F472311

General Info

Members Datasets Scaffolds Average Seq Length
647 351 1294 269

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0053646|Ga0495638_0053646_693_1637
Length 314
Sequence MPTRSERAEPTSGIHRLDDAYATSVRSVHRLRVRYRSDASGSGRLGVNTDTVRAVGYDDDLRLAHVIADQVDAVTIARFTAVDLLVETKPDLTPVTDADRAAEELIRSQLRRTRPRDAVLGEEFGSSGRGSRQWIVDPIDGTKNFVRGVPVWATLIALVDDGVPVIGLVSAPALGRRWWAATGTGAWTGRSLSSARRLRVSAVEKLADASLSYASFRGWEDLDKGEAFLQLTRTVWRSRAYGDFWSYMLLAEGAVDLACEPELQLYDMAALVPIVVEAGGRFSSLAGVDGPFGGNAVASNGLLHSQLLSALNPG

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
93 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
158 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
159 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
172 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
173 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
174 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
175 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
176 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
177 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
178 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
179 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
180 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
181 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
182 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
183 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
184 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
185 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
186 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
187 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
188 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
189 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
190 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
191 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
192 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
196 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
197 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
198 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
218 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
219 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
229 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
256 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
257 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
283 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
284 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
285 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
286 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
287 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
288 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
289 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
290 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
292 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
293 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
294 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
295 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
296 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
297 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
298 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
299 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
300 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
301 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
302 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
303 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
304 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
305 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
306 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
307 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
308 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
309 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
310 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
311 2808606394 Promicromonospora sp. C35 Isolate Unclassified
312 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
313 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
314 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
315 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
316 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
317 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
318 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
319 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
320 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
321 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
322 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
323 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
324 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
325 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
326 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
327 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
328 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
329 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
330 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
331 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
332 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
333 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
334 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
335 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
336 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
337 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
338 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
339 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
340 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
341 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
342 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
343 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
344 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
345 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
346 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
347 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
348 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
349 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
350 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
351 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.73
Metatranscriptomes 0.31
Isolates 8.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.47
Nodule 0
Rhizoplane 10.97
Rhizosphere 78.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0053646 3300046460 Bacteria 2509
2 JGI24738J21930_10000450 3300002075 Bacteria 11641
3 JGI25152J39213_1000085 3300002773 Bacteria 64570
