F472311
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 647 | 351 | 1294 | 269 |
Family's Representative Sequence
| Representative Sequence | 3300046460|Ga0495638_0053646|Ga0495638_0053646_693_1637 |
| Length | 314 |
| Sequence | MPTRSERAEPTSGIHRLDDAYATSVRSVHRLRVRYRSDASGSGRLGVNTDTVRAVGYDDDLRLAHVIADQVDAVTIARFTAVDLLVETKPDLTPVTDADRAAEELIRSQLRRTRPRDAVLGEEFGSSGRGSRQWIVDPIDGTKNFVRGVPVWATLIALVDDGVPVIGLVSAPALGRRWWAATGTGAWTGRSLSSARRLRVSAVEKLADASLSYASFRGWEDLDKGEAFLQLTRTVWRSRAYGDFWSYMLLAEGAVDLACEPELQLYDMAALVPIVVEAGGRFSSLAGVDGPFGGNAVASNGLLHSQLLSALNPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 56 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 62 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 63 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 93 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 142 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 143 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 144 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 145 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 146 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 147 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 148 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 149 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 150 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 151 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 153 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 154 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 155 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 156 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 157 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 158 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 159 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 160 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 163 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 165 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 166 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 167 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 168 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 169 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 170 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 171 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 172 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 173 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 174 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 175 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 176 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 179 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 180 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 181 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 182 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 183 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 184 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 185 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 186 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 187 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 188 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 189 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 190 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 191 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 192 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 193 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 194 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 195 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 196 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 197 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 198 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 199 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 200 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 201 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 202 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 242 