300047469 Bacteria 1697
316 Ga0495681_0013081 3300047470 Bacteria 4840
317 Ga0495686_0001235 3300047472 Bacteria 29180
318 Ga0495686_0034480 3300047472 Bacteria 3259
319 Ga0495686_0087950 3300047472 Bacteria 1889
320 Ga0495686_0580656 3300047472 Bacteria 582
321 Ga0495593_0037870 3300047673 Bacteria 2606
322 Ga0495593_0099820 3300047673 Bacteria 1489
323 Ga0495593_0188917 3300047673 Bacteria 1036
324 Ga0495593_0298564 3300047673 Bacteria 805
325 Ga0495602_0265504 3300048088 Bacteria 1271
326 Ga0495602_0314138 3300048088 Bacteria 1142
327 Ga0495615_0020389 3300048090 Bacteria 1485
328 Ga0496100_0500309 3300048903 Bacteria 936
329 Ga0496102_1007396 3300048905 Unclassified 753
330 Ga0496103_0051249 3300048906 Bacteria 2554
331 Ga0496111_0117532 3300048914 Bacteria 1962
332 Ga0496116_0000129 3300048919 Bacteria 158284
333 Ga0496119_0000103 3300048922 Bacteria 122901
334 Ga0496119_0004966 3300048922 Bacteria 12998
335 Ga0496119_0132408 3300048922 Bacteria 1357
336 Ga0496119_0186588 3300048922 Bacteria 1084
337 Ga0496120_0000024 3300048923 Bacteria 236853
338 Ga0496120_0002140 3300048923 Bacteria 21070
339 Ga0496121_0028521 3300048924 Bacteria 5193
340 Ga0496121_0880723 3300048924 Bacteria 517
341 Ga0496122_0019922 3300048925 Bacteria 6099
342 Ga0496123_0033071 3300048926 Bacteria 3728
343 Ga0496124_0000136 3300048927 Bacteria 151846
344 Ga0496126_0094727 3300048929 Bacteria 2620
345 Ga0496126_1382697 3300048929 Unclassified 509
346 Ga0495678_000018 3300049459 Bacteria 279747
347 Ga0495682_0053960 3300049460 Bacteria 1459
348 Ga0501032_0007461 3300049569 Bacteria 7987
349 Ga0501033_0007287 3300049570 Bacteria 8628
350 Ga0501034_0051624 3300049571 Bacteria 4146
351 Ga0501036_0302017 3300049572 Bacteria 1339
352 Ga0501036_1118636 3300049572 Unclassified 643
353 Ga0501037_0000271 3300049573 Bacteria 44641
354 Ga0501038_0064624 3300049574 Bacteria 3120
355 Ga0501038_0209249 3300049574 Bacteria 1561
356 Ga0501043_0000096 3300049579 Bacteria 79864
357 Ga0501047_0042223 3300049581 Bacteria 4407
358 Ga0501067_0219361 3300049583 Bacteria 1059
359 Ga0501068_0098652 3300049584 Bacteria 1809
360 Ga0501069_0000012 3300049585 Bacteria 148453
361 Ga0501069_0330350 3300049585 Bacteria 897
362 Ga0501070_0000655 3300049586 Bacteria 31899
363 Ga0501070_0700288 3300049586 Bacteria 801
364 Ga0501070_0740109 3300049586 Unclassified 775
365 Ga0501071_0005903 3300049587 Bacteria 7920
366 Ga0501073_0032760 3300049589 Bacteria 3703
367 Ga0501073_0040779 3300049589 Bacteria 3284
368 Ga0501074_0000018 3300049590 Bacteria 76326
369 Ga0501079_0492224 3300049741 Bacteria 964
370 Ga0501080_0000558 3300049742 Bacteria 29460
371 Ga0501080_0179492 3300049742 Bacteria 1949
372 Ga0501083_0001735 3300049744 Bacteria 14857
373 Ga0501083_0023392 3300049744 Bacteria 4286
374 Ga0501083_0656132 3300049744 Bacteria 682
375 Ga0501035_0000039 3300049822 Bacteria 156824
376 Ga0501035_0284114 3300049822 Bacteria 1398
377 Ga0501044_0000047 3300049823 Bacteria 146449
378 Ga0501044_0128708 3300049823 Bacteria 2527
379 nmdc:mga03683_14190_c1 3300050489 Bacteria 2944
380 nmdc:mga03683_241847_c1 3300050489 Bacteria 837
381 nmdc:mga03n38_145764_c1 3300050490 Bacteria 1187
382 nmdc:mga0yw44_20701_c1 3300050492 Bacteria 3656
383 nmdc:mga0yw44_742445_c1 3300050492 Bacteria 667
384 nmdc:mga0k408_75843_c1 3300050493 Bacteria 1965
385 nmdc:mga06z11_17124_c1 3300050494 Bacteria 3282
386 nmdc:mga07m45_42347_c1 3300050496 Bacteria 2552
387 nmdc:mga0sz30_156624_c1 3300050516 Bacteria 1009
388 Ga0500578_0000006 3300053086 Bacteria 234598
389 Ga0500578_0231244 3300053086 Unclassified 1120
390 Ga0500647_0008252 3300053091 Bacteria 4516
391 Ga0500651_0000540 3300053093 Bacteria 19274
392 Ga0500651_0156541 3300053093 Bacteria 1365
393 Ga0500650_0521262 3300053098 Bacteria 503
394 Ga0500652_252580 3300053131 Bacteria 698
395 Ga0500655_019605 3300053133 Bacteria 1260
396 Ga0500658_0191510 3300053134 Bacteria 933
397 Ga0500559_0031959 3300053136 Bacteria 2259
398 Ga0500568_0080450 3300053139 Bacteria 1237
399 Ga0500577_0080469 3300053142 Unclassified 1298
400 Ga0500588_0121210 3300053146 Unclassified 923
401 Ga0500604_0144138 3300053151 Bacteria 806
402 Ga0500616_0054994 3300053153 Bacteria 2083
403 Ga0500616_0154921 3300053153 Bacteria 1057
404 Ga0500620_000230 3300053155 Bacteria 11152
405 Ga0500627_0098728 3300053158 Bacteria 1310
406 Ga0500634_0018089 3300053161 Bacteria 3782
407 Ga0500634_0053506 3300053161 Bacteria 2165
408 Ga0501082_0059465 3300060353 Bacteria 3293
409 Ga0501082_0153549 3300060353 Bacteria 2000

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048919 Ga0496116_0000129 Ga0496116_0000129_118631_118864 73
2 3300048922 Ga0496119_0000103 Ga0496119_0000103_71980_72213 73
3 3300048923 Ga0496120_0000024 Ga0496120_0000024_105079_105312 73
4 3300046660 Ga0495625_0064330 Ga0495625_0064330_1184_1459 76
5 3300046528 Ga0495642_0168561 Ga0495642_0168561_364_645 78
6 3300046463 Ga0495653_0447097 Ga0495653_0447097_254_535 79
7 3300046477 Ga0495664_0720235 Ga0495664_0720235_37_318 79
8 3300046499 Ga0495594_0413163 Ga0495594_0413163_136_417 79
9 3300046516 Ga0495628_0434006 Ga0495628_0434006_486_767 79
10 3300046517 Ga0495630_0176122 Ga0495630_0176122_459_740 79