4 JGI25406J46586_10008596 3300003203 Bacteria 4613
5 JGI25406J46586_10023330 3300003203 Bacteria 2446
6 JGI25406J46586_10068618 3300003203 Bacteria 1119
7 JGI25406J46586_10076236 3300003203 Bacteria 1038
8 Ga0055542_1011376 3300003762 Bacteria 1581
9 Ga0070658_10004438 3300005327 Bacteria 11426
10 Ga0070683_100001033 3300005329 Bacteria 20895
11 Ga0070683_100044638 3300005329 Bacteria 4088
12 Ga0070683_100685071 3300005329 Bacteria 981
13 Ga0068869_100097444 3300005334 Bacteria 2220
14 Ga0070666_10135291 3300005335 Bacteria 1714
15 Ga0070680_100039261 3300005336 Bacteria 3832
16 Ga0068868_100003308 3300005338 Bacteria 11213
17 Ga0070660_100059713 3300005339 Bacteria 2957
18 Ga0070660_100166771 3300005339 Bacteria 1777
19 Ga0070689_100016236 3300005340 Bacteria 5445
20 Ga0070691_10113254 3300005341 Bacteria 1359
21 Ga0070661_100036378 3300005344 Bacteria 3579
22 Ga0070661_100261064 3300005344 Bacteria 1339
23 Ga0070661_100337820 3300005344 Bacteria 1179
24 Ga0070692_10024631 3300005345 Bacteria 2959
25 Ga0070668_100006985 3300005347 Bacteria 8363
26 Ga0070668_100029643 3300005347 Bacteria 4157
27 Ga0070675_100001082 3300005354 Bacteria 19671
28 Ga0070675_100455555 3300005354 Bacteria 1148
29 Ga0070674_100214211 3300005356 Bacteria 1495
30 Ga0070673_100116914 3300005364 Bacteria 2219
31 Ga0070688_100331393 3300005365 Bacteria 1109
32 Ga0070659_100010924 3300005366 Bacteria 6700
33 Ga0070659_100033946 3300005366 Bacteria 3967
34 Ga0070659_100055569 3300005366 Bacteria 3121
35 Ga0070709_10032356 3300005434 Bacteria 3153
36 Ga0070709_10035005 3300005434 Bacteria 3049
37 Ga0070714_100004918 3300005435 Bacteria 10152
38 Ga0070714_100024008 3300005435 Bacteria 5015
39 Ga0070714_100046143 3300005435 Bacteria 3695
40 Ga0070710_10146029 3300005437 Bacteria 1455
41 Ga0070710_10193457 3300005437 Bacteria 1280
42 Ga0070711_100348180 3300005439 Bacteria 1191
43 Ga0070700_100108546 3300005441 Bacteria 1841
44 Ga0070694_100076828 3300005444 Bacteria 2312
45 Ga0070663_100003520 3300005455 Bacteria 9035
46 Ga0070678_100028268 3300005456 Bacteria 3822
47 Ga0070662_100003771 3300005457 Bacteria 9482
48 Ga0070662_100152724 3300005457 Bacteria 1799
49 Ga0070679_100074126 3300005530 Bacteria 3394
50 Ga0070684_100026059 3300005535 Bacteria 4921
51 Ga0068853_100017947 3300005539 Bacteria 5847
52 Ga0070672_100077887 3300005543 Bacteria 2652
53 Ga0070672_100287393 3300005543 Bacteria 1392
54 Ga0070696_100052375 3300005546 Bacteria 2839
55 Ga0070665_100053866 3300005548 Bacteria 4035
56 Ga0070665_100066602 3300005548 Bacteria 3613
57 Ga0070704_100099269 3300005549 Bacteria 2189
58 Ga0068855_100008907 3300005563 Bacteria 12130
59 Ga0070664_100012825 3300005564 Bacteria 6818
60 Ga0070664_100155914 3300005564 Bacteria 2018
61 Ga0070664_100218772 3300005564 Bacteria 1704
62 Ga0070664_100361638 3300005564 Bacteria 1322
63 Ga0068857_100094322 3300005577 Bacteria 2680
64 Ga0068857_100412126 3300005577 Bacteria 1259
65 Ga0068854_100124683 3300005578 Bacteria 1960
66 Ga0070702_100008289 3300005615 Bacteria 5023
67 Ga0070702_100019479 3300005615 Bacteria 3541
68 Ga0068864_100003965 3300005618 Bacteria 12187
69 Ga0068864_100062750 3300005618 Bacteria 3220
70 Ga0068864_100157740 3300005618 Bacteria 2061
71 Ga0068861_100032585 3300005719 Bacteria 3837
72 Ga0068861_100316907 3300005719 Bacteria 1357
73 Ga0068870_10069117 3300005840 Bacteria 1921
74 Ga0068863_100115346 3300005841 Bacteria 2559
75 Ga0068863_100145002 3300005841 Bacteria 2270
76 Ga0068858_100092207 3300005842 Bacteria 2819
77 Ga0068860_100058251 3300005843 Bacteria 3672
78 Ga0068862_100045932 3300005844 Bacteria 3728
79 Ga0081455_10137995 3300005937 Bacteria 1897
80 Ga0081540_1016528 3300005983 Bacteria 4611
81 Ga0081540_1027777 3300005983 Bacteria 3196
82 Ga0081539_10000270 3300005985 Bacteria 118964
83 Ga0081539_10002008 3300005985 Bacteria 30810
84 Ga0070717_10012134 3300006028 Bacteria 6568
85 Ga0070717_10271943 3300006028 Bacteria 1501
86 Ga0075363_100215016 3300006048 Bacteria 1101
87 Ga0075432_10012200 3300006058 Bacteria 2921
88 Ga0075432_10016860 3300006058 Bacteria 2493
89 Ga0075428_100005782 3300006844 Bacteria 13728
90 Ga0075428_100216708 3300006844 Bacteria 2068
91 Ga0075430_100250512 3300006846 Bacteria 1468
92 Ga0075431_100006877 3300006847 Bacteria 11301
93 Ga0075431_100020526 3300006847 Bacteria 6750
94 Ga0075433_10044048 3300006852 Bacteria 3876
95 Ga0075429_100000306 3300006880 Bacteria 34715
96 Ga0075436_100031561 3300006914 Bacteria 3648
97 Ga0105244_10003153 3300009036 Bacteria 11984
98 Ga0105244_10029317 3300009036 Bacteria 2943
99 Ga0105244_10040733 3300009036 Bacteria 2410
100 Ga0105244_10099123 3300009036 Bacteria 1427
101 Ga0111539_10005398 3300009094 Bacteria 16536
102 Ga0111539_10134871 3300009094 Bacteria 2891
103 Ga0111539_10539967 3300009094 Bacteria 1358
104 Ga0111539_10565697 3300009094 Bacteria 1324
105 Ga0105245_10006496 3300009098 Bacteria 10276
106 Ga0105245_10006809 3300009098 Bacteria 10025
107 Ga0105245_10175768 3300009098 Bacteria 2042
108 Ga0105245_10227602 3300009098 Bacteria 1802
109 Ga0105247_10014241 3300009101 Bacteria 4772
110 Ga0114129_10130159 3300009147 Bacteria 3457
111 Ga0114129_10186215 3300009147 Bacteria 2821
112 Ga0114129_10243668 3300009147 Bacteria 2416
113 Ga0105243_10006336 3300009148 Bacteria 9139
114 Ga0105243_10058605 3300009148 Bacteria 3069
115 Ga0105243_10071311 3300009148 Bacteria 2809
116 Ga0105241_10200520 3300009174 Bacteria 1666
117 Ga0105242_10177582 3300009176 Bacteria 1876
118 Ga0105248_10161701 3300009177 Bacteria 2525
119 Ga0105248_10391040 3300009177 Bacteria 1566
120 Ga0105248_10438570 3300009177 Bacteria 1471
121 Ga0105248_10914644 3300009177 Bacteria 991
122 Ga0105238_10026906 3300009551 Bacteria 5862
123 Ga0105238_10242563 3300009551 Bacteria 1780
124 Ga0105249_10004106 3300009553 Bacteria 12571
125 Ga0105249_10096861 3300009553 Bacteria 2769
126 Ga0105249_10236971 3300009553 Bacteria 1802
127 Ga0105239_10185856 3300010375 Bacteria 2325
128 Ga0105239_10512879 3300010375 Bacteria 1364
129 Ga0105246_10002983 3300011119 Bacteria 10253
130 Ga0105246_10003045 3300011119 Bacteria 10171
131 Ga0105246_10010929 3300011119 Bacteria 5629
132 Ga0105246_10228077 3300011119 Bacteria 1465
133 Ga0105246_10302779 3300011119 Bacteria 1291
134 Ga0157373_10010255 3300013100 Bacteria 6901
135 Ga0157371_10136640 3300013102 Bacteria 1746
136 Ga0157370_10012783 3300013104 Bacteria 8681
137 Ga0157370_10061215 3300013104 Bacteria 3573
138 Ga0157369_10055355 3300013105 Bacteria 4282
139 Ga0157369_10221237 3300013105 Bacteria 1982
140 Ga0157374_10145930 3300013296 Bacteria 2298
141 Ga0163162_10014986 3300013306 Bacteria 7573
142 Ga0163162_10215334 3300013306 Bacteria 2051
143 Ga0163162_10293831 3300013306 Bacteria 1756