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 243 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 244 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 245 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 250 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 251 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 252 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 253 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 254 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 255 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 256 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 257 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 258 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 259 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 260 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 283 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 284 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 285 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 286 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 287 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 288 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 289 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 290 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 293 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 294 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 295 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 296 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 297 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 298 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 299 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 300 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 301 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 302 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 303 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 304 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 305 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 306 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 307 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 308 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 309 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 310 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 311 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 312 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 313 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 314 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 315 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 316 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 317 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 318 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 319 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 320 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 321 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 322 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 323 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 324 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 325 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 326 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 327 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 328 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 329 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 330 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 331 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 332 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 333 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 334 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 335 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 336 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 337 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 338 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 339 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 340 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 341 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 342 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 343 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 344 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 345 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 346 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 347 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 348 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 349 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 350 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 351 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.73 |
| Metatranscriptomes | 0.31 |
| Isolates | 8.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.47 |
| Nodule | 0 |
| Rhizoplane | 10.97 |
| Rhizosphere | 78.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495638_0053646 | 3300046460 | Bacteria | 2509 |
| 2 | JGI24738J21930_10000450 | 3300002075 | Bacteria | 11641 |
| 3 | JGI25152J39213_1000085 | 3300002773 | Bacteria | 64570 |
| 4 | JGI25406J46586_10008596 | 3300003203 | Bacteria | 4613 |
| 5 | JGI25406J46586_10023330 | 3300003203 | Bacteria | 2446 |
| 6 | JGI25406J46586_10068618 | 3300003203 | Bacteria | 1119 |
| 7 | JGI25406J46586_10076236 | 3300003203 | Bacteria | 1038 |
| 8 | Ga0055542_1011376 | 3300003762 | Bacteria | 1581 |
| 9 | Ga0070658_10004438 | 3300005327 | Bacteria | 11426 |
| 10 | Ga0070683_100001033 | 3300005329 | Bacteria | 20895 |
| 11 | Ga0070683_100044638 | 3300005329 | Bacteria | 4088 |
| 12 | Ga0070683_100685071 | 3300005329 | Bacteria | 981 |
| 13 | Ga0068869_100097444 | 3300005334 | Bacteria | 2220 |
| 14 | Ga0070666_10135291 | 3300005335 | Bacteria | 1714 |
| 15 | Ga0070680_100039261 | 3300005336 | Bacteria | 3832 |
| 16 | Ga0068868_100003308 | 3300005338 | Bacteria | 11213 |
| 17 | Ga0070660_100059713 | 3300005339 | Bacteria | 2957 |
| 18 | Ga0070660_100166771 | 3300005339 | Bacteria | 1777 |
| 19 | Ga0070689_100016236 | 3300005340 | Bacteria | 5445 |
| 20 | Ga0070691_10113254 | 3300005341 | Bacteria | 1359 |
| 21 | Ga0070661_100036378 | 3300005344 | Bacteria | 3579 |
| 22 | Ga0070661_100261064 | 3300005344 | Bacteria | 1339 |
| 23 | Ga0070661_100337820 | 3300005344 | Bacteria | 1179 |
| 24 | Ga0070692_10024631 | 3300005345 | Bacteria | 2959 |
| 25 | Ga0070668_100006985 | 3300005347 | Bacteria | 8363 |
| 26 | Ga0070668_100029643 | 3300005347 | Bacteria | 4157 |
| 27 | Ga0070675_100001082 | 3300005354 | Bacteria | 19671 |
| 28 | Ga0070675_100455555 | 3300005354 | Bacteria | 1148 |
| 29 | Ga0070674_100214211 | 3300005356 | Bacteria | 1495 |
| 30 | Ga0070673_100116914 | 3300005364 | Bacteria | 2219 |
| 31 | Ga0070688_100331393 | 3300005365 | Bacteria | 1109 |
| 32 | Ga0070659_100010924 | 3300005366 | Bacteria | 6700 |
| 33 | Ga0070659_100033946 | 3300005366 | Bacteria | 3967 |
| 34 | Ga0070659_100055569 | 3300005366 | Bacteria | 3121 |
| 35 | Ga0070709_10032356 | 3300005434 | Bacteria | 3153 |
| 36 | Ga0070709_10035005 | 3300005434 | Bacteria | 3049 |
| 37 | Ga0070714_100004918 | 3300005435 | Bacteria | 10152 |
| 38 | Ga0070714_100024008 | 3300005435 | Bacteria | 5015 |
| 39 | Ga0070714_100046143 | 3300005435 | Bacteria | 3695 |
| 40 | Ga0070710_10146029 | 3300005437 | Bacteria | 1455 |
| 41 | Ga0070710_10193457 | 3300005437 | Bacteria | 1280 |
| 42 | Ga0070711_100348180 | 3300005439 | Bacteria | 1191 |
| 43 | Ga0070700_100108546 | 3300005441 | Bacteria | 1841 |
| 44 | Ga0070694_100076828 | 3300005444 | Bacteria | 2312 |
| 45 | Ga0070663_100003520 | 3300005455 | Bacteria | 9035 |
| 46 | Ga0070678_100028268 | 3300005456 | Bacteria | 3822 |
| 47 | Ga0070662_100003771 | 3300005457 | Bacteria | 9482 |
| 48 | Ga0070662_100152724 | 3300005457 | Bacteria | 1799 |
| 49 | Ga0070679_100074126 | 3300005530 | Bacteria | 3394 |
| 50 | Ga0070684_100026059 | 3300005535 | Bacteria | 4921 |
| 51 | Ga0068853_100017947 | 3300005539 | Bacteria | 5847 |
| 52 | Ga0070672_100077887 | 3300005543 | Bacteria | 2652 |