11 3300046526 Ga0495666_0043881 Ga0495666_0043881_903_1184 79
12 3300046529 Ga0495652_0260075 Ga0495652_0260075_461_742 79
13 3300046531 Ga0495665_0340391 Ga0495665_0340391_197_478 79
14 3300046535 Ga0495586_0033363 Ga0495586_0033363_278_559 79
15 3300046536 Ga0495587_0016920 Ga0495587_0016920_3080_3361 79
16 3300046557 Ga0495622_0107381 Ga0495622_0107381_724_1005 79
17 3300046559 Ga0495667_0253982 Ga0495667_0253982_91_372 79
18 3300046674 Ga0495588_0030975 Ga0495588_0030975_1839_2120 79
19 3300046679 Ga0495623_0047895 Ga0495623_0047895_1839_2120 79
20 3300046689 Ga0495613_0047532 Ga0495613_0047532_836_1117 79
21 3300046690 Ga0495624_0117813 Ga0495624_0117813_643_924 79
22 3300046809 Ga0495600_0089212 Ga0495600_0089212_274_555 79
23 3300047315 Ga0495581_0455865 Ga0495581_0455865_196_477 79
24 3300047317 Ga0495604_0029224 Ga0495604_0029224_1225_1506 79
25 3300047444 Ga0495675_0287823 Ga0495675_0287823_287_568 79
26 3300047673 Ga0495593_0188917 Ga0495593_0188917_444_725 79
27 3300048088 Ga0495602_0314138 Ga0495602_0314138_401_682 79
28 3300031967 Ga0315914_1039627 Ga0315914_10396272 82
29 3300033464 Ga0315915_1044842 Ga0315915_10448422 82
30 3300045051 Ga0451576_0408943 Ga0451576_0408943_499_777 82
31 3300046472 Ga0495580_0692359 Ga0495580_0692359_238_525 82
32 3300046526 Ga0495666_0020024 Ga0495666_0020024_2263_2550 82
33 3300046531 Ga0495665_0012047 Ga0495665_0012047_1921_2208 82
34 3300046536 Ga0495587_0706083 Ga0495587_0706083_172_453 82
35 3300046557 Ga0495622_0016536 Ga0495622_0016536_1876_2163 82
36 3300046674 Ga0495588_0080907 Ga0495588_0080907_145_432 82
37 3300046690 Ga0495624_0046077 Ga0495624_0046077_1841_2128 82
38 3300047315 Ga0495581_0046397 Ga0495581_0046397_969_1256 82
39 iso_pu_bacteria 2503198000 2503202980 82
40 iso_pu_bacteria 2509276018 2509372470 82
41 iso_pu_bacteria 2509276021 2509390565 82
42 iso_pu_bacteria 2509276033 2509442236 82
43 iso_pu_bacteria 2510461076 2510892806 82
44 iso_pu_bacteria 2510917028 2511185986 82
45 iso_pu_bacteria 2511231052 2511499270 82
46 iso_pu_bacteria 2512875026 2512974466 82
47 iso_pu_bacteria 2512875026 2512975585 82
48 iso_pu_bacteria 2513237088 2513599366 82
49 iso_pu_bacteria 2513237089 2513607610 82
50 iso_pu_bacteria 2513237090 2513611719 82
51 iso_pu_bacteria 2513237091 2513621272 82
52 iso_pu_bacteria 2513237143 2513906876 82
53 iso_pu_bacteria 2513237156 2513989448 82
54 iso_pu_bacteria 2513237160 2514008807 82
55 iso_pu_bacteria 2515154107 2515612265 82
56 iso_pu_bacteria 2515154113 2515633111 82
57 iso_pu_bacteria 2515154114 2515640316 82
58 iso_pu_bacteria 2515154116 2515656398 82
59 iso_pu_bacteria 2517093000 2517098426 82
60 iso_pu_bacteria 2517487022 2517567173 82
61 iso_pu_bacteria 2524023207 2524449035 82
62 iso_pu_bacteria 2551306086 2551694706 82
63 iso_pu_bacteria 2551306089 2551714570 82
64 iso_pu_bacteria 2551306089 2551714627 82
65 iso_pu_bacteria 2551306090 2551717462 82
66 iso_pu_bacteria 2551306093 2551744732 82
67 iso_pu_bacteria 2585427528 2585543119 82
68 iso_pu_bacteria 2585427593 2585841485 82
69 iso_pu_bacteria 2615840624 2616297151 82
70 iso_pu_bacteria 2643221618 2644110316 82
71 iso_pu_bacteria 2643221626 2644144865 82
72 iso_pu_bacteria 2643221655 2644310210 82
73 iso_pu_bacteria 2643221659 2644336966 82
74 iso_pu_bacteria 2643221712 2644613150 82
75 iso_pu_bacteria 2643221723 2644674220 82
76 iso_pu_bacteria 2687453392 2688599859 82
77 iso_pu_bacteria 2738541333 2739035187 82
78 iso_pu_bacteria 2757320392 2757569361 82
79 iso_pu_bacteria 2775506902 2776266967 82
80 iso_pu_bacteria 2775506904 2776283065 82
81 iso_pu_bacteria 2791355094 2792640768 82
82 iso_pu_bacteria 2791355259 2793315068 82
83 iso_pu_bacteria 2791355260 2793323650 82
84 iso_pu_bacteria 2802428858 2802721806 82
85 iso_pu_bacteria 2802428858 2802722082 82
86 iso_pu_bacteria 2802428859 2802728510 82
87 iso_pu_bacteria 2802428860 2802734798 82
88 iso_pu_bacteria 2802428860 2802734995 82
89 iso_pu_bacteria 2802428861 2802741171 82
90 iso_pu_bacteria 2802428862 2802747452 82
91 iso_pu_bacteria 2802428862 2802747681 82
92 iso_pu_bacteria 2802428863 2802753821 82
93 iso_pu_bacteria 2802429633 2806048089 82
94 iso_pu_bacteria 2802429634 2806054625 82
95 iso_pu_bacteria 2802429635 2806060633 82
96 iso_pu_bacteria 2802429636 2806069447 82
97 iso_pu_bacteria 2802429637 2806076918 82
98 iso_pu_bacteria 2841864319 2841866120 82
99 iso_pu_bacteria 2842192696 2842195977 82
100 iso_pu_bacteria 2842317721 2842320269 82
101 iso_pu_bacteria 2842341865 2842342017 82
102 iso_pu_bacteria 2842363717 2842366002 82
103 iso_pu_bacteria 2842495871 2842498110 82
104 iso_pu_bacteria 2844163670 2844165392 82
105 iso_pu_bacteria 2855839649 2855844898 82
106 iso_pu_bacteria 2855839649 2855846572 82
107 iso_pu_bacteria 2856328259 2856333111 82
108 iso_pu_bacteria 2856334872 2856335587 82
109 iso_pu_bacteria 2857367948 2857372378 82
110 iso_pu_bacteria 2858800743 2858804745 82
111 iso_pu_bacteria 2869249662 2869251853 82
112 iso_pu_bacteria 2869264136 2869269257 82
113 iso_pu_bacteria 2869271264 2869273940 82
114 iso_pu_bacteria 2871459585 2871463365 82
115 iso_pu_bacteria 2874131515 2874133955 82
116 iso_pu_bacteria 2874162495 2874168525 82
117 iso_pu_bacteria 2876399893 2876402417 82
118 iso_pu_bacteria 2876406927 2876408889 82