144 Ga0157375_10069034 3300013308 Bacteria 3539
145 Ga0157375_10286346 3300013308 Bacteria 1811
146 Ga0157375_10331769 3300013308 Bacteria 1686
147 Ga0157375_10338841 3300013308 Bacteria 1669
148 Ga0163163_10003868 3300014325 Bacteria 12755
149 Ga0163163_10061583 3300014325 Bacteria 3718
150 Ga0163163_10280530 3300014325 Bacteria 1717
151 Ga0163163_10885180 3300014325 Bacteria 956
152 Ga0157380_10015064 3300014326 Bacteria 5673
153 Ga0157377_10047177 3300014745 Bacteria 2412
154 Ga0157379_10006318 3300014968 Bacteria 10205
155 Ga0157376_10093261 3300014969 Bacteria 2613
156 Ga0163161_10007540 3300017792 Bacteria 7521
157 Ga0163161_10244875 3300017792 Bacteria 1396
158 Ga0197907_11498807 3300020069 Bacteria 1265
159 Ga0206353_11891345 3300020082 Bacteria 2362
160 Ga0209148_1000960 3300025254 Bacteria 18779
161 Ga0209759_1013922 3300025256 Bacteria 2152
162 Ga0209129_1000028 3300025258 Bacteria 405451
163 Ga0209025_1000112 3300025294 Bacteria 218958
164 Ga0209051_1001385 3300025303 Bacteria 20899
165 Ga0207655_1018358 3300025728 Bacteria 3714
166 Ga0207655_1019425 3300025728 Bacteria 3551
167 Ga0207692_10012152 3300025898 Bacteria 3690
168 Ga0207692_10108219 3300025898 Bacteria 1538
169 Ga0207688_10000688 3300025901 Bacteria 16687
170 Ga0207688_10089894 3300025901 Bacteria 1762
171 Ga0207699_10052375 3300025906 Bacteria 2415
172 Ga0207705_10050963 3300025909 Bacteria 2980
173 Ga0207707_10153314 3300025912 Bacteria 2014
174 Ga0207695_10352965 3300025913 Bacteria 1357
175 Ga0207693_10000849 3300025915 Bacteria 27274
176 Ga0207663_10031587 3300025916 Bacteria 3136
177 Ga0207660_10129646 3300025917 Bacteria 1918
178 Ga0207662_10017857 3300025918 Bacteria 4017
179 Ga0207657_10034108 3300025919 Bacteria 4581
180 Ga0207649_10029038 3300025920 Bacteria 3263
181 Ga0207652_10202346 3300025921 Bacteria 1787
182 Ga0207694_10013151 3300025924 Bacteria 6232
183 Ga0207659_10003231 3300025926 Bacteria 9748
184 Ga0207687_10039765 3300025927 Bacteria 3221
185 Ga0207687_10414229 3300025927 Bacteria 1111
186 Ga0207664_10056087 3300025929 Bacteria 3128
187 Ga0207664_10102716 3300025929 Bacteria 2364
188 Ga0207664_10170288 3300025929 Bacteria 1863
189 Ga0207644_10169250 3300025931 Bacteria 1704
190 Ga0207690_10009814 3300025932 Bacteria 5689
191 Ga0207690_10021645 3300025932 Bacteria 3990
192 Ga0207690_10237799 3300025932 Bacteria 1401
193 Ga0207706_10041949 3300025933 Bacteria 4055
194 Ga0207706_10097572 3300025933 Bacteria 2585
195 Ga0207709_10040032 3300025935 Bacteria 2804
196 Ga0207670_10203235 3300025936 Bacteria 1506
197 Ga0207669_10205564 3300025937 Bacteria 1433
198 Ga0207665_10004230 3300025939 Bacteria 9556
199 Ga0207691_10136291 3300025940 Bacteria 2165
200 Ga0207711_10397180 3300025941 Bacteria 1281
201 Ga0207689_10004145 3300025942 Bacteria 13177
202 Ga0207689_10019332 3300025942 Bacteria 5742
203 Ga0207661_10018763 3300025944 Bacteria 5144
204 Ga0207661_10105806 3300025944 Bacteria 2371
205 Ga0207679_10012516 3300025945 Bacteria 5533
206 Ga0207679_10048775 3300025945 Bacteria 3085
207 Ga0207679_10208853 3300025945 Bacteria 1636
208 Ga0207667_10013323 3300025949 Bacteria 9417
209 Ga0207712_10137258 3300025961 Bacteria 1872
210 Ga0207640_10050138 3300025981 Bacteria 2707
211 Ga0207640_10118740 3300025981 Bacteria 1890
212 Ga0207677_10003998 3300026023 Bacteria 7864
213 Ga0207703_10242406 3300026035 Bacteria 1621
214 Ga0207678_10003736 3300026067 Bacteria 13694
215 Ga0207678_10088692 3300026067 Bacteria 2643
216 Ga0207678_10313294 3300026067 Bacteria 1349
217 Ga0207708_10016115 3300026075 Bacteria 5614
218 Ga0207641_10012947 3300026088 Bacteria 6843
219 Ga0207676_10112351 3300026095 Bacteria 2282
220 Ga0207676_10119344 3300026095 Bacteria 2221
221 Ga0207676_10376637 3300026095 Bacteria 1320
222 Ga0207674_10038684 3300026116 Bacteria 4947
223 Ga0207674_10160603 3300026116 Bacteria 2202
224 Ga0207674_10551643 3300026116 Bacteria 1113
225 Ga0207675_100084196 3300026118 Bacteria 2984
226 Ga0207683_10052463 3300026121 Bacteria 3573
227 Ga0207683_10243065 3300026121 Bacteria 1642
228 Ga0207428_10019442 3300027907 Bacteria 5790
229 Ga0207428_10026047 3300027907 Bacteria 4886
230 Ga0207428_10035454 3300027907 Bacteria 4078
231 Ga0268266_10087083 3300028379 Bacteria 2732
232 Ga0268265_10013250 3300028380 Bacteria 5603
233 Ga0307515_10000065 3300028794 Bacteria 244497
234 Ga0307515_10065068 3300028794 Bacteria 5084
235 Ga0307515_10203618 3300028794 Bacteria 1847
236 Ga0307515_10456181 3300028794 Bacteria 893
237 Ga0265340_10012498 3300031247 Bacteria 4482
238 Ga0307513_10000149 3300031456 Bacteria 99930
239 Ga0307513_10199099 3300031456 Bacteria 1846
240 Ga0307408_100018562 3300031548 Bacteria 4671
241 Ga0307408_100019897 3300031548 Bacteria 4522
242 Ga0307408_100045798 3300031548 Bacteria 3126
243 Ga0307408_100061342 3300031548 Bacteria 2745
244 Ga0307408_100075093 3300031548 Bacteria 2510
245 Ga0307408_100106264 3300031548 Bacteria 2147
246 Ga0307408_100172426 3300031548 Bacteria 1728
247 Ga0307408_100230501 3300031548 Bacteria 1516
248 Ga0307408_100558485 3300031548 Bacteria 1011
249 Ga0307408_100620005 3300031548 Bacteria 963
250 Ga0307508_10000654 3300031616 Bacteria 41574
251 Ga0307405_10021502 3300031731 Bacteria 3629
252 Ga0307405_10031079 3300031731 Bacteria 3139
253 Ga0307405_10086777 3300031731 Bacteria 2060
254 Ga0307405_10125656 3300031731 Bacteria 1763
255 Ga0307405_10136053 3300031731 Bacteria 1706
256 Ga0307405_10165624 3300031731 Bacteria 1571
257 Ga0307405_10255154 3300031731 Bacteria 1307
258 Ga0307405_10262707 3300031731 Bacteria 1290
259 Ga0307413_10007182 3300031824 Bacteria 5152
260 Ga0307413_10016711 3300031824 Bacteria 3800
261 Ga0307413_10029131 3300031824 Bacteria 3085
262 Ga0307413_10029766 3300031824 Bacteria 3060
263 Ga0307413_10185092 3300031824 Bacteria 1489
264 Ga0307413_10268356 3300031824 Bacteria 1276
265 Ga0307413_10447525 3300031824 Bacteria 1024
266 Ga0307413_10454773 3300031824 Bacteria 1017
267 Ga0307410_10002891 3300031852 Bacteria 8455
268 Ga0307410_10020949 3300031852 Bacteria 4012
269 Ga0307410_10031877 3300031852 Bacteria 3386
270 Ga0307410_10033049 3300031852 Bacteria 3337
271 Ga0307410_10064186 3300031852 Bacteria 2522
272 Ga0307410_10100045 3300031852 Bacteria 2076
273 Ga0307410_10163208 3300031852 Bacteria 1671
274 Ga0307410_10211154 3300031852 Bacteria 1487
275 Ga0307410_10325842 3300031852 Bacteria 1220
276 Ga0307406_10006159 3300031901 Bacteria 6599
277 Ga0307406_10024287 3300031901 Bacteria 3619
278 Ga0307406_10069220 3300031901 Bacteria 2306
279 Ga0307406_10072483 3300031901 Bacteria 2261
280 Ga0307406_10118594 3300031901 Bacteria 1835
281 Ga0307406_10171107 3300031901 Bacteria 1572
282 Ga0307406_10192358 3300031901 Bacteria 1495