| 53 | Ga0070672_100287393 | 3300005543 | Bacteria | 1392 |
| 54 | Ga0070696_100052375 | 3300005546 | Bacteria | 2839 |
| 55 | Ga0070665_100053866 | 3300005548 | Bacteria | 4035 |
| 56 | Ga0070665_100066602 | 3300005548 | Bacteria | 3613 |
| 57 | Ga0070704_100099269 | 3300005549 | Bacteria | 2189 |
| 58 | Ga0068855_100008907 | 3300005563 | Bacteria | 12130 |
| 59 | Ga0070664_100012825 | 3300005564 | Bacteria | 6818 |
| 60 | Ga0070664_100155914 | 3300005564 | Bacteria | 2018 |
| 61 | Ga0070664_100218772 | 3300005564 | Bacteria | 1704 |
| 62 | Ga0070664_100361638 | 3300005564 | Bacteria | 1322 |
| 63 | Ga0068857_100094322 | 3300005577 | Bacteria | 2680 |
| 64 | Ga0068857_100412126 | 3300005577 | Bacteria | 1259 |
| 65 | Ga0068854_100124683 | 3300005578 | Bacteria | 1960 |
| 66 | Ga0070702_100008289 | 3300005615 | Bacteria | 5023 |
| 67 | Ga0070702_100019479 | 3300005615 | Bacteria | 3541 |
| 68 | Ga0068864_100003965 | 3300005618 | Bacteria | 12187 |
| 69 | Ga0068864_100062750 | 3300005618 | Bacteria | 3220 |
| 70 | Ga0068864_100157740 | 3300005618 | Bacteria | 2061 |
| 71 | Ga0068861_100032585 | 3300005719 | Bacteria | 3837 |
| 72 | Ga0068861_100316907 | 3300005719 | Bacteria | 1357 |
| 73 | Ga0068870_10069117 | 3300005840 | Bacteria | 1921 |
| 74 | Ga0068863_100115346 | 3300005841 | Bacteria | 2559 |
| 75 | Ga0068863_100145002 | 3300005841 | Bacteria | 2270 |
| 76 | Ga0068858_100092207 | 3300005842 | Bacteria | 2819 |
| 77 | Ga0068860_100058251 | 3300005843 | Bacteria | 3672 |
| 78 | Ga0068862_100045932 | 3300005844 | Bacteria | 3728 |
| 79 | Ga0081455_10137995 | 3300005937 | Bacteria | 1897 |
| 80 | Ga0081540_1016528 | 3300005983 | Bacteria | 4611 |
| 81 | Ga0081540_1027777 | 3300005983 | Bacteria | 3196 |
| 82 | Ga0081539_10000270 | 3300005985 | Bacteria | 118964 |
| 83 | Ga0081539_10002008 | 3300005985 | Bacteria | 30810 |
| 84 | Ga0070717_10012134 | 3300006028 | Bacteria | 6568 |
| 85 | Ga0070717_10271943 | 3300006028 | Bacteria | 1501 |
| 86 | Ga0075363_100215016 | 3300006048 | Bacteria | 1101 |
| 87 | Ga0075432_10012200 | 3300006058 | Bacteria | 2921 |
| 88 | Ga0075432_10016860 | 3300006058 | Bacteria | 2493 |
| 89 | Ga0075428_100005782 | 3300006844 | Bacteria | 13728 |
| 90 | Ga0075428_100216708 | 3300006844 | Bacteria | 2068 |
| 91 | Ga0075430_100250512 | 3300006846 | Bacteria | 1468 |
| 92 | Ga0075431_100006877 | 3300006847 | Bacteria | 11301 |
| 93 | Ga0075431_100020526 | 3300006847 | Bacteria | 6750 |
| 94 | Ga0075433_10044048 | 3300006852 | Bacteria | 3876 |
| 95 | Ga0075429_100000306 | 3300006880 | Bacteria | 34715 |
| 96 | Ga0075436_100031561 | 3300006914 | Bacteria | 3648 |
| 97 | Ga0105244_10003153 | 3300009036 | Bacteria | 11984 |
| 98 | Ga0105244_10029317 | 3300009036 | Bacteria | 2943 |
| 99 | Ga0105244_10040733 | 3300009036 | Bacteria | 2410 |
| 100 | Ga0105244_10099123 | 3300009036 | Bacteria | 1427 |
| 101 | Ga0111539_10005398 | 3300009094 | Bacteria | 16536 |
| 102 | Ga0111539_10134871 | 3300009094 | Bacteria | 2891 |
| 103 | Ga0111539_10539967 | 3300009094 | Bacteria | 1358 |
| 104 | Ga0111539_10565697 | 3300009094 | Bacteria | 1324 |
| 105 | Ga0105245_10006496 | 3300009098 | Bacteria | 10276 |
| 106 | Ga0105245_10006809 | 3300009098 | Bacteria | 10025 |
| 107 | Ga0105245_10175768 | 3300009098 | Bacteria | 2042 |
| 108 | Ga0105245_10227602 | 3300009098 | Bacteria | 1802 |
| 109 | Ga0105247_10014241 | 3300009101 | Bacteria | 4772 |
| 110 | Ga0114129_10130159 | 3300009147 | Bacteria | 3457 |
| 111 | Ga0114129_10186215 | 3300009147 | Bacteria | 2821 |
| 112 | Ga0114129_10243668 | 3300009147 | Bacteria | 2416 |
| 113 | Ga0105243_10006336 | 3300009148 | Bacteria | 9139 |
| 114 | Ga0105243_10058605 | 3300009148 | Bacteria | 3069 |
| 115 | Ga0105243_10071311 | 3300009148 | Bacteria | 2809 |
| 116 | Ga0105241_10200520 | 3300009174 | Bacteria | 1666 |
| 117 | Ga0105242_10177582 | 3300009176 | Bacteria | 1876 |
| 118 | Ga0105248_10161701 | 3300009177 | Bacteria | 2525 |
| 119 | Ga0105248_10391040 | 3300009177 | Bacteria | 1566 |
| 120 | Ga0105248_10438570 | 3300009177 | Bacteria | 1471 |