119 iso_pu_bacteria 2878774303 2878779883 82
120 iso_pu_bacteria 2878781027 2878787506 82
121 iso_pu_bacteria 2906363423 2906366948 82
122 iso_pu_bacteria 2906370794 2906372761 82
123 iso_pu_bacteria 2906386501 2906392292 82
124 iso_pu_bacteria 2906393657 2906394441 82
125 iso_pu_bacteria 2906408224 2906409537 82
126 iso_pu_bacteria 2915980308 2915985454 82
127 iso_pu_bacteria 2916000859 2916004978 82
128 iso_pu_bacteria 2916014648 2916021476 82
129 iso_pu_bacteria 2916021584 2916023449 82
130 iso_pu_bacteria 2916028427 2916028640 82
131 iso_pu_bacteria 2916055098 2916056030 82
132 iso_pu_bacteria 2916061851 2916063152 82
133 iso_pu_bacteria 2916061851 2916067717 82
134 iso_pu_bacteria 2920760137 2920764528 82
135 iso_pu_bacteria 2921201388 2921208352 82
136 iso_pu_bacteria 2921237296 2921242532 82
137 iso_pu_bacteria 2921250672 2921255385 82
138 iso_pu_bacteria 2921263974 2921264264 82
139 iso_pu_bacteria 2921296804 2921300323 82
140 iso_pu_bacteria 2922151315 2922157345 82
141 iso_pu_bacteria 2922172374 2922175942 82
142 iso_pu_bacteria 2922178524 2922185550 82
143 iso_pu_bacteria 2924150972 2924151372 82
144 iso_pu_bacteria 2924150972 2924152299 82
145 iso_pu_bacteria 2924158325 2924159130 82
146 iso_pu_bacteria 2924158325 2924162656 82
147 iso_pu_bacteria 2924172951 2924179495 82
148 iso_pu_bacteria 2924179722 2924183921 82
149 iso_pu_bacteria 2924718760 2924722630 82
150 iso_pu_bacteria 2936996657 2937002379 82
151 iso_pu_bacteria 2937002841 2937009103 82
152 iso_pu_bacteria 2937029754 2937034817 82
153 iso_pu_bacteria 2937036028 2937041632 82
154 iso_pu_bacteria 2937042894 2937047626 82
155 iso_pu_bacteria 2937049772 2937055364 82
156 iso_pu_bacteria 2937056579 2937062407 82
157 iso_pu_bacteria 2937056579 2937062438 82
158 iso_pu_bacteria 2937063883 2937066169 82
159 iso_pu_bacteria 2937071275 2937075832 82
160 iso_pu_bacteria 2937078374 2937083362 82
161 iso_pu_bacteria 2937084907 2937085283 82
162 iso_pu_bacteria 2937084907 2937088312 82
163 iso_pu_bacteria 2937091812 2937092826 82
164 iso_pu_bacteria 2937098957 2937100384 82
165 iso_pu_bacteria 2937098957 2937101378 82
166 iso_pu_bacteria 2937106411 2937106914 82
167 iso_pu_bacteria 2937126314 2937126605 82
168 iso_pu_bacteria 2937868953 2937873975 82
169 iso_pu_bacteria 2937877337 2937879901 82
170 iso_pu_bacteria 2957375807 2957381741 82
171 iso_pu_bacteria 2957388812 2957391026 82
172 iso_pu_bacteria 2957437181 2957440360 82
173 iso_pu_bacteria 2957457609 2957458385 82
174 iso_pu_bacteria 2957457609 2957462576 82
175 iso_pu_bacteria 2957478035 2957478281 82
176 iso_pu_bacteria 2957491536 2957492646 82
177 iso_pu_bacteria 2958064165 2958067508 82
178 iso_pu_bacteria 2958084443 2958087079 82
179 iso_pu_bacteria 2958122699 2958127674 82
180 iso_pu_bacteria 2958137437 2958140463 82
181 iso_pu_bacteria 2958158011 2958160378 82
182 iso_pu_bacteria 2960591022 2960597100 82
183 iso_pu_bacteria 2960603979 2960606176 82
184 iso_pu_bacteria 2960610863 2960611387 82
185 iso_pu_bacteria 2960631154 2960631681 82
186 iso_pu_bacteria 2960631154 2960636926 82
187 iso_pu_bacteria 2960652885 2960654905 82
188 iso_pu_bacteria 2960652885 2960655005 82
189 iso_pu_bacteria 2960680706 2960685996 82
190 iso_pu_bacteria 2960693952 2960696026 82
191 iso_pu_bacteria 2960693952 2960696451 82
192 iso_pu_bacteria 2961136820 2961144094 82
193 iso_pu_bacteria 2964607997 2964608767 82
194 iso_pu_bacteria 2964607997 2964610022 82
195 iso_pu_bacteria 2964643177 2964647407 82
196 iso_pu_bacteria 2964656573 2964658840 82
197 iso_pu_bacteria 2964670856 2964675109 82
198 iso_pu_bacteria 2964705432 2964706891 82
199 iso_pu_bacteria 2964712639 2964714596 82
200 iso_pu_bacteria 2965025482 2965030384 82
201 iso_pu_bacteria 2965040258 2965044540 82
202 iso_pu_bacteria 2965047637 2965051187 82
203 iso_pu_bacteria 2965089291 2965093383 82
204 iso_pu_bacteria 2965102966 2965107104 82
205 iso_pu_bacteria 2965110997 2965111568 82
206 iso_pu_bacteria 2967664464 2967665048 82
207 iso_pu_bacteria 2967671571 2967675675 82
208 iso_pu_bacteria 2967678726 2967680994 82
209 iso_pu_bacteria 2967678726 2967681462 82
210 iso_pu_bacteria 2967714385 2967715223 82
211 iso_pu_bacteria 2967728569 2967733771 82
212 iso_pu_bacteria 2967775926 2967780335 82
213 iso_pu_bacteria 2970019648 2970021862 82
214 iso_pu_bacteria 2970026789 2970032796 82
215 iso_pu_bacteria 2970033650 2970035488 82
216 iso_pu_bacteria 2970040964 2970045997 82
217 iso_pu_bacteria 2970047711 2970048974 82
218 iso_pu_bacteria 2970068827 2970070346 82
219 iso_pu_bacteria 2970076120 2970077674 82
220 iso_pu_bacteria 2970095765 2970100268 82
221 iso_pu_bacteria 2970122695 2970128082 82
222 iso_pu_bacteria 2970143518 2970148913 82
223 iso_pu_bacteria 2970156795 2970159653 82
224 iso_pu_bacteria 2970191845 2970193119 82
225 iso_pu_bacteria 2970489779 2970495354 82
226 iso_pu_bacteria 2970547951 2970549090 82
227 iso_pu_bacteria 2977516862 2977519050 82
228 iso_pu_bacteria 2977530762 2977537031 82
229 iso_pu_bacteria 2977544691 2977546259 82
230 iso_pu_bacteria 2977544691 2977550924 82
231 iso_pu_bacteria 2977551784 2977552637 82
232 iso_pu_bacteria 2977551784 2977554552 82
233 iso_pu_bacteria 2977565890 2977566490 82