283 Ga0307406_10371335 3300031901 Bacteria 1125
284 Ga0307407_10225764 3300031903 Bacteria 1269
285 Ga0307407_10448339 3300031903 Bacteria 936
286 Ga0307407_10501669 3300031903 Bacteria 890
287 Ga0307407_10526927 3300031903 Bacteria 870
288 Ga0307412_10021483 3300031911 Bacteria 3943
289 Ga0307412_10021500 3300031911 Bacteria 3942
290 Ga0307412_10028867 3300031911 Bacteria 3477
291 Ga0307412_10032907 3300031911 Bacteria 3290
292 Ga0307412_10053406 3300031911 Bacteria 2678
293 Ga0307412_10066985 3300031911 Bacteria 2436
294 Ga0307412_10072817 3300031911 Bacteria 2349
295 Ga0307412_10076121 3300031911 Bacteria 2304
296 Ga0307412_10236799 3300031911 Bacteria 1409
297 Ga0307412_10361816 3300031911 Bacteria 1168
298 Ga0307409_100015197 3300031995 Bacteria 5041
299 Ga0307409_100020466 3300031995 Bacteria 4511
300 Ga0307409_100062342 3300031995 Bacteria 2918
301 Ga0307409_100076918 3300031995 Bacteria 2678
302 Ga0307409_100085881 3300031995 Bacteria 2559
303 Ga0307409_100121856 3300031995 Bacteria 2210
304 Ga0307409_100136999 3300031995 Bacteria 2102
305 Ga0307409_100194249 3300031995 Bacteria 1810
306 Ga0307409_100234661 3300031995 Bacteria 1665
307 Ga0307409_100560631 3300031995 Bacteria 1123
308 Ga0307416_100010594 3300032002 Bacteria 6099
309 Ga0307416_100044024 3300032002 Bacteria 3501
310 Ga0307416_100080602 3300032002 Bacteria 2748
311 Ga0307416_100086738 3300032002 Bacteria 2669
312 Ga0307416_100088044 3300032002 Bacteria 2653
313 Ga0307416_100124610 3300032002 Bacteria 2305
314 Ga0307416_100199739 3300032002 Bacteria 1896
315 Ga0307416_100202350 3300032002 Bacteria 1885
316 Ga0307416_100217114 3300032002 Bacteria 1830
317 Ga0307416_100341442 3300032002 Bacteria 1510
318 Ga0307416_100476211 3300032002 Bacteria 1307
319 Ga0307416_100561222 3300032002 Bacteria 1216
320 Ga0307416_100796983 3300032002 Bacteria 1040
321 Ga0307414_10066991 3300032004 Bacteria 2569
322 Ga0307414_10092908 3300032004 Bacteria 2248
323 Ga0307414_10130004 3300032004 Bacteria 1953
324 Ga0307414_10161967 3300032004 Bacteria 1778
325 Ga0307411_10013910 3300032005 Bacteria 4460
326 Ga0307411_10030215 3300032005 Bacteria 3319
327 Ga0307411_10054445 3300032005 Bacteria 2627
328 Ga0307411_10171497 3300032005 Bacteria 1637
329 Ga0307415_100003929 3300032126 Bacteria 7639
330 Ga0307415_100034893 3300032126 Bacteria 3280
331 Ga0307415_100158165 3300032126 Bacteria 1753
332 Ga0307415_100221231 3300032126 Bacteria 1518
333 Ga0307415_100400460 3300032126 Bacteria 1172
334 Ga0307415_100672139 3300032126 Bacteria 931
335 Ga0307507_10000020 3300033179 Bacteria 220880
336 Ga0307507_10039359 3300033179 Bacteria 4773
337 Ga0373959_0018113 3300034820 Bacteria 1322
338 Ga0373940_0010775 3300035088 Bacteria 2159
339 Ga0373944_0058139 3300035089 Bacteria 1234
340 Ga0373932_0028763 3300035112 Bacteria 1530
341 Ga0373939_0003768 3300035114 Bacteria 3575
342 Ga0373941_0011811 3300035115 Bacteria 2267
343 Ga0373943_0025178 3300035170 Bacteria 2780
344 Ga0373933_0158564 3300035724 Bacteria 1436
345 Ga0373947_0025327 3300035725 Bacteria 3459
346 Ga0395899_0027132 3300037312 Bacteria 4320
347 Ga0395900_0010013 3300037418 Bacteria 9700
348 Ga0395900_0020745 3300037418 Bacteria 6716
349 Ga0395900_0122747 3300037418 Bacteria 2664
350 Ga0395898_0063072 3300037466 Bacteria 3597
351 Ga0395898_0398961 3300037466 Bacteria 1311
352 Ga0395901_0074690 3300038443 Bacteria 3536
353 Ga0395901_0093049 3300038443 Bacteria 3156
354 Ga0439436_0030758 3300041404 Bacteria 1559
355 Ga0439438_031967 3300041405 Bacteria 1397
356 Ga0439439_0004876 3300041406 Bacteria 3040
357 Ga0439461_0000758 3300041410 Bacteria 4717
358 Ga0439461_0001970 3300041410 Bacteria 3242
359 Ga0439466_0001793 3300041411 Bacteria 8403
360 Ga0439466_0014536 3300041411 Bacteria 2865
361 Ga0439466_0095510 3300041411 Bacteria 930
362 Ga0451789_0014534 3300041443 Bacteria 1523
363 Ga0451793_1920694 3300041452 Bacteria 1342
364 Ga0451797_0529923 3300041453 Bacteria 1236
365 Ga0451797_1438664 3300041453 Bacteria 774
366 Ga0451853_0985435 3300041512 Bacteria 999
367 Ga0439433_0003043 3300041999 Bacteria 3593
368 Ga0439442_000001 3300042002 Bacteria 161142
369 Ga0439442_000068 3300042002 Bacteria 24332
370 Ga0439442_002116 3300042002 Bacteria 3903
371 Ga0439442_005362 3300042002 Bacteria 2565
372 Ga0439448_0032542 3300042005 Bacteria 1660
373 Ga0439449_0000147 3300042007 Bacteria 23936
374 Ga0439449_0002610 3300042007 Bacteria 7022
375 Ga0439449_0016720 3300042007 Bacteria 2755
376 Ga0439457_006366 3300042014 Bacteria 2898
377 Ga0439457_007398 3300042014 Bacteria 2638
378 Ga0439462_0013343 3300042015 Bacteria 2105
379 Ga0439462_0018342 3300042015 Bacteria 1817
380 Ga0450920_004324 3300042122 Bacteria 2490
381 Ga0450907_000102 3300042146 Bacteria 32710
382 Ga0450907_018660 3300042146 Bacteria 1161
383 Ga0450908_002545 3300042184 Bacteria 3577
384 Ga0439434_0000022 3300042435 Bacteria 37374
385 Ga0439434_0000119 3300042435 Bacteria 20788
386 Ga0439434_0000960 3300042435 Bacteria 8303
387 Ga0450918_001152 3300042531 Bacteria 5418
388 Ga0450918_003544 3300042531 Bacteria 2894
389 Ga0466969_0001685 3300044656 Bacteria 11809
390 Ga0466969_0012892 3300044656 Bacteria 4403
391 Ga0466965_0286092 3300044683 Bacteria 891
392 Ga0466966_0012173 3300044684 Bacteria 5700
393 Ga0466966_0034327 3300044684 Bacteria 3280
394 Ga0466966_0090057 3300044684 Bacteria 1905
395 Ga0466961_0002853 3300044693 Bacteria 10721
396 Ga0466961_0012402 3300044693 Bacteria 5451
397 Ga0466971_0008173 3300044719 Bacteria 4560
398 Ga0466971_0120538 3300044719 Bacteria 1214
399 Ga0466971_0155615 3300044719 Bacteria 1068
400 Ga0466970_0045460 3300044765 Bacteria 2338
401 Ga0466957_0066702 3300044842 Bacteria 2219
402 Ga0466960_0029095 3300044901 Bacteria 2533
403 Ga0466959_0012689 3300045049 Bacteria 6096
404 Ga0466959_0040398 3300045049 Bacteria 3446
405 Ga0466959_0053621 3300045049 Bacteria 2947
406 Ga0466959_0101950 3300045049 Bacteria 2054
407 Ga0466958_0009244 3300045836 Bacteria 5487
408 Ga0466967_0198801 3300045976 Bacteria 1898
409 Ga0495603_0201932 3300046455 Bacteria 1149
410 Ga0495651_0061031 3300046462 Bacteria 2886
411 Ga0495580_0002711 3300046472 Bacteria 15306
412 Ga0495580_0051968 3300046472 Bacteria 2896
413 Ga0495582_0054618 3300046473 Bacteria 2202
414 Ga0495582_0058109 3300046473 Bacteria 2133
415 Ga0495639_0000709 3300046475 Bacteria 15271
416 Ga0495664_0006373 3300046477 Bacteria 6522
417 Ga0495596_0148696 3300046500 Bacteria 910
418 Ga0495628_0004464 3300046516 Bacteria 12405
419 Ga0495630_0099248 3300046517 Bacteria 2203
420 Ga0495631_0124326 3300046518 Bacteria 1109
421 Ga0495643_0040780 3300046522 Bacteria 2534
422 Ga0495642_0005095 3300046528 Bacteria 5060
423 Ga0495642_0139660 3300046528 Bacteria 1045