| 121 | Ga0105248_10914644 | 3300009177 | Bacteria | 991 |
| 122 | Ga0105238_10026906 | 3300009551 | Bacteria | 5862 |
| 123 | Ga0105238_10242563 | 3300009551 | Bacteria | 1780 |
| 124 | Ga0105249_10004106 | 3300009553 | Bacteria | 12571 |
| 125 | Ga0105249_10096861 | 3300009553 | Bacteria | 2769 |
| 126 | Ga0105249_10236971 | 3300009553 | Bacteria | 1802 |
| 127 | Ga0105239_10185856 | 3300010375 | Bacteria | 2325 |
| 128 | Ga0105239_10512879 | 3300010375 | Bacteria | 1364 |
| 129 | Ga0105246_10002983 | 3300011119 | Bacteria | 10253 |
| 130 | Ga0105246_10003045 | 3300011119 | Bacteria | 10171 |
| 131 | Ga0105246_10010929 | 3300011119 | Bacteria | 5629 |
| 132 | Ga0105246_10228077 | 3300011119 | Bacteria | 1465 |
| 133 | Ga0105246_10302779 | 3300011119 | Bacteria | 1291 |
| 134 | Ga0157373_10010255 | 3300013100 | Bacteria | 6901 |
| 135 | Ga0157371_10136640 | 3300013102 | Bacteria | 1746 |
| 136 | Ga0157370_10012783 | 3300013104 | Bacteria | 8681 |
| 137 | Ga0157370_10061215 | 3300013104 | Bacteria | 3573 |
| 138 | Ga0157369_10055355 | 3300013105 | Bacteria | 4282 |
| 139 | Ga0157369_10221237 | 3300013105 | Bacteria | 1982 |
| 140 | Ga0157374_10145930 | 3300013296 | Bacteria | 2298 |
| 141 | Ga0163162_10014986 | 3300013306 | Bacteria | 7573 |
| 142 | Ga0163162_10215334 | 3300013306 | Bacteria | 2051 |
| 143 | Ga0163162_10293831 | 3300013306 | Bacteria | 1756 |
| 144 | Ga0157375_10069034 | 3300013308 | Bacteria | 3539 |
| 145 | Ga0157375_10286346 | 3300013308 | Bacteria | 1811 |
| 146 | Ga0157375_10331769 | 3300013308 | Bacteria | 1686 |
| 147 | Ga0157375_10338841 | 3300013308 | Bacteria | 1669 |
| 148 | Ga0163163_10003868 | 3300014325 | Bacteria | 12755 |
| 149 | Ga0163163_10061583 | 3300014325 | Bacteria | 3718 |
| 150 | Ga0163163_10280530 | 3300014325 | Bacteria | 1717 |
| 151 | Ga0163163_10885180 | 3300014325 | Bacteria | 956 |
| 152 | Ga0157380_10015064 | 3300014326 | Bacteria | 5673 |
| 153 | Ga0157377_10047177 | 3300014745 | Bacteria | 2412 |
| 154 | Ga0157379_10006318 | 3300014968 | Bacteria | 10205 |
| 155 | Ga0157376_10093261 | 3300014969 | Bacteria | 2613 |
| 156 | Ga0163161_10007540 | 3300017792 | Bacteria | 7521 |
| 157 | Ga0163161_10244875 | 3300017792 | Bacteria | 1396 |
| 158 | Ga0197907_11498807 | 3300020069 | Bacteria | 1265 |
| 159 | Ga0206353_11891345 | 3300020082 | Bacteria | 2362 |
| 160 | Ga0209148_1000960 | 3300025254 | Bacteria | 18779 |
| 161 | Ga0209759_1013922 | 3300025256 | Bacteria | 2152 |
| 162 | Ga0209129_1000028 | 3300025258 | Bacteria | 405451 |
| 163 | Ga0209025_1000112 | 3300025294 | Bacteria | 218958 |
| 164 | Ga0209051_1001385 | 3300025303 | Bacteria | 20899 |
| 165 | Ga0207655_1018358 | 3300025728 | Bacteria | 3714 |
| 166 | Ga0207655_1019425 | 3300025728 | Bacteria | 3551 |
| 167 | Ga0207692_10012152 | 3300025898 | Bacteria | 3690 |
| 168 | Ga0207692_10108219 | 3300025898 | Bacteria | 1538 |
| 169 | Ga0207688_10000688 | 3300025901 | Bacteria | 16687 |
| 170 | Ga0207688_10089894 | 3300025901 | Bacteria | 1762 |
| 171 | Ga0207699_10052375 | 3300025906 | Bacteria | 2415 |
| 172 | Ga0207705_10050963 | 3300025909 | Bacteria | 2980 |
| 173 | Ga0207707_10153314 | 3300025912 | Bacteria | 2014 |
| 174 | Ga0207695_10352965 | 3300025913 | Bacteria | 1357 |
| 175 | Ga0207693_10000849 | 3300025915 | Bacteria | 27274 |
| 176 | Ga0207663_10031587 | 3300025916 | Bacteria | 3136 |
| 177 | Ga0207660_10129646 | 3300025917 | Bacteria | 1918 |
| 178 | Ga0207662_10017857 | 3300025918 | Bacteria | 4017 |
| 179 | Ga0207657_10034108 | 3300025919 | Bacteria | 4581 |
| 180 | Ga0207649_10029038 | 3300025920 | Bacteria | 3263 |
| 181 | Ga0207652_10202346 | 3300025921 | Bacteria | 1787 |
| 182 | Ga0207694_10013151 | 3300025924 | Bacteria | 6232 |
| 183 | Ga0207659_10003231 | 3300025926 | Bacteria | 9748 |
| 184 | Ga0207687_10039765 | 3300025927 | Bacteria | 3221 |
| 185 | Ga0207687_10414229 | 3300025927 | Bacteria | 1111 |
| 186 | Ga0207664_10056087 | 3300025929 | Bacteria | 3128 |
| 187 | Ga0207664_10102716 | 3300025929 | Bacteria | 2364 |