234 iso_pu_bacteria 2977579622 2977584743 82
235 iso_pu_bacteria 2977872689 2977876452 82
236 iso_pu_bacteria 2977915119 2977922502 82
237 iso_pu_bacteria 2977935797 2977939283 82
238 iso_pu_bacteria 2977950692 2977956875 82
239 iso_pu_bacteria 2977957713 2977962338 82
240 iso_pu_bacteria 2979793036 2979797309 82
241 iso_pu_bacteria 2987645492 2987650993 82
242 iso_pu_bacteria 2987673487 2987677242 82
243 iso_pu_bacteria 3004195979 3004196767 82
244 iso_pu_bacteria 3004239961 3004242737 82
245 iso_pu_bacteria 3004289098 3004292969 82
246 iso_pu_bacteria 643692032 643822833 82
247 iso_pu_bacteria 649633066 649874338 82
248 iso_pu_bacteria 8003992118 8003998654 82
249 iso_pu_bacteria 8003999396 8004005768 82
250 iso_pu_bacteria 8003999396 8004006361 82
251 iso_pu_bacteria 8004300914 8004302526 82
252 iso_pu_bacteria 8004312739 8004315122 82
253 iso_pu_bacteria 8004361976 8004367493 82
254 iso_pu_bacteria 8004592986 8004593426 82
255 iso_pu_bacteria 8004695233 8004699801 82
256 iso_pu_bacteria 8005301065 8005301230 82
257 iso_pu_bacteria 8005570704 8005571344 82
258 iso_pu_bacteria 8005688590 8005688957 82
259 iso_pu_bacteria 8005695170 8005697091 82
260 iso_pu_bacteria 8015394850 8015399800 82
261 iso_pu_bacteria 8018127388 8018132239 82
262 iso_pu_bacteria 8018176218 8018176403 82
263 iso_pu_bacteria 8024501048 8024507372 82
264 iso_pu_bacteria 8057798959 8057803116 82
265 3300046674 Ga0495588_0524910 Ga0495588_0524910_149_430 83
266 iso_pu_bacteria 2511231021 2511355567 83
267 iso_pu_bacteria 2512047018 2512325742 83
268 iso_pu_bacteria 2597489887 2597856054 83
269 iso_pu_bacteria 2599185185 2599483690 83
270 iso_pu_bacteria 2599185257 2599805599 83
271 iso_pu_bacteria 2671180172 2671767665 83
272 3300046507 Ga0495606_0018287 Ga0495606_0018287_4447_4701 84
273 3300047472 Ga0495686_0001235 Ga0495686_0001235_24545_24820 84
274 3300047472 Ga0495686_0034480 Ga0495686_0034480_435_689 84
275 3300047472 Ga0495686_0087950 Ga0495686_0087950_1157_1411 84
276 3300048903 Ga0496100_0500309 Ga0496100_0500309_169_423 84
277 3300048922 Ga0496119_0186588 Ga0496119_0186588_380_634 84
278 3300048924 Ga0496121_0028521 Ga0496121_0028521_4286_4540 84
279 3300048929 Ga0496126_1382697 Ga0496126_1382697_208_462 84
280 3300053153 Ga0500616_0154921 Ga0500616_0154921_398_655 85
281 iso_pu_bacteria 2855195626 2855196832 85
282 iso_pu_bacteria 2881927736 2881930637 85
283 iso_pu_bacteria 2891633521 2891635091 85
284 iso_pu_bacteria 2919688452 2919692488 85
285 3300001989 JGI24739J22299_10210669 JGI24739J22299_102106692 86
286 3300002739 JGI25158J39367_1001169 JGI25158J39367_10011695 86
287 3300002773 JGI25152J39213_1006849 JGI25152J39213_10068492 86
288 3300002774 JGI25150J39212_1038013 JGI25150J39212_10380132 86
289 3300002987 JGI25159J45721_1000030 JGI25159J45721_100003048 86
290 3300003187 JGI25151J46595_10000825 JGI25151J46595_100008252 86
291 3300003187 JGI25151J46595_10001066 JGI25151J46595_100010665 86
292 3300003187 JGI25151J46595_10083486 JGI25151J46595_100834862 86
293 3300003215 JGI25153J46596_10005661 JGI25153J46596_100056614 86
294 3300003354 JGI25160J50197_1000075 JGI25160J50197_100007548 86
295 3300003354 JGI25160J50197_1003916 JGI25160J50197_10039166 86
296 3300003354 JGI25160J50197_1031923 JGI25160J50197_10319232 86
297 3300003374 JGI25161J50226_1001805 JGI25161J50226_10018053 86
298 3300003374 JGI25161J50226_1003820 JGI25161J50226_10038202 86
299 3300003771 Ga0055526_1001290 Ga0055526_100129017 86
300 3300003771 Ga0055526_1002641 Ga0055526_10026415 86
301 3300003775 Ga0055524_1029872 Ga0055524_10298724 86
302 3300003775 Ga0055524_1040417 Ga0055524_10404171 86
303 3300003781 Ga0055536_1003181 Ga0055536_10031812 86
304 3300003790 Ga0055528_1026147 Ga0055528_10261473 86
305 3300003791 Ga0055530_10010182 Ga0055530_100101823 86
306 3300003792 Ga0055540_1038360 Ga0055540_10383603 86
307 3300003792 Ga0055540_1061293 Ga0055540_10612931 86
308 3300003794 Ga0055531_10010187 Ga0055531_100101872 86
309 3300004625 Ga0055543_1000168 Ga0055543_100016848 86
310 3300004625 Ga0055543_1000477 Ga0055543_100047715 86
311 3300005262 Ga0065165_1000206 Ga0065165_100020648 86
312 3300005262 Ga0065165_1059809 Ga0065165_10598091 86
313 3300005339 Ga0070660_100100002 Ga0070660_1001000024 86
314 3300005436 Ga0070713_101951598 Ga0070713_1019515981 86
315 3300005445 Ga0070708_101050510 Ga0070708_1010505102 86
316 3300005455 Ga0070663_100206924 Ga0070663_1002069242 86
317 3300005455 Ga0070663_100310146 Ga0070663_1003101461 86
318 3300005458 Ga0070681_10772625 Ga0070681_107726252 86
319 3300005458 Ga0070681_11448196 Ga0070681_114481961 86
320 3300005530 Ga0070679_100396009 Ga0070679_1003960093 86
321 3300005546 Ga0070696_100876320 Ga0070696_1008763202 86
322 3300005549 Ga0070704_102142095 Ga0070704_1021420952 86
323 3300005563 Ga0068855_100114672 Ga0068855_1001146723 86
324 3300005577 Ga0068857_100262374 Ga0068857_1002623742 86
325 3300005577 Ga0068857_100818806 Ga0068857_1008188063 86
326 3300005578 Ga0068854_101382413 Ga0068854_1013824132 86
327 3300005615 Ga0070702_100357140 Ga0070702_1003571401 86
328 3300005842 Ga0068858_101965497 Ga0068858_1019654972 86
329 3300006038 Ga0075365_10045989 Ga0075365_100459892 86
330 3300006038 Ga0075365_10056601 Ga0075365_100566012 86