424 Ga0495652_0218151 3300046529 Bacteria 1435
425 Ga0495665_0211020 3300046531 Bacteria 1005
426 Ga0495586_0001629 3300046535 Bacteria 12313
427 Ga0495586_0006292 3300046535 Bacteria 6342
428 Ga0495598_0049726 3300046537 Bacteria 1258
429 Ga0495621_0078784 3300046539 Bacteria 1226
430 Ga0495597_0044183 3300046542 Bacteria 1982
431 Ga0495645_0008335 3300046543 Bacteria 7235
432 Ga0495622_0072159 3300046557 Bacteria 1593
433 Ga0495667_0240749 3300046559 Bacteria 1152
434 Ga0495668_0178249 3300046616 Bacteria 1164
435 Ga0495634_0077631 3300046642 Bacteria 2177
436 Ga0495661_0089942 3300046665 Bacteria 1749
437 Ga0495588_0006103 3300046674 Bacteria 5409
438 Ga0495588_0010563 3300046674 Bacteria 4299
439 Ga0495588_0184774 3300046674 Bacteria 1101
440 Ga0495657_0016539 3300046675 Bacteria 5375
441 Ga0495658_0017998 3300046683 Bacteria 3664
442 Ga0495670_0126715 3300046691 Bacteria 1329
443 Ga0495670_0137414 3300046691 Bacteria 1276
444 Ga0495600_0056782 3300046809 Bacteria 2558
445 Ga0495581_0005705 3300047315 Bacteria 7220
446 Ga0495581_0008668 3300047315 Bacteria 5890
447 Ga0495581_0237503 3300047315 Bacteria 1066
448 Ga0495604_0056648 3300047317 Bacteria 3016
449 Ga0495672_0129381 3300047320 Bacteria 1330
450 Ga0495676_0016869 3300047321 Bacteria 6465
451 Ga0495676_0023797 3300047321 Bacteria 5309
452 Ga0495680_0038314 3300047322 Bacteria 3832
453 Ga0495680_0110890 3300047322 Bacteria 2033
454 Ga0495677_0132111 3300047445 Bacteria 956
455 Ga0495684_0103434 3300047471 Bacteria 2153
456 Ga0496100_0002615 3300048903 Bacteria 9177
457 Ga0496100_0131624 3300048903 Bacteria 1762
458 Ga0496100_0303042 3300048903 Bacteria 1196
459 Ga0496100_0337326 3300048903 Bacteria 1136
460 Ga0496101_0039374 3300048904 Bacteria 3361
461 Ga0496101_0053527 3300048904 Bacteria 2912
462 Ga0496101_0122009 3300048904 Bacteria 1971
463 Ga0496101_0146120 3300048904 Bacteria 1806
464 Ga0496102_0025412 3300048905 Bacteria 5272
465 Ga0496102_0051000 3300048905 Bacteria 3769
466 Ga0496102_0056805 3300048905 Bacteria 3571
467 Ga0496102_0639917 3300048905 Bacteria 986
468 Ga0496103_0001053 3300048906 Bacteria 19227
469 Ga0496103_0078916 3300048906 Bacteria 2068
470 Ga0496104_0003873 3300048907 Bacteria 12944
471 Ga0496104_0074204 3300048907 Bacteria 3238
472 Ga0496104_0171212 3300048907 Bacteria 2082
473 Ga0496104_0350751 3300048907 Bacteria 1388
474 Ga0496105_0022976 3300048908 Bacteria 5056
475 Ga0496105_0105065 3300048908 Bacteria 2331
476 Ga0496105_0117617 3300048908 Bacteria 2192
477 Ga0496105_0174735 3300048908 Bacteria 1760
478 Ga0496105_0230459 3300048908 Bacteria 1505
479 Ga0496105_0492806 3300048908 Bacteria 963
480 Ga0496106_0009324 3300048909 Bacteria 7255
481 Ga0496107_0001827 3300048910 Bacteria 13429
482 Ga0496107_0125592 3300048910 Bacteria 1892
483 Ga0496107_0225703 3300048910 Bacteria 1393
484 Ga0496108_0003330 3300048911 Bacteria 12912
485 Ga0496108_0063758 3300048911 Bacteria 3103
486 Ga0496108_0145854 3300048911 Bacteria 2040
487 Ga0496109_0017208 3300048912 Bacteria 6331
488 Ga0496109_0017977 3300048912 Bacteria 6207
489 Ga0496109_0137284 3300048912 Bacteria 2285
490 Ga0496109_0219583 3300048912 Bacteria 1787
491 Ga0496109_0428576 3300048912 Bacteria 1249
492 Ga0496109_0741803 3300048912 Bacteria 920
493 Ga0496110_0016702 3300048913 Bacteria 6130
494 Ga0496110_0103766 3300048913 Bacteria 2550
495 Ga0496110_0143451 3300048913 Bacteria 2159
496 Ga0496110_0383056 3300048913 Bacteria 1281
497 Ga0496111_0007898 3300048914 Bacteria 7015
498 Ga0496111_0012253 3300048914 Bacteria 5801
499 Ga0496111_0013521 3300048914 Bacteria 5558
500 Ga0496111_0119602 3300048914 Bacteria 1945
501 Ga0496112_0018811 3300048915 Bacteria 6510
502 Ga0496112_0027524 3300048915 Bacteria 5481
503 Ga0496112_0032543 3300048915 Bacteria 5064
504 Ga0496112_0047728 3300048915 Bacteria 4200
505 Ga0496112_0065244 3300048915 Bacteria 3593
506 Ga0496112_0102831 3300048915 Bacteria 2827
507 Ga0496112_0116396 3300048915 Bacteria 2644
508 Ga0496112_0127898 3300048915 Bacteria 2511
509 Ga0496112_0697033 3300048915 Bacteria 943
510 Ga0496113_0006096 3300048916 Bacteria 7605
511 Ga0496113_0027305 3300048916 Bacteria 4091
512 Ga0496113_0100666 3300048916 Bacteria 2239
513 Ga0496113_0242695 3300048916 Bacteria 1437
514 Ga0496113_0344005 3300048916 Bacteria 1196
515 Ga0496114_0000927 3300048917 Bacteria 21944
516 Ga0496114_0015494 3300048917 Bacteria 6129
517 Ga0496114_0028899 3300048917 Bacteria 4554
518 Ga0496114_0031942 3300048917 Bacteria 4331
519 Ga0496115_0053224 3300048918 Bacteria 3248
520 Ga0496115_0074107 3300048918 Bacteria 2764
521 Ga0496115_0077473 3300048918 Bacteria 2703
522 Ga0496115_0186605 3300048918 Bacteria 1713
523 Ga0496119_0168427 3300048922 Bacteria 1159
524 Ga0496122_0003688 3300048925 Bacteria 19851
525 Ga0496123_0000142 3300048926 Bacteria 146932
526 Ga0496124_0000461 3300048927 Bacteria 70566
527 Ga0496124_0406811 3300048927 Bacteria 943
528 Ga0496125_0043438 3300048928 Bacteria 3815
529 Ga0496126_0040382 3300048929 Bacteria 4325
530 Ga0496126_0093987 3300048929 Bacteria 2632
531 Ga0496126_0161248 3300048929 Bacteria 1916
532 Ga0496126_0240783 3300048929 Bacteria 1511
533 Ga0501032_0000370 3300049569 Bacteria 37322
534 Ga0501032_0074027 3300049569 Bacteria 2269
535 Ga0501032_0444835 3300049569 Bacteria 830
536 Ga0501034_0000051 3300049571 Bacteria 210960
537 Ga0501034_0026756 3300049571 Bacteria 5869
538 Ga0501036_0191662 3300049572 Bacteria 1720
539 Ga0501036_0302559 3300049572 Bacteria 1337
540 Ga0501036_0483284 3300049572 Bacteria 1031
541 Ga0501037_0013188 3300049573 Bacteria 6093
542 Ga0501037_0017155 3300049573 Bacteria 5329
543 Ga0501037_0029053 3300049573 Bacteria 4083
544 Ga0501037_0093851 3300049573 Bacteria 2170
545 Ga0501037_0156864 3300049573 Bacteria 1624
546 Ga0501038_0000386 3300049574 Bacteria 38058
547 Ga0501038_0015613 3300049574 Bacteria 6903
548 Ga0501038_0064863 3300049574 Bacteria 3113
549 Ga0501039_0121738 3300049575 Bacteria 2045
550 Ga0501039_0329212 3300049575 Bacteria 1200
551 Ga0501043_0012922 3300049579 Bacteria 6526
552 Ga0501043_0015964 3300049579 Bacteria 5886
553 Ga0501043_0021058 3300049579 Bacteria 5112
554 Ga0501046_0016810 3300049580 Bacteria 6117
555 Ga0501046_0019874 3300049580 Bacteria 5563
556 Ga0501047_0022276 3300049581 Bacteria 6086
557 Ga0501047_0026611 3300049581 Bacteria 5566
558 Ga0501070_0039913 3300049586 Bacteria 3915
559 Ga0501070_0156770 3300049586 Bacteria 1878
560 Ga0501074_0433274 3300049590 Bacteria 932
561 Ga0501080_0157150 3300049742 Bacteria 2100
562 Ga0501083_0003465 3300049744 Bacteria 11030
563 Ga0501035_0038120 3300049822 Bacteria 4352
564 Ga0501035_0067877 3300049822 Bacteria 3163
565 Ga0501044_0006148 3300049823 Bacteria 13260