| 188 | Ga0207664_10170288 | 3300025929 | Bacteria | 1863 |
| 189 | Ga0207644_10169250 | 3300025931 | Bacteria | 1704 |
| 190 | Ga0207690_10009814 | 3300025932 | Bacteria | 5689 |
| 191 | Ga0207690_10021645 | 3300025932 | Bacteria | 3990 |
| 192 | Ga0207690_10237799 | 3300025932 | Bacteria | 1401 |
| 193 | Ga0207706_10041949 | 3300025933 | Bacteria | 4055 |
| 194 | Ga0207706_10097572 | 3300025933 | Bacteria | 2585 |
| 195 | Ga0207709_10040032 | 3300025935 | Bacteria | 2804 |
| 196 | Ga0207670_10203235 | 3300025936 | Bacteria | 1506 |
| 197 | Ga0207669_10205564 | 3300025937 | Bacteria | 1433 |
| 198 | Ga0207665_10004230 | 3300025939 | Bacteria | 9556 |
| 199 | Ga0207691_10136291 | 3300025940 | Bacteria | 2165 |
| 200 | Ga0207711_10397180 | 3300025941 | Bacteria | 1281 |
| 201 | Ga0207689_10004145 | 3300025942 | Bacteria | 13177 |
| 202 | Ga0207689_10019332 | 3300025942 | Bacteria | 5742 |
| 203 | Ga0207661_10018763 | 3300025944 | Bacteria | 5144 |
| 204 | Ga0207661_10105806 | 3300025944 | Bacteria | 2371 |
| 205 | Ga0207679_10012516 | 3300025945 | Bacteria | 5533 |
| 206 | Ga0207679_10048775 | 3300025945 | Bacteria | 3085 |
| 207 | Ga0207679_10208853 | 3300025945 | Bacteria | 1636 |
| 208 | Ga0207667_10013323 | 3300025949 | Bacteria | 9417 |
| 209 | Ga0207712_10137258 | 3300025961 | Bacteria | 1872 |
| 210 | Ga0207640_10050138 | 3300025981 | Bacteria | 2707 |
| 211 | Ga0207640_10118740 | 3300025981 | Bacteria | 1890 |
| 212 | Ga0207677_10003998 | 3300026023 | Bacteria | 7864 |
| 213 | Ga0207703_10242406 | 3300026035 | Bacteria | 1621 |
| 214 | Ga0207678_10003736 | 3300026067 | Bacteria | 13694 |
| 215 | Ga0207678_10088692 | 3300026067 | Bacteria | 2643 |
| 216 | Ga0207678_10313294 | 3300026067 | Bacteria | 1349 |
| 217 | Ga0207708_10016115 | 3300026075 | Bacteria | 5614 |
| 218 | Ga0207641_10012947 | 3300026088 | Bacteria | 6843 |
| 219 | Ga0207676_10112351 | 3300026095 | Bacteria | 2282 |
| 220 | Ga0207676_10119344 | 3300026095 | Bacteria | 2221 |
| 221 | Ga0207676_10376637 | 3300026095 | Bacteria | 1320 |
| 222 | Ga0207674_10038684 | 3300026116 | Bacteria | 4947 |
| 223 | Ga0207674_10160603 | 3300026116 | Bacteria | 2202 |
| 224 | Ga0207674_10551643 | 3300026116 | Bacteria | 1113 |
| 225 | Ga0207675_100084196 | 3300026118 | Bacteria | 2984 |
| 226 | Ga0207683_10052463 | 3300026121 | Bacteria | 3573 |
| 227 | Ga0207683_10243065 | 3300026121 | Bacteria | 1642 |
| 228 | Ga0207428_10019442 | 3300027907 | Bacteria | 5790 |
| 229 | Ga0207428_10026047 | 3300027907 | Bacteria | 4886 |
| 230 | Ga0207428_10035454 | 3300027907 | Bacteria | 4078 |
| 231 | Ga0268266_10087083 | 3300028379 | Bacteria | 2732 |
| 232 | Ga0268265_10013250 | 3300028380 | Bacteria | 5603 |
| 233 | Ga0307515_10000065 | 3300028794 | Bacteria | 244497 |
| 234 | Ga0307515_10065068 | 3300028794 | Bacteria | 5084 |
| 235 | Ga0307515_10203618 | 3300028794 | Bacteria | 1847 |
| 236 | Ga0307515_10456181 | 3300028794 | Bacteria | 893 |
| 237 | Ga0265340_10012498 | 3300031247 | Bacteria | 4482 |
| 238 | Ga0307513_10000149 | 3300031456 | Bacteria | 99930 |
| 239 | Ga0307513_10199099 | 3300031456 | Bacteria | 1846 |
| 240 | Ga0307408_100018562 | 3300031548 | Bacteria | 4671 |
| 241 | Ga0307408_100019897 | 3300031548 | Bacteria | 4522 |
| 242 | Ga0307408_100045798 | 3300031548 | Bacteria | 3126 |
| 243 | Ga0307408_100061342 | 3300031548 | Bacteria | 2745 |
| 244 | Ga0307408_100075093 | 3300031548 | Bacteria | 2510 |
| 245 | Ga0307408_100106264 | 3300031548 | Bacteria | 2147 |
| 246 | Ga0307408_100172426 | 3300031548 | Bacteria | 1728 |
| 247 | Ga0307408_100230501 | 3300031548 | Bacteria | 1516 |
| 248 | Ga0307408_100558485 | 3300031548 | Bacteria | 1011 |
| 249 | Ga0307408_100620005 | 3300031548 | Bacteria | 963 |
| 250 | Ga0307508_10000654 | 3300031616 | Bacteria | 41574 |
| 251 | Ga0307405_10021502 | 3300031731 | Bacteria | 3629 |
| 252 | Ga0307405_10031079 | 3300031731 | Bacteria | 3139 |
| 253 | Ga0307405_10086777 | 3300031731 | Bacteria | 2060 |
| 254 | Ga0307405_10125656 | 3300031731 | Bacteria | 1763 |