331 3300006042 Ga0075368_10236372 Ga0075368_102363723 86
332 3300006048 Ga0075363_100013508 Ga0075363_1000135085 86
333 3300006177 Ga0075362_10030747 Ga0075362_100307472 86
334 3300006178 Ga0075367_10092397 Ga0075367_100923972 86
335 3300006178 Ga0075367_10124553 Ga0075367_101245531 86
336 3300006186 Ga0075369_10020997 Ga0075369_100209974 86
337 3300006186 Ga0075369_10028614 Ga0075369_100286145 86
338 3300006195 Ga0075366_10036818 Ga0075366_100368183 86
339 3300006353 Ga0075370_10000447 Ga0075370_100004478 86
340 3300006946 Ga0079104_1014054 Ga0079104_10140541 86
341 3300006946 Ga0079104_1041534 Ga0079104_10415344 86
342 3300006946 Ga0079104_1061103 Ga0079104_10611032 86
343 3300006948 Ga0099826_10462000 Ga0099826_104620002 86
344 3300009011 Ga0105251_10085116 Ga0105251_100851163 86
345 3300009092 Ga0105250_10468014 Ga0105250_104680142 86
346 3300009101 Ga0105247_11642167 Ga0105247_116421672 86
347 3300009148 Ga0105243_10321419 Ga0105243_103214193 86
348 3300009177 Ga0105248_10071986 Ga0105248_100719862 86
349 3300009551 Ga0105238_10091650 Ga0105238_100916502 86
350 3300009553 Ga0105249_10288239 Ga0105249_102882393 86
351 3300009553 Ga0105249_11038323 Ga0105249_110383233 86
352 3300009763 Ga0123340_1019400 Ga0123340_10194005 86
353 3300009765 Ga0123341_1000002 Ga0123341_100000287 86
354 3300009765 Ga0123341_1035449 Ga0123341_10354494 86
355 3300009766 Ga0123342_1026000 Ga0123342_10260003 86
356 3300010375 Ga0105239_10279656 Ga0105239_102796565 86
357 3300010375 Ga0105239_11935531 Ga0105239_119355312 86
358 3300010375 Ga0105239_12086157 Ga0105239_120861572 86
359 3300011119 Ga0105246_10630473 Ga0105246_106304732 86
360 3300013100 Ga0157373_10000942 Ga0157373_100009425 86
361 3300013100 Ga0157373_11244143 Ga0157373_112441432 86
362 3300013104 Ga0157370_10994742 Ga0157370_109947422 86
363 3300013105 Ga0157369_12582372 Ga0157369_125823721 86
364 3300013306 Ga0163162_10052858 Ga0163162_100528582 86
365 3300014325 Ga0163163_10709956 Ga0163163_107099563 86
366 3300014326 Ga0157380_11779406 Ga0157380_117794062 86
367 3300014497 Ga0182008_10094142 Ga0182008_100941422 86
368 3300015261 Ga0182006_1122088 Ga0182006_11220882 86
369 3300015262 Ga0182007_10147068 Ga0182007_101470682 86
370 3300015265 Ga0182005_1034416 Ga0182005_10344162 86
371 3300017792 Ga0163161_10105547 Ga0163161_101055472 86
372 3300021361 Ga0213872_10000092 Ga0213872_1000009252 86
373 3300022739 Ga0228711_1011003 Ga0228711_101100311 86
374 3300022739 Ga0228711_1028456 Ga0228711_10284562 86
375 3300022740 Ga0228710_1002177 Ga0228710_100217720 86
376 3300022740 Ga0228710_1023418 Ga0228710_10234181 86
377 3300025208 Ga0209436_103109 Ga0209436_1031093 86
378 3300025245 Ga0207425_1015667 Ga0207425_10156673 86
379 3300025245 Ga0207425_1031798 Ga0207425_10317981 86
380 3300025258 Ga0209129_1000353 Ga0209129_10003538 86
381 3300025273 Ga0209673_1000760 Ga0209673_100076029 86
382 3300025284 Ga0209130_1000154 Ga0209130_100015449 86
383 3300025284 Ga0209130_1000693 Ga0209130_10006934 86
384 3300025292 Ga0209676_1001353 Ga0209676_10013533 86
385 3300025294 Ga0209025_1000032 Ga0209025_1000032335 86
386 3300025294 Ga0209025_1000190 Ga0209025_100019084 86
387 3300025294 Ga0209025_1002324 Ga0209025_100232420 86
388 3300025295 Ga0209564_1000025 Ga0209564_1000025444 86
389 3300025295 Ga0209564_1002550 Ga0209564_100255011 86
390 3300025297 Ga0209758_1000245 Ga0209758_100024548 86
391 3300025297 Ga0209758_1005765 Ga0209758_100576510 86
392 3300025298 Ga0209050_1000198 Ga0209050_100019856 86
393 3300025298 Ga0209050_1005931 Ga0209050_10059313 86
394 3300025299 Ga0209256_1000907 Ga0209256_100090721 86
395 3300025299 Ga0209256_1001032 Ga0209256_10010329 86
396 3300025302 Ga0207426_1000080 Ga0207426_1000080176 86
397 3300025302 Ga0207426_1000109 Ga0207426_100010945 86
398 3300025302 Ga0207426_1000286 Ga0207426_100028649 86
399 3300025303 Ga0209051_1002477 Ga0209051_10024776 86
400 3300025303 Ga0209051_1006613 Ga0209051_10066137 86
401 3300025303 Ga0209051_1025986 Ga0209051_10259864 86
402 3300025304 Ga0209257_1006839 Ga0209257_10068393 86
403 3300025315 Ga0207697_10013575 Ga0207697_100135756 86
404 3300025321 Ga0207656_10673226 Ga0207656_106732261 86
405 3300025711 Ga0207696_1093091 Ga0207696_10930912 86
406 3300025735 Ga0207713_1136656 Ga0207713_11366561 86
407 3300025909 Ga0207705_10000826 Ga0207705_100008263 86
408 3300025912 Ga0207707_10658880 Ga0207707_106588802 86
409 3300025919 Ga0207657_10036215 Ga0207657_100362156 86
410 3300025924 Ga0207694_10115445 Ga0207694_101154452 86
411 3300025937 Ga0207669_10932702 Ga0207669_109327021 86
412 3300025941 Ga0207711_10029927 Ga0207711_100299276 86
413 3300025949 Ga0207667_10011900 Ga0207667_1001190013 86
414 3300025961 Ga0207712_10913469 Ga0207712_109134691 86
415 3300026035 Ga0207703_10000135 Ga0207703_100001354 86
416 3300026067 Ga0207678_10436639 Ga0207678_104366392 86
417 3300026067 Ga0207678_11602135 Ga0207678_116021352 86
418 3300026116 Ga0207674_10126223 Ga0207674_101262234 86
419 3300026116 Ga0207674_10588248 Ga0207674_105882482 86
420 3300027111 Ga0209281_1000793 Ga0209281_100079322 86
421 3300027111 Ga0209281_1010465 Ga0209281_10104653 86
422 3300027111 Ga0209281_1020573 Ga0209281_10205732 86
423 3300027666 Ga0209282_1000428 Ga0209282_100042822 86