566 Ga0501044_0048330 3300049823 Bacteria 4395
567 nmdc:mga05p37_154014_c1 3300050507 Bacteria 2810
568 nmdc:mga05p37_275147_c1 3300050507 Bacteria 2010
569 nmdc:mga05p37_9718_c1 3300050507 Bacteria 11405
570 nmdc:mga09592_8482_c1 3300050508 Bacteria 8358
571 nmdc:mga0qj67_405449_c1 3300050509 Bacteria 1100
572 nmdc:mga06r32_60156_c1 3300050510 Bacteria 3655
573 nmdc:mga06r32_87767_c1 3300050510 Bacteria 3036
574 nmdc:mga0n895_20064_c1 3300050512 Bacteria 6224
575 nmdc:mga0a205_86888_c1 3300050515 Bacteria 3021
576 Ga0495601_0003077 3300053077 Bacteria 9516
577 Ga0500644_0027806 3300053088 Bacteria 1763
578 Ga0500646_0000237 3300053090 Bacteria 16818
579 Ga0500583_0019648 3300053092 Bacteria 2774
580 Ga0500641_0057740 3300053096 Bacteria 1610
581 Ga0500562_040603 3300053108 Bacteria 1237
582 Ga0500588_0004322 3300053146 Bacteria 3072
583 Ga0500616_0001577 3300053153 Bacteria 21289
584 Ga0500616_0003190 3300053153 Bacteria 12766
585 Ga0500633_0078005 3300053160 Bacteria 1194
586 Ga0501084_0049728 3300054114 Bacteria 3509
587 Ga0501082_0003943 3300060353 Bacteria 12954
588 Ga0466962_0054640 3300061719 Bacteria 1908
589 Ga0530510_0020488 3300061734 Bacteria 4702
590 2537899772 2537561592 Bacteria 4348607
591 2644527667 2643221694 Bacteria 4392972
592 2644670712 2643221722 Bacteria 4247614
593 2676481218 2675903059 Bacteria 8644972
594 2691514524 2690315906 Bacteria 4517044
595 2729906989 2728369276 Bacteria 5610032
596 2738693430 2738541272 Bacteria 6848551
597 2739323156 2738543027 Bacteria 6409078
598 2739607747 2739367654 Bacteria 6049412
599 2760304239 2758568522 Bacteria 5953541
600 2760621818 2758568621 Bacteria 5967089
601 2775655145 2775506735 Bacteria 4556596
602 2808827604 2808606357 Bacteria 4466944
603 2808852971 2808606360 Bacteria 4404006
604 2808878579 2808606366 Bacteria 4415912
605 2808891855 2808606370 Bacteria 4942454
606 2808896967 2808606371 Bacteria 4251511
607 2809026625 2808606394 Bacteria 6248540
608 2810364159 2808606700 Bacteria 3482157
609 2812320608 2811994871 Bacteria 4497550
610 2831938460 2831935698 Bacteria 5963223
611 2835191138 2835188231 Bacteria 3476928
612 2844849471 2844849076 Bacteria 4091819
613 2848552823 2848551377 Bacteria 3720646
614 2857741389 2857740372 Bacteria 4782044
615 2861527389 2861520306 Bacteria 8348283
616 2884994679 2884994152 Bacteria 4492978
617 2887445806 2887443736 Bacteria 4426037
618 2904499924 2904497146 Bacteria 4731781
619 2904776568 2904776348 Bacteria 4658726
620 2905929128 2905926851 Bacteria 4423176
621 2910813822 2910809715 Bacteria 4982797
622 2919037690 2919034639 Bacteria 4763403
623 2919061762 2919059106 Bacteria 4991624
624 2919391347 2919391150 Bacteria 4884741
625 2919542081 2919538618 Bacteria 4677069
626 2932429174 2932426870 Bacteria 4547726
627 2933420658 2933418574 Bacteria 4476724
628 2939598582 2939598168 Bacteria 4687164
629 2939648938 2939647034 Bacteria 4681660
630 2939676129 2939674588 Bacteria 4844420
631 2945918367 2945916053 Bacteria 4555517
632 2945921347 2945920336 Bacteria 4501603
633 2945942478 2945941187 Bacteria 4682474
634 2945959763 2945956166 Bacteria 5110334
635 2946005295 2946003308 Bacteria 3857229
636 2946038407 2946037020 Bacteria 4900426
637 2946062222 2946059875 Bacteria 4386623
638 2953999682 2953998280 Bacteria 4812144
639 2974306393 2974302888 Bacteria 4369871
640 2995467255 2995463766 Bacteria 8577691
641 3001890759 3001889506 Bacteria 2975194
642 8003863431 8003856774 Bacteria 7675274
643 8004023381 8004021418 Bacteria 4313954
644 8004027867 8004025490 Bacteria 4327753
645 8047719856 8047710418 Bacteria 11023148
646 8054111100 8054107350 Bacteria 5022511
647 8056582621 8056579771 Bacteria 5840325
648 Ga0495638_0053646
649 JGI24738J21930_10000450
650 JGI25152J39213_1000085
651 JGI25406J46586_10008596
652 JGI25406J46586_10023330
653 JGI25406J46586_10068618
654 JGI25406J46586_10076236
655 Ga0055542_1011376
656 Ga0070658_10004438
657 Ga0070683_100001033
658 Ga0070683_100044638
659 Ga0070683_100685071
660 Ga0068869_100097444
661 Ga0070666_10135291
662 Ga0070680_100039261
663 Ga0068868_100003308
664 Ga0070660_100059713
665 Ga0070660_100166771
666 Ga0070689_100016236
667 Ga0070691_10113254
668 Ga0070661_100036378
669 Ga0070661_100261064
670 Ga0070661_100337820
671 Ga0070692_10024631
672 Ga0070668_100006985
673 Ga0070668_100029643
674 Ga0070675_100001082
675 Ga0070675_100455555
676 Ga0070674_100214211
677 Ga0070673_100116914
678 Ga0070688_100331393
679 Ga0070659_100010924
680 Ga0070659_100033946
681 Ga0070659_100055569
682 Ga0070709_10032356
683 Ga0070709_10035005
684 Ga0070714_100004918
685 Ga0070714_100024008
686 Ga0070714_100046143
687 Ga0070710_10146029
688 Ga0070710_10193457
689 Ga0070711_100348180
690 Ga0070700_100108546
691 Ga0070694_100076828
692 Ga0070663_100003520
693 Ga0070678_100028268
694 Ga0070662_100003771
695 Ga0070662_100152724
696 Ga0070679_100074126
697 Ga0070684_100026059
698 Ga0068853_100017947
699 Ga0070672_100077887
700 Ga0070672_100287393
701 Ga0070696_100052375
702 Ga0070665_100053866
703 Ga0070665_100066602
704 Ga0070704_100099269
705 Ga0068855_100008907
706 Ga0070664_100012825
707 Ga0070664_100155914
708 Ga0070664_100218772
709 Ga0070664_100361638
710 Ga0068857_100094322
711 Ga0068857_100412126
712 Ga0068854_100124683
713 Ga0070702_100008289
714 Ga0070702_100019479
715 Ga0068864_100003965
716 Ga0068864_100062750
717 Ga0068864_100157740
718 Ga0068861_100032585
719 Ga0068861_100316907
720 Ga0068870_10069117
721 Ga0068863_100115346
722 Ga0068863_100145002
723 Ga0068858_100092207
724 Ga0068860_100058251
725 Ga0068862_100045932
726 Ga0081455_10137995
727 Ga0081540_1016528
728 Ga0081540_1027777
729 Ga0081539_10000270
730 Ga0081539_10002008
731 Ga0070717_10012134
732 Ga0070717_10271943
733 Ga0075363_100215016
734 Ga0075432_10012200
735 Ga0075432_10016860
736 Ga0075428_100005782
737 Ga0075428_100216708
738 Ga0075430_100250512
739 Ga0075431_100006877
740 Ga0075431_100020526
741 Ga0075433_10044048
742 Ga0075429_100000306
743 Ga0075436_100031561
744 Ga0105244_10003153
745 Ga0105244_10029317
746 Ga0105244_10040733
747 Ga0105244_10099123
748 Ga0111539_10005398
749 Ga0111539_10134871
750 Ga0111539_10539967
751 Ga0111539_10565697
752 Ga0105245_10006496
753 Ga0105245_10006809
754 Ga0105245_10175768
755 Ga0105245_10227602
756 Ga0105247_10014241
757 Ga0114129_10130159
758 Ga0114129_10186215
759 Ga0114129_10243668
760 Ga0105243_10006336
761 Ga0105243_10058605
762 Ga0105243_10071311
763 Ga0105241_10200520
764 Ga0105242_10177582
765 Ga0105248_10161701
766 Ga0105248_10391040
767 Ga0105248_10438570
768 Ga0105248_10914644
769 Ga0105238_10026906
770 Ga0105238_10242563
771 Ga0105249_10004106
772 Ga0105249_10096861
773 Ga0105249_10236971
774 Ga0105239_10185856