| 255 | Ga0307405_10136053 | 3300031731 | Bacteria | 1706 |
| 256 | Ga0307405_10165624 | 3300031731 | Bacteria | 1571 |
| 257 | Ga0307405_10255154 | 3300031731 | Bacteria | 1307 |
| 258 | Ga0307405_10262707 | 3300031731 | Bacteria | 1290 |
| 259 | Ga0307413_10007182 | 3300031824 | Bacteria | 5152 |
| 260 | Ga0307413_10016711 | 3300031824 | Bacteria | 3800 |
| 261 | Ga0307413_10029131 | 3300031824 | Bacteria | 3085 |
| 262 | Ga0307413_10029766 | 3300031824 | Bacteria | 3060 |
| 263 | Ga0307413_10185092 | 3300031824 | Bacteria | 1489 |
| 264 | Ga0307413_10268356 | 3300031824 | Bacteria | 1276 |
| 265 | Ga0307413_10447525 | 3300031824 | Bacteria | 1024 |
| 266 | Ga0307413_10454773 | 3300031824 | Bacteria | 1017 |
| 267 | Ga0307410_10002891 | 3300031852 | Bacteria | 8455 |
| 268 | Ga0307410_10020949 | 3300031852 | Bacteria | 4012 |
| 269 | Ga0307410_10031877 | 3300031852 | Bacteria | 3386 |
| 270 | Ga0307410_10033049 | 3300031852 | Bacteria | 3337 |
| 271 | Ga0307410_10064186 | 3300031852 | Bacteria | 2522 |
| 272 | Ga0307410_10100045 | 3300031852 | Bacteria | 2076 |
| 273 | Ga0307410_10163208 | 3300031852 | Bacteria | 1671 |
| 274 | Ga0307410_10211154 | 3300031852 | Bacteria | 1487 |
| 275 | Ga0307410_10325842 | 3300031852 | Bacteria | 1220 |
| 276 | Ga0307406_10006159 | 3300031901 | Bacteria | 6599 |
| 277 | Ga0307406_10024287 | 3300031901 | Bacteria | 3619 |
| 278 | Ga0307406_10069220 | 3300031901 | Bacteria | 2306 |
| 279 | Ga0307406_10072483 | 3300031901 | Bacteria | 2261 |
| 280 | Ga0307406_10118594 | 3300031901 | Bacteria | 1835 |
| 281 | Ga0307406_10171107 | 3300031901 | Bacteria | 1572 |
| 282 | Ga0307406_10192358 | 3300031901 | Bacteria | 1495 |
| 283 | Ga0307406_10371335 | 3300031901 | Bacteria | 1125 |
| 284 | Ga0307407_10225764 | 3300031903 | Bacteria | 1269 |
| 285 | Ga0307407_10448339 | 3300031903 | Bacteria | 936 |
| 286 | Ga0307407_10501669 | 3300031903 | Bacteria | 890 |
| 287 | Ga0307407_10526927 | 3300031903 | Bacteria | 870 |
| 288 | Ga0307412_10021483 | 3300031911 | Bacteria | 3943 |
| 289 | Ga0307412_10021500 | 3300031911 | Bacteria | 3942 |
| 290 | Ga0307412_10028867 | 3300031911 | Bacteria | 3477 |
| 291 | Ga0307412_10032907 | 3300031911 | Bacteria | 3290 |
| 292 | Ga0307412_10053406 | 3300031911 | Bacteria | 2678 |
| 293 | Ga0307412_10066985 | 3300031911 | Bacteria | 2436 |
| 294 | Ga0307412_10072817 | 3300031911 | Bacteria | 2349 |
| 295 | Ga0307412_10076121 | 3300031911 | Bacteria | 2304 |
| 296 | Ga0307412_10236799 | 3300031911 | Bacteria | 1409 |
| 297 | Ga0307412_10361816 | 3300031911 | Bacteria | 1168 |
| 298 | Ga0307409_100015197 | 3300031995 | Bacteria | 5041 |
| 299 | Ga0307409_100020466 | 3300031995 | Bacteria | 4511 |
| 300 | Ga0307409_100062342 | 3300031995 | Bacteria | 2918 |
| 301 | Ga0307409_100076918 | 3300031995 | Bacteria | 2678 |
| 302 | Ga0307409_100085881 | 3300031995 | Bacteria | 2559 |
| 303 | Ga0307409_100121856 | 3300031995 | Bacteria | 2210 |
| 304 | Ga0307409_100136999 | 3300031995 | Bacteria | 2102 |
| 305 | Ga0307409_100194249 | 3300031995 | Bacteria | 1810 |
| 306 | Ga0307409_100234661 | 3300031995 | Bacteria | 1665 |
| 307 | Ga0307409_100560631 | 3300031995 | Bacteria | 1123 |
| 308 | Ga0307416_100010594 | 3300032002 | Bacteria | 6099 |
| 309 | Ga0307416_100044024 | 3300032002 | Bacteria | 3501 |
| 310 | Ga0307416_100080602 | 3300032002 | Bacteria | 2748 |
| 311 | Ga0307416_100086738 | 3300032002 | Bacteria | 2669 |
| 312 | Ga0307416_100088044 | 3300032002 | Bacteria | 2653 |
| 313 | Ga0307416_100124610 | 3300032002 | Bacteria | 2305 |
| 314 | Ga0307416_100199739 | 3300032002 | Bacteria | 1896 |
| 315 | Ga0307416_100202350 | 3300032002 | Bacteria | 1885 |
| 316 | Ga0307416_100217114 | 3300032002 | Bacteria | 1830 |
| 317 | Ga0307416_100341442 | 3300032002 | Bacteria | 1510 |
| 318 | Ga0307416_100476211 | 3300032002 | Bacteria | 1307 |
| 319 | Ga0307416_100561222 | 3300032002 | Bacteria | 1216 |
| 320 | Ga0307416_100796983 | 3300032002 | Bacteria | 1040 |
| 321 | Ga0307414_10066991 | 3300032004 | Bacteria | 2569 |
| 322 | Ga0307414_10092908 | 3300032004 | Bacteria | 2248 |