424 3300027666 Ga0209282_1036358 Ga0209282_10363584 86
425 3300027666 Ga0209282_1049475 Ga0209282_10494754 86
426 3300028653 Ga0265323_10148236 Ga0265323_101482362 86
427 3300031235 Ga0265330_10039241 Ga0265330_100392413 86
428 3300031250 Ga0265331_10399743 Ga0265331_103997432 86
429 3300031251 Ga0265327_10193647 Ga0265327_101936472 86
430 3300031548 Ga0307408_101554921 Ga0307408_1015549211 86
431 3300031616 Ga0307508_10285438 Ga0307508_102854383 86
432 3300031730 Ga0307516_10292866 Ga0307516_102928661 86
433 3300031901 Ga0307406_11196469 Ga0307406_111964691 86
434 3300031903 Ga0307407_10512270 Ga0307407_105122702 86
435 3300031967 Ga0315914_1002657 Ga0315914_100265720 86
436 3300031967 Ga0315914_1033585 Ga0315914_10335851 86
437 3300031995 Ga0307409_102132773 Ga0307409_1021327731 86
438 3300032002 Ga0307416_101201828 Ga0307416_1012018281 86
439 3300032002 Ga0307416_102301260 Ga0307416_1023012601 86
440 3300032004 Ga0307414_11370519 Ga0307414_113705192 86
441 3300033430 Ga0315913_1001246 Ga0315913_100124620 86
442 3300033430 Ga0315913_1051423 Ga0315913_10514234 86
443 3300033464 Ga0315915_1001267 Ga0315915_100126719 86
444 3300033464 Ga0315915_1001646 Ga0315915_10016463 86
445 3300037418 Ga0395900_0147531 Ga0395900_0147531_1038_1325 86
446 3300037466 Ga0395898_0635369 Ga0395898_0635369_33_293 86
447 3300037471 Ga0395905_0034216 Ga0395905_0034216_3512_3772 86
448 3300037471 Ga0395905_0181134 Ga0395905_0181134_1053_1313 86
449 3300038443 Ga0395901_0046823 Ga0395901_0046823_3298_3585 86
450 3300039447 Ga0436361_0586967 Ga0436361_0586967_25222_25497 86
451 3300041453 Ga0451797_1461245 Ga0451797_1461245_143_403 86
452 3300041459 Ga0451800_0259518 Ga0451800_0259518_446_706 86
453 3300041491 Ga0451833_1408807 Ga0451833_1408807_3353_3625 86
454 3300041492 Ga0451835_0260446 Ga0451835_0260446_438_710 86
455 3300041494 Ga0451837_0249919 Ga0451837_0249919_376_657 86
456 3300041494 Ga0451837_0694308 Ga0451837_0694308_435_707 86
457 3300041496 Ga0451839_0027569 Ga0451839_0027569_708_989 86
458 3300041496 Ga0451839_0129601 Ga0451839_0129601_501_773 86
459 3300041497 Ga0451840_13009 Ga0451840_13009_279_539 86
460 3300041498 Ga0451841_1006338 Ga0451841_1006338_470_742 86
461 3300041498 Ga0451841_1272860 Ga0451841_1272860_1146_1427 86
462 3300041501 Ga0451845_0574853 Ga0451845_0574853_370_651 86
463 3300041501 Ga0451845_0608733 Ga0451845_0608733_2610_2882 86
464 3300041502 Ga0451846_29071 Ga0451846_29071_538_819 86
465 3300041503 Ga0451847_0210948 Ga0451847_0210948_581_853 86
466 3300041503 Ga0451847_0362927 Ga0451847_0362927_720_1001 86
467 3300041505 Ga0451849_0062759 Ga0451849_0062759_151_432 86
468 3300041505 Ga0451849_0388269 Ga0451849_0388269_552_824 86
469 3300041506 Ga0451850_20411 Ga0451850_20411_283_564 86
470 3300041507 Ga0451851_0161468 Ga0451851_0161468_511_792 86
471 3300041507 Ga0451851_0611608 Ga0451851_0611608_839_1111 86
472 3300041509 Ga0451843_0388296 Ga0451843_0388296_510_791 86
473 3300041509 Ga0451843_1376257 Ga0451843_1376257_566_838 86
474 3300041510 Ga0451854_15176 Ga0451854_15176_108_380 86
475 3300041510 Ga0451854_24022 Ga0451854_24022_241_501 86
476 3300041511 Ga0451855_0881404 Ga0451855_0881404_144_425 86
477 3300041511 Ga0451855_1865224 Ga0451855_1865224_501_773 86
478 3300041511 Ga0451855_2004194 Ga0451855_2004194_105_386 86
479 3300041512 Ga0451853_1108787 Ga0451853_1108787_619_903 86
480 3300041512 Ga0451853_1204410 Ga0451853_1204410_1084_1365 86
481 3300041512 Ga0451853_3158512 Ga0451853_3158512_660_932 86
482 3300041907 Ga0452268_42669 Ga0452268_42669_100_381 86
483 3300042007 Ga0439449_0141793 Ga0439449_0141793_17_277 86
484 3300042016 Ga0439463_000146 Ga0439463_000146_1042_1305 86
485 3300042146 Ga0450907_040166 Ga0450907_040166_359_619 86
486 3300042876 Ga0451577_0044566 Ga0451577_0044566_1617_1880 86
487 3300042993 Ga0439440_0018378 Ga0439440_0018378_782_1045 86
488 3300044673 Ga0453683_0054339 Ga0453683_0054339_230_493 86
489 3300044712 Ga0453684_0308237 Ga0453684_0308237_685_948 86
490 3300045051 Ga0451576_0002517 Ga0451576_0002517_15409_15672 86
491 3300046452 Ga0495617_056781 Ga0495617_056781_619_882 86
492 3300046452 Ga0495617_130071 Ga0495617_130071_402_683 86
493 3300046453 Ga0495627_004714 Ga0495627_004714_648_920 86
494 3300046455 Ga0495603_0003848 Ga0495603_0003848_7881_8144 86
495 3300046458 Ga0495591_007611 Ga0495591_007611_118_390 86
496 3300046459 Ga0495629_0009186 Ga0495629_0009186_3934_4215 86
497 3300046460 Ga0495638_0137940 Ga0495638_0137940_262_525 86
498 3300046460 Ga0495638_0241785 Ga0495638_0241785_454_735 86
499 3300046460 Ga0495638_0606113 Ga0495638_0606113_154_429 86
500 3300046463 Ga0495653_0056409 Ga0495653_0056409_1749_2030 86
501 3300046473 Ga0495582_0068441 Ga0495582_0068441_1109_1390 86
502 3300046474 Ga0495605_0000008 Ga0495605_0000008_247087_247359 86
503 3300046474 Ga0495605_0268874 Ga0495605_0268874_214_495 86
504 3300046492 Ga0495585_0028370 Ga0495585_0028370_1740_2021 86
505 3300046499 Ga0495594_0001037 Ga0495594_0001037_1254_1526 86
506 3300046499 Ga0495594_0498016 Ga0495594_0498016_184_447 86
507 3300046499 Ga0495594_0771653 Ga0495594_0771653_182_463 86
508 3300046500 Ga0495596_0077453 Ga0495596_0077453_878_1159 86