775 Ga0105239_10512879
776 Ga0105246_10002983
777 Ga0105246_10003045
778 Ga0105246_10010929
779 Ga0105246_10228077
780 Ga0105246_10302779
781 Ga0157373_10010255
782 Ga0157371_10136640
783 Ga0157370_10012783
784 Ga0157370_10061215
785 Ga0157369_10055355
786 Ga0157369_10221237
787 Ga0157374_10145930
788 Ga0163162_10014986
789 Ga0163162_10215334
790 Ga0163162_10293831
791 Ga0157375_10069034
792 Ga0157375_10286346
793 Ga0157375_10331769
794 Ga0157375_10338841
795 Ga0163163_10003868
796 Ga0163163_10061583
797 Ga0163163_10280530
798 Ga0163163_10885180
799 Ga0157380_10015064
800 Ga0157377_10047177
801 Ga0157379_10006318
802 Ga0157376_10093261
803 Ga0163161_10007540
804 Ga0163161_10244875
805 Ga0197907_11498807
806 Ga0206353_11891345
807 Ga0209148_1000960
808 Ga0209759_1013922
809 Ga0209129_1000028
810 Ga0209025_1000112
811 Ga0209051_1001385
812 Ga0207655_1018358
813 Ga0207655_1019425
814 Ga0207692_10012152
815 Ga0207692_10108219
816 Ga0207688_10000688
817 Ga0207688_10089894
818 Ga0207699_10052375
819 Ga0207705_10050963
820 Ga0207707_10153314
821 Ga0207695_10352965
822 Ga0207693_10000849
823 Ga0207663_10031587
824 Ga0207660_10129646
825 Ga0207662_10017857
826 Ga0207657_10034108
827 Ga0207649_10029038
828 Ga0207652_10202346
829 Ga0207694_10013151
830 Ga0207659_10003231
831 Ga0207687_10039765
832 Ga0207687_10414229
833 Ga0207664_10056087
834 Ga0207664_10102716
835 Ga0207664_10170288
836 Ga0207644_10169250
837 Ga0207690_10009814
838 Ga0207690_10021645
839 Ga0207690_10237799
840 Ga0207706_10041949
841 Ga0207706_10097572
842 Ga0207709_10040032
843 Ga0207670_10203235
844 Ga0207669_10205564
845 Ga0207665_10004230
846 Ga0207691_10136291
847 Ga0207711_10397180
848 Ga0207689_10004145
849 Ga0207689_10019332
850 Ga0207661_10018763
851 Ga0207661_10105806
852 Ga0207679_10012516
853 Ga0207679_10048775
854 Ga0207679_10208853
855 Ga0207667_10013323
856 Ga0207712_10137258
857 Ga0207640_10050138
858 Ga0207640_10118740
859 Ga0207677_10003998
860 Ga0207703_10242406
861 Ga0207678_10003736
862 Ga0207678_10088692
863 Ga0207678_10313294
864 Ga0207708_10016115
865 Ga0207641_10012947
866 Ga0207676_10112351
867 Ga0207676_10119344
868 Ga0207676_10376637
869 Ga0207674_10038684
870 Ga0207674_10160603
871 Ga0207674_10551643
872 Ga0207675_100084196
873 Ga0207683_10052463
874 Ga0207683_10243065
875 Ga0207428_10019442
876 Ga0207428_10026047
877 Ga0207428_10035454
878 Ga0268266_10087083
879 Ga0268265_10013250
880 Ga0307515_10000065
881 Ga0307515_10065068
882 Ga0307515_10203618
883 Ga0307515_10456181
884 Ga0265340_10012498
885 Ga0307513_10000149
886 Ga0307513_10199099
887 Ga0307408_100018562
888 Ga0307408_100019897
889 Ga0307408_100045798
890 Ga0307408_100061342
891 Ga0307408_100075093
892 Ga0307408_100106264
893 Ga0307408_100172426
894 Ga0307408_100230501
895 Ga0307408_100558485
896 Ga0307408_100620005
897 Ga0307508_10000654
898 Ga0307405_10021502
899 Ga0307405_10031079
900 Ga0307405_10086777
901 Ga0307405_10125656
902 Ga0307405_10136053
903 Ga0307405_10165624
904 Ga0307405_10255154
905 Ga0307405_10262707
906 Ga0307413_10007182
907 Ga0307413_10016711
908 Ga0307413_10029131
909 Ga0307413_10029766
910 Ga0307413_10185092
911 Ga0307413_10268356
912 Ga0307413_10447525
913 Ga0307413_10454773
914 Ga0307410_10002891
915 Ga0307410_10020949
916 Ga0307410_10031877
917 Ga0307410_10033049
918 Ga0307410_10064186
919 Ga0307410_10100045
920 Ga0307410_10163208
921 Ga0307410_10211154
922 Ga0307410_10325842
923 Ga0307406_10006159
924 Ga0307406_10024287
925 Ga0307406_10069220
926 Ga0307406_10072483
927 Ga0307406_10118594
928 Ga0307406_10171107
929 Ga0307406_10192358
930 Ga0307406_10371335
931 Ga0307407_10225764
932 Ga0307407_10448339
933 Ga0307407_10501669
934 Ga0307407_10526927
935 Ga0307412_10021483
936 Ga0307412_10021500
937 Ga0307412_10028867
938 Ga0307412_10032907
939 Ga0307412_10053406
940 Ga0307412_10066985
941 Ga0307412_10072817
942 Ga0307412_10076121
943 Ga0307412_10236799
944 Ga0307412_10361816
945 Ga0307409_100015197
946 Ga0307409_100020466
947 Ga0307409_100062342
948 Ga0307409_100076918
949 Ga0307409_100085881
950 Ga0307409_100121856
951 Ga0307409_100136999
952 Ga0307409_100194249
953 Ga0307409_100234661
954 Ga0307409_100560631
955 Ga0307416_100010594
956 Ga0307416_100044024
957 Ga0307416_100080602
958 Ga0307416_100086738
959 Ga0307416_100088044
960 Ga0307416_100124610
961 Ga0307416_100199739
962 Ga0307416_100202350
963 Ga0307416_100217114
964 Ga0307416_100341442
965 Ga0307416_100476211
966 Ga0307416_100561222
967 Ga0307416_100796983
968 Ga0307414_10066991
969 Ga0307414_10092908
970 Ga0307414_10130004
971 Ga0307414_10161967
972 Ga0307411_10013910
973 Ga0307411_10030215
974 Ga0307411_10054445
975 Ga0307411_10171497
976 Ga0307415_100003929
977 Ga0307415_100034893
978 Ga0307415_100158165
979 Ga0307415_100221231
980 Ga0307415_100400460
981 Ga0307415_100672139
982 Ga0307507_10000020
983 Ga0307507_10039359
984 Ga0373959_0018113
985 Ga0373940_0010775
986 Ga0373944_0058139
987 Ga0373932_0028763
988 Ga0373939_0003768
989 Ga0373941_0011811
990 Ga0373943_0025178
991 Ga0373933_0158564
992 Ga0373947_0025327
993 Ga0395899_0027132
994 Ga0395900_0010013
995 Ga0395900_0020745
996 Ga0395900_0122747
997 Ga0395898_0063072
998 Ga0395898_0398961
999 Ga0395901_0074690
1000 Ga0395901_0093049
1001 Ga0439436_0030758
1002 Ga0439438_031967
1003 Ga0439439_0004876
1004 Ga0439461_0000758
1005 Ga0439461_0001970
1006 Ga0439466_0001793
1007 Ga0439466_0014536
1008 Ga0439466_0095510
1009 Ga0451789_0014534
1010 Ga0451793_1920694
1011 Ga0451797_0529923
1012 Ga0451797_1438664
1013 Ga0451853_0985435
1014 Ga0439433_0003043
1015 Ga0439442_000001
1016 Ga0439442_000068
1017 Ga0439442_002116
1018 Ga0439442_005362
1019 Ga0439448_0032542
1020 Ga0439449_0000147
1021 Ga0439449_0002610
1022 Ga0439449_0016720
1023 Ga0439457_006366
1024 Ga0439457_007398
1025 Ga0439462_0013343
1026 Ga0439462_0018342
1027 Ga0450920_004324
1028 Ga0450907_000102
1029 Ga0450907_018660
1030 Ga0450908_002545
1031 Ga0439434_0000022
1032 Ga0439434_0000119
1033 Ga0439434_0000960
1034 Ga0450918_001152
1035 Ga0450918_003544
1036 Ga0466969_0001685
1037 Ga0466969_0012892
1038 Ga0466965_0286092
1039 Ga0466966_0012173
1040 Ga0466966_0034327
1041 Ga0466966_0090057
1042 Ga0466961_0002853
1043 Ga0466961_0012402
1044 Ga0466971_0008173
1045 Ga0466971_0120538
1046 Ga0466971_0155615
1047 Ga0466970_0045460
1048 Ga0466957_0066702
1049 Ga0466960_0029095
1050 Ga0466959_0012689
1051 Ga0466959_0040398
1052 Ga0466959_0053621
1053 Ga0466959_0101950
1054 Ga0466958_0009244
1055 Ga0466967_0198801
1056 Ga0495603_0201932
1057 Ga0495651_0061031
1058 Ga0495580_0002711
1059 Ga0495580_0051968
1060 Ga0495582_0054618
1061 Ga0495582_0058109
1062 Ga0495639_0000709
1063 Ga0495664_0006373
1064 Ga0495596_0148696
1065 Ga0495628_0004464