509 3300046501 Ga0495607_0051428 Ga0495607_0051428_615_887 86
510 3300046501 Ga0495607_0090872 Ga0495607_0090872_901_1182 86
511 3300046506 Ga0495583_0000039 Ga0495583_0000039_98596_98868 86
512 3300046506 Ga0495583_0343779 Ga0495583_0343779_303_563 86
513 3300046512 Ga0495610_0017957 Ga0495610_0017957_3109_3381 86
514 3300046512 Ga0495610_0030102 Ga0495610_0030102_1201_1482 86
515 3300046515 Ga0495620_0000031 Ga0495620_0000031_119527_119799 86
516 3300046515 Ga0495620_0016725 Ga0495620_0016725_688_948 86
517 3300046515 Ga0495620_0080934 Ga0495620_0080934_12_293 86
518 3300046517 Ga0495630_0152408 Ga0495630_0152408_567_830 86
519 3300046518 Ga0495631_0000777 Ga0495631_0000777_11589_11861 86
520 3300046518 Ga0495631_0211270 Ga0495631_0211270_53_334 86
521 3300046519 Ga0495632_0276030 Ga0495632_0276030_132_413 86
522 3300046520 Ga0495637_0006053 Ga0495637_0006053_2181_2453 86
523 3300046524 Ga0495648_0004346 Ga0495648_0004346_3421_3693 86
524 3300046524 Ga0495648_0055864 Ga0495648_0055864_214_495 86
525 3300046525 Ga0495663_0137431 Ga0495663_0137431_53_334 86
526 3300046526 Ga0495666_0144296 Ga0495666_0144296_614_895 86
527 3300046530 Ga0495654_0000220 Ga0495654_0000220_28413_28685 86
528 3300046531 Ga0495665_0141447 Ga0495665_0141447_725_1006 86
529 3300046535 Ga0495586_0098184 Ga0495586_0098184_853_1134 86
530 3300046538 Ga0495609_0000031 Ga0495609_0000031_76133_76405 86
531 3300046538 Ga0495609_0131783 Ga0495609_0131783_676_957 86
532 3300046542 Ga0495597_0002062 Ga0495597_0002062_3310_3582 86
533 3300046557 Ga0495622_0157223 Ga0495622_0157223_434_715 86
534 3300046557 Ga0495622_0178323 Ga0495622_0178323_486_749 86
535 3300046558 Ga0495633_0000011 Ga0495633_0000011_169508_169780 86
536 3300046558 Ga0495633_0046855 Ga0495633_0046855_763_1044 86
537 3300046615 Ga0495656_0106141 Ga0495656_0106141_450_731 86
538 3300046648 Ga0495611_0119267 Ga0495611_0119267_592_873 86
539 3300046660 Ga0495625_0089163 Ga0495625_0089163_1223_1504 86
540 3300046660 Ga0495625_0353108 Ga0495625_0353108_388_663 86
541 3300046663 Ga0495635_0703520 Ga0495635_0703520_120_383 86
542 3300046664 Ga0495659_0111815 Ga0495659_0111815_505_789 86
543 3300046665 Ga0495661_0000021 Ga0495661_0000021_45957_46229 86
544 3300046665 Ga0495661_0012708 Ga0495661_0012708_4774_5058 86
545 3300046665 Ga0495661_0239702 Ga0495661_0239702_155_436 86
546 3300046674 Ga0495588_0100252 Ga0495588_0100252_221_484 86
547 3300046674 Ga0495588_0267631 Ga0495588_0267631_167_448 86
548 3300046679 Ga0495623_0165594 Ga0495623_0165594_252_533 86
549 3300046691 Ga0495670_0005064 Ga0495670_0005064_618_902 86
550 3300046691 Ga0495670_0091586 Ga0495670_0091586_715_987 86
551 3300046692 Ga0495671_0031513 Ga0495671_0031513_1059_1340 86
552 3300046692 Ga0495671_0116824 Ga0495671_0116824_910_1182 86
553 3300046794 Ga0495589_0000960 Ga0495589_0000960_16343_16615 86
554 3300046810 Ga0495660_0003828 Ga0495660_0003828_8205_8477 86
555 3300046810 Ga0495660_0062179 Ga0495660_0062179_537_818 86
556 3300047315 Ga0495581_0073340 Ga0495581_0073340_257_538 86
557 3300047317 Ga0495604_0280978 Ga0495604_0280978_252_533 86
558 3300047322 Ga0495680_0025822 Ga0495680_0025822_4023_4286 86
559 3300047323 Ga0495683_0000008 Ga0495683_0000008_30609_30881 86
560 3300047444 Ga0495675_0229222 Ga0495675_0229222_252_533 86
561 3300047446 Ga0495679_000043 Ga0495679_000043_51362_51634 86
562 3300047469 Ga0495673_0010228 Ga0495673_0010228_4314_4577 86
563 3300047469 Ga0495673_0013902 Ga0495673_0013902_1841_2113 86
564 3300047469 Ga0495673_0056525 Ga0495673_0056525_955_1218 86
565 3300047470 Ga0495681_0013081 Ga0495681_0013081_3171_3443 86
566 3300047472 Ga0495686_0580656 Ga0495686_0580656_204_485 86
567 3300047673 Ga0495593_0037870 Ga0495593_0037870_1779_2042 86
568 3300047673 Ga0495593_0099820 Ga0495593_0099820_531_812 86
569 3300047673 Ga0495593_0298564 Ga0495593_0298564_70_333 86
570 3300048088 Ga0495602_0265504 Ga0495602_0265504_789_1070 86
571 3300048090 Ga0495615_0020389 Ga0495615_0020389_184_465 86
572 3300048905 Ga0496102_1007396 Ga0496102_1007396_227_502 86
573 3300048906 Ga0496103_0051249 Ga0496103_0051249_1168_1443 86
574 3300048914 Ga0496111_0117532 Ga0496111_0117532_1227_1502 86
575 3300048922 Ga0496119_0004966 Ga0496119_0004966_8027_8287 86
576 3300048922 Ga0496119_0132408 Ga0496119_0132408_147_434 86
577 3300048923 Ga0496120_0002140 Ga0496120_0002140_16073_16333 86
578 3300048924 Ga0496121_0880723 Ga0496121_0880723_128_415 86
579 3300048925 Ga0496122_0019922 Ga0496122_0019922_3264_3536 86
580 3300048926 Ga0496123_0033071 Ga0496123_0033071_1363_1635 86
581 3300048927 Ga0496124_0000136 Ga0496124_0000136_95581_95841 86
582 3300048929 Ga0496126_0094727 Ga0496126_0094727_2090_2377 86
583 3300049459 Ga0495678_000018 Ga0495678_000018_180808_181080 86
584 3300049460 Ga0495682_0053960 Ga0495682_0053960_369_632 86
585 3300049569 Ga0501032_0007461 Ga0501032_0007461_5433_5693 86
586 3300049570 Ga0501033_0007287 Ga0501033_0007287_5444_5704 86
587 3300049571 Ga0501034_0051624 Ga0501034_0051624_959_1219 86
588 3300049572 Ga0501036_0302017 Ga0501036_0302017_48_308 86
589 3300049572 Ga0501036_1118636 Ga0501036_1118636_67_336 86
590 3300049573 Ga0501037_0000271 Ga0501037_0000271_16785_17045 86
591 3300049574 Ga0501038_0064624 Ga0501038_0064624_2342_2602 86
592 3300049574 Ga0501038_0209249 Ga0501038_0209249_610_879 86
593 3300049579 Ga0501043_0000096 Ga0501043_0000096_27934_28194 86
594 3300049581 Ga0501047_0042223 Ga0501047_0042223_3894_4163 86
595 3300049583 Ga0501067_0219361 Ga0501067_0219361_502_762 86
596 3300049584 Ga0501068_0098652 Ga0501068_0098652_817_1086 86
597 3300049585 Ga0501069_0000012 Ga0501069_0000012_51671_51931 86
598 3300049585 Ga0501069_0330350 Ga0501069_0330350_384_644 86
599 3300049586 Ga0501070_0000655 Ga0501070_0000655_24013_24273 86
600 3300049586 Ga0501070_0700288 Ga0501070_0700288_383_643 86
601 3300049586 Ga0501070_0740109 Ga0501070_0740109_318_605 86
602 3300049587 Ga0501071_0005903 Ga0501071_0005903_4364_4624 86
603 3300049589 Ga0501073_0032760 Ga0501073_0032760_1556_1825 86
604 3300049589 Ga0501073_0040779 Ga0501073_0040779_2999_3259 86
605 3300049590 Ga0501074_0000018 Ga0501074_0000018_51672_51932 86
606 3300049741 Ga0501079_0492224 Ga0501079_0492224_463_723 86
607 3300049742 Ga0501080_0000558 Ga0501080_0000558_24891_25151 86
608 3300049742 Ga0501080_0179492 Ga0501080_0179492_834_1103 86
609 3300049744 Ga0501083_0001735 Ga0501083_0001735_9658_9918 86
610 3300049744 Ga0501083_0023392 Ga0501083_0023392_3312_3581 86
611 3300049744 Ga0501083_0656132 Ga0501083_0656132_398_658 86
612 3300049822 Ga0501035_0000039 Ga0501035_0000039_104810_105070 86
613 3300049822 Ga0501035_0284114 Ga0501035_0284114_177_446 86
614 3300049823 Ga0501044_0000047 Ga0501044_0000047_51834_52094 86
615 3300049823 Ga0501044_0128708 Ga0501044_0128708_1325_1594 86
616 3300050489 nmdc:mga03683_14190_c1 nmdc:mga03683_14190_c1_613_894 86
617 3300050489 nmdc:mga03683_241847_c1 nmdc:mga03683_241847_c1_170_430 86
618 3300050490 nmdc:mga03n38_145764_c1 nmdc:mga03n38_145764_c1_500_781 86
619 3300050492 nmdc:mga0yw44_20701_c1 nmdc:mga0yw44_20701_c1_530_811 86
620 3300050492 nmdc:mga0yw44_742445_c1 nmdc:mga0yw44_742445_c1_359_619 86
621 3300050493 nmdc:mga0k408_75843_c1 nmdc:mga0k408_75843_c1_1240_1521 86
622 3300050494 nmdc:mga06z11_17124_c1 nmdc:mga06z11_17124_c1_1300_1581 86
623 3300050496 nmdc:mga07m45_42347_c1 nmdc:mga07m45_42347_c1_972_1253 86
624 3300050516 nmdc:mga0sz30_156624_c1 nmdc:mga0sz30_156624_c1_28_288 86
625 3300053086 Ga0500578_0000006 Ga0500578_0000006_180651_180911 86
626 3300053086 Ga0500578_0231244 Ga0500578_0231244_274_555 86
627 3300053091 Ga0500647_0008252 Ga0500647_0008252_519_779 86
628 3300053093 Ga0500651_0000540 Ga0500651_0000540_5168_5449 86
629 3300053093 Ga0500651_0156541 Ga0500651_0156541_1057_1317 86
630 3300053098 Ga0500650_0521262 Ga0500650_0521262_153_413 86
631 3300053131 Ga0500652_252580 Ga0500652_252580_135_395 86
632 3300053133 Ga0500655_019605 Ga0500655_019605_169_429 86
633 3300053134 Ga0500658_0191510 Ga0500658_0191510_542_823 86
634 3300053136 Ga0500559_0031959 Ga0500559_0031959_1672_1932 86
635 3300053139 Ga0500568_0080450 Ga0500568_0080450_448_708 86
636 3300053142 Ga0500577_0080469 Ga0500577_0080469_663_944 86
637 3300053146 Ga0500588_0121210 Ga0500588_0121210_300_581 86
638 3300053151 Ga0500604_0144138 Ga0500604_0144138_438_698 86
639 3300053153 Ga0500616_0054994 Ga0500616_0054994_154_414 86
640 3300053155 Ga0500620_000230 Ga0500620_000230_7950_8237 86
641 3300053158 Ga0500627_0098728 Ga0500627_0098728_844_1104 86
642 3300053161 Ga0500634_0018089 Ga0500634_0018089_615_884 86
643 3300053161 Ga0500634_0053506 Ga0500634_0053506_1375_1638 86
644 3300060353 Ga0501082_0059465 Ga0501082_0059465_167_427 86
645 3300060353 Ga0501082_0153549 Ga0501082_0153549_343_612 86
646 iso_pu_bacteria 2957498199 2957504739 86
647 iso_pu_bacteria 2965032056 2965035617 86

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01402

RHH_1

Ribbon-helix-helix protein, copG family

5

43

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x3t-assembly1.cif.gz_E vapbc from mycobacterium tuberculosis 0.8144 3 39
6iya-assembly2.cif.gz_C structure of the dna binding domain of antitoxin copaso 0.8102 4 47
5x3t-assembly1.cif.gz_C vapbc from mycobacterium tuberculosis 0.8072 3 41
5x3t-assembly1.cif.gz_G vapbc from mycobacterium tuberculosis 0.8057 3 42
6iya-assembly4.cif.gz_F-2 structure of the dna binding domain of antitoxin copaso 0.7898 2 49
ID Description Score Start End Superfamily
af_Q4DDS4_1_596_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8845 11 39 3.40.50.720
3omyA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;TraM protein, DNA-binding 0.8112 4 47 1.10.10.450
1qtgB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.8107 11 46 1.10.1220.10
af_F7ES73_1_68_1.20.930.10 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.7929 9 32 1.20.930.10
3ft7B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.7836 2 44 1.10.1220.10
ID Description Score Start End GO Terms
AF-A0A0X8HAT9-F1-model_v4 Ribbon-helix-helix protein CopG domain-containing protein 0.8846 7 86 GO:0006355
AF-A0A5R8QQ84-F1-model_v4 deleted 0.8843 8 86
AF-A0A5R8QQ84-F1-model_v4 deleted 0.8743 8 86
AF-A0A6A7Z0R5-F1-model_v4 Ribbon-helix-helix protein, CopG family 0.869 1 86 GO:0006355
AF-K2PB00-F1-model_v4 Ribbon-helix-helix protein CopG domain-containing protein 0.8665 3 86

Feature Viewer

pLDDT pTM Quality
94.15 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map