1066 Ga0495630_0099248
1067 Ga0495631_0124326
1068 Ga0495643_0040780
1069 Ga0495642_0005095
1070 Ga0495642_0139660
1071 Ga0495652_0218151
1072 Ga0495665_0211020
1073 Ga0495586_0001629
1074 Ga0495586_0006292
1075 Ga0495598_0049726
1076 Ga0495621_0078784
1077 Ga0495597_0044183
1078 Ga0495645_0008335
1079 Ga0495622_0072159
1080 Ga0495667_0240749
1081 Ga0495668_0178249
1082 Ga0495634_0077631
1083 Ga0495661_0089942
1084 Ga0495588_0006103
1085 Ga0495588_0010563
1086 Ga0495588_0184774
1087 Ga0495657_0016539
1088 Ga0495658_0017998
1089 Ga0495670_0126715
1090 Ga0495670_0137414
1091 Ga0495600_0056782
1092 Ga0495581_0005705
1093 Ga0495581_0008668
1094 Ga0495581_0237503
1095 Ga0495604_0056648
1096 Ga0495672_0129381
1097 Ga0495676_0016869
1098 Ga0495676_0023797
1099 Ga0495680_0038314
1100 Ga0495680_0110890
1101 Ga0495677_0132111
1102 Ga0495684_0103434
1103 Ga0496100_0002615
1104 Ga0496100_0131624
1105 Ga0496100_0303042
1106 Ga0496100_0337326
1107 Ga0496101_0039374
1108 Ga0496101_0053527
1109 Ga0496101_0122009
1110 Ga0496101_0146120
1111 Ga0496102_0025412
1112 Ga0496102_0051000
1113 Ga0496102_0056805
1114 Ga0496102_0639917
1115 Ga0496103_0001053
1116 Ga0496103_0078916
1117 Ga0496104_0003873
1118 Ga0496104_0074204
1119 Ga0496104_0171212
1120 Ga0496104_0350751
1121 Ga0496105_0022976
1122 Ga0496105_0105065
1123 Ga0496105_0117617
1124 Ga0496105_0174735
1125 Ga0496105_0230459
1126 Ga0496105_0492806
1127 Ga0496106_0009324
1128 Ga0496107_0001827
1129 Ga0496107_0125592
1130 Ga0496107_0225703
1131 Ga0496108_0003330
1132 Ga0496108_0063758
1133 Ga0496108_0145854
1134 Ga0496109_0017208
1135 Ga0496109_0017977
1136 Ga0496109_0137284
1137 Ga0496109_0219583
1138 Ga0496109_0428576
1139 Ga0496109_0741803
1140 Ga0496110_0016702
1141 Ga0496110_0103766
1142 Ga0496110_0143451
1143 Ga0496110_0383056
1144 Ga0496111_0007898
1145 Ga0496111_0012253
1146 Ga0496111_0013521
1147 Ga0496111_0119602
1148 Ga0496112_0018811
1149 Ga0496112_0027524
1150 Ga0496112_0032543
1151 Ga0496112_0047728
1152 Ga0496112_0065244
1153 Ga0496112_0102831
1154 Ga0496112_0116396
1155 Ga0496112_0127898
1156 Ga0496112_0697033
1157 Ga0496113_0006096
1158 Ga0496113_0027305
1159 Ga0496113_0100666
1160 Ga0496113_0242695
1161 Ga0496113_0344005
1162 Ga0496114_0000927
1163 Ga0496114_0015494
1164 Ga0496114_0028899
1165 Ga0496114_0031942
1166 Ga0496115_0053224
1167 Ga0496115_0074107
1168 Ga0496115_0077473
1169 Ga0496115_0186605
1170 Ga0496119_0168427
1171 Ga0496122_0003688
1172 Ga0496123_0000142
1173 Ga0496124_0000461
1174 Ga0496124_0406811
1175 Ga0496125_0043438
1176 Ga0496126_0040382
1177 Ga0496126_0093987
1178 Ga0496126_0161248
1179 Ga0496126_0240783
1180 Ga0501032_0000370
1181 Ga0501032_0074027
1182 Ga0501032_0444835
1183 Ga0501034_0000051
1184 Ga0501034_0026756
1185 Ga0501036_0191662
1186 Ga0501036_0302559
1187 Ga0501036_0483284
1188 Ga0501037_0013188
1189 Ga0501037_0017155
1190 Ga0501037_0029053
1191 Ga0501037_0093851
1192 Ga0501037_0156864
1193 Ga0501038_0000386
1194 Ga0501038_0015613
1195 Ga0501038_0064863
1196 Ga0501039_0121738
1197 Ga0501039_0329212
1198 Ga0501043_0012922
1199 Ga0501043_0015964
1200 Ga0501043_0021058
1201 Ga0501046_0016810
1202 Ga0501046_0019874
1203 Ga0501047_0022276
1204 Ga0501047_0026611
1205 Ga0501070_0039913
1206 Ga0501070_0156770
1207 Ga0501074_0433274
1208 Ga0501080_0157150
1209 Ga0501083_0003465
1210 Ga0501035_0038120
1211 Ga0501035_0067877
1212 Ga0501044_0006148
1213 Ga0501044_0048330
1214 nmdc:mga05p37_154014_c1
1215 nmdc:mga05p37_275147_c1
1216 nmdc:mga05p37_9718_c1
1217 nmdc:mga09592_8482_c1
1218 nmdc:mga0qj67_405449_c1
1219 nmdc:mga06r32_60156_c1
1220 nmdc:mga06r32_87767_c1
1221 nmdc:mga0n895_20064_c1
1222 nmdc:mga0a205_86888_c1
1223 Ga0495601_0003077
1224 Ga0500644_0027806
1225 Ga0500646_0000237
1226 Ga0500583_0019648
1227 Ga0500641_0057740
1228 Ga0500562_040603
1229 Ga0500588_0004322
1230 Ga0500616_0001577
1231 Ga0500616_0003190
1232 Ga0500633_0078005
1233 Ga0501084_0049728
1234 Ga0501082_0003943
1235 Ga0466962_0054640
1236 Ga0530510_0020488
1237 2537899772
1238 2644527667
1239 2644670712
1240 2676481218
1241 2691514524
1242 2729906989
1243 2738693430
1244 2739323156
1245 2739607747
1246 2760304239
1247 2760621818
1248 2775655145
1249 2808827604
1250 2808852971
1251 2808878579
1252 2808891855
1253 2808896967
1254 2809026625
1255 2810364159
1256 2812320608
1257 2831938460
1258 2835191138
1259 2844849471
1260 2848552823
1261 2857741389
1262 2861527389
1263 2884994679
1264 2887445806
1265 2904499924
1266 2904776568
1267 2905929128
1268 2910813822
1269 2919037690
1270 2919061762
1271 2919391347
1272 2919542081
1273 2932429174
1274 2933420658
1275 2939598582
1276 2939648938
1277 2939676129
1278 2945918367
1279 2945921347
1280 2945942478
1281 2945959763
1282 2946005295
1283 2946038407
1284 2946062222
1285 2953999682
1286 2974306393
1287 2995467255
1288 3001890759
1289 8003863431
1290 8004023381
1291 8004027867
1292 8047719856
1293 8054111100
1294 8056582621

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00459

Inositol_P

Inositol monophosphatase family

77

313

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zon-assembly1.cif.gz_B histidinol phosphate phosphatase from mycobacterium tuberculosis 0.9022 5 259
4n81-assembly1.cif.gz_A-2 another flexible region at the active site of an inositol monophosphatase from zymomonas mobilis 0.9008 11 259
5zon-assembly2.cif.gz_D histidinol phosphate phosphatase from mycobacterium tuberculosis 0.9004 4 259
5zon-assembly1.cif.gz_B histidinol phosphate phosphatase from mycobacterium tuberculosis 0.8986 5 259
5yht-assembly1.cif.gz_B crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate 0.8972 6 259
ID Description Score Start End Superfamily
4n81A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.967 146 259 3.40.190.80
af_A0A1D6FBS3_220_343_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9495 147 259 3.40.190.80
4n81A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9351 146 259 3.40.190.80
af_P95189_145_259_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.932 147 259 3.40.190.80
af_A4HWI6_353_462_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9192 185 261 3.40.190.80
ID Description Score Start End GO Terms
AF-A0A529T5C1-F1-model_v4 Histidinol-phosphatase 0.9766 129 260 GO:0006020
GO:0007165
GO:0008934
GO:0046872
AF-A0A661PDV2-F1-model_v4 Histidinol-phosphatase 0.9734 48 257 GO:0006020
GO:0007165
GO:0008934
GO:0046872
AF-A0A3M2DM86-F1-model_v4 Histidinol-phosphatase 0.9717 112 260 GO:0006020
GO:0007165
GO:0008934
GO:0046872
AF-A0A849F3S8-F1-model_v4 Histidinol-phosphatase 0.9695 119 258 GO:0000105
GO:0042578
GO:0046854
GO:0046872
AF-A0A4Q3YZD0-F1-model_v4 Histidinol-phosphatase 0.9693 81 260 GO:0006020
GO:0007165
GO:0008934
GO:0046872

Map