| 323 | Ga0307414_10130004 | 3300032004 | Bacteria | 1953 |
| 324 | Ga0307414_10161967 | 3300032004 | Bacteria | 1778 |
| 325 | Ga0307411_10013910 | 3300032005 | Bacteria | 4460 |
| 326 | Ga0307411_10030215 | 3300032005 | Bacteria | 3319 |
| 327 | Ga0307411_10054445 | 3300032005 | Bacteria | 2627 |
| 328 | Ga0307411_10171497 | 3300032005 | Bacteria | 1637 |
| 329 | Ga0307415_100003929 | 3300032126 | Bacteria | 7639 |
| 330 | Ga0307415_100034893 | 3300032126 | Bacteria | 3280 |
| 331 | Ga0307415_100158165 | 3300032126 | Bacteria | 1753 |
| 332 | Ga0307415_100221231 | 3300032126 | Bacteria | 1518 |
| 333 | Ga0307415_100400460 | 3300032126 | Bacteria | 1172 |
| 334 | Ga0307415_100672139 | 3300032126 | Bacteria | 931 |
| 335 | Ga0307507_10000020 | 3300033179 | Bacteria | 220880 |
| 336 | Ga0307507_10039359 | 3300033179 | Bacteria | 4773 |
| 337 | Ga0373959_0018113 | 3300034820 | Bacteria | 1322 |
| 338 | Ga0373940_0010775 | 3300035088 | Bacteria | 2159 |
| 339 | Ga0373944_0058139 | 3300035089 | Bacteria | 1234 |
| 340 | Ga0373932_0028763 | 3300035112 | Bacteria | 1530 |
| 341 | Ga0373939_0003768 | 3300035114 | Bacteria | 3575 |
| 342 | Ga0373941_0011811 | 3300035115 | Bacteria | 2267 |
| 343 | Ga0373943_0025178 | 3300035170 | Bacteria | 2780 |
| 344 | Ga0373933_0158564 | 3300035724 | Bacteria | 1436 |
| 345 | Ga0373947_0025327 | 3300035725 | Bacteria | 3459 |
| 346 | Ga0395899_0027132 | 3300037312 | Bacteria | 4320 |
| 347 | Ga0395900_0010013 | 3300037418 | Bacteria | 9700 |
| 348 | Ga0395900_0020745 | 3300037418 | Bacteria | 6716 |
| 349 | Ga0395900_0122747 | 3300037418 | Bacteria | 2664 |
| 350 | Ga0395898_0063072 | 3300037466 | Bacteria | 3597 |
| 351 | Ga0395898_0398961 | 3300037466 | Bacteria | 1311 |
| 352 | Ga0395901_0074690 | 3300038443 | Bacteria | 3536 |
| 353 | Ga0395901_0093049 | 3300038443 | Bacteria | 3156 |
| 354 | Ga0439436_0030758 | 3300041404 | Bacteria | 1559 |
| 355 | Ga0439438_031967 | 3300041405 | Bacteria | 1397 |
| 356 | Ga0439439_0004876 | 3300041406 | Bacteria | 3040 |
| 357 | Ga0439461_0000758 | 3300041410 | Bacteria | 4717 |
| 358 | Ga0439461_0001970 | 3300041410 | Bacteria | 3242 |
| 359 | Ga0439466_0001793 | 3300041411 | Bacteria | 8403 |
| 360 | Ga0439466_0014536 | 3300041411 | Bacteria | 2865 |
| 361 | Ga0439466_0095510 | 3300041411 | Bacteria | 930 |
| 362 | Ga0451789_0014534 | 3300041443 | Bacteria | 1523 |
| 363 | Ga0451793_1920694 | 3300041452 | Bacteria | 1342 |
| 364 | Ga0451797_0529923 | 3300041453 | Bacteria | 1236 |
| 365 | Ga0451797_1438664 | 3300041453 | Bacteria | 774 |
| 366 | Ga0451853_0985435 | 3300041512 | Bacteria | 999 |
| 367 | Ga0439433_0003043 | 3300041999 | Bacteria | 3593 |
| 368 | Ga0439442_000001 | 3300042002 | Bacteria | 161142 |
| 369 | Ga0439442_000068 | 3300042002 | Bacteria | 24332 |
| 370 | Ga0439442_002116 | 3300042002 | Bacteria | 3903 |
| 371 | Ga0439442_005362 | 3300042002 | Bacteria | 2565 |
| 372 | Ga0439448_0032542 | 3300042005 | Bacteria | 1660 |
| 373 | Ga0439449_0000147 | 3300042007 | Bacteria | 23936 |
| 374 | Ga0439449_0002610 | 3300042007 | Bacteria | 7022 |
| 375 | Ga0439449_0016720 | 3300042007 | Bacteria | 2755 |
| 376 | Ga0439457_006366 | 3300042014 | Bacteria | 2898 |
| 377 | Ga0439457_007398 | 3300042014 | Bacteria | 2638 |
| 378 | Ga0439462_0013343 | 3300042015 | Bacteria | 2105 |
| 379 | Ga0439462_0018342 | 3300042015 | Bacteria | 1817 |
| 380 | Ga0450920_004324 | 3300042122 | Bacteria | 2490 |
| 381 | Ga0450907_000102 | 3300042146 | Bacteria | 32710 |
| 382 | Ga0450907_018660 | 3300042146 | Bacteria | 1161 |
| 383 | Ga0450908_002545 | 3300042184 | Bacteria | 3577 |
| 384 | Ga0439434_0000022 | 3300042435 | Bacteria | 37374 |
| 385 | Ga0439434_0000119 | 3300042435 | Bacteria | 20788 |
| 386 | Ga0439434_0000960 | 3300042435 | Bacteria | 8303 |
| 387 | Ga0450918_001152 | 3300042531 | Bacteria | 5418 |
| 388 | Ga0450918_003544 | 3300042531 | Bacteria | 2894 |
| 389 | Ga0466969_0001685 | 3300044656 | Bacteria | 11809 |
| 390 | Ga0466969_0012892 | 3300044656 | Bacteria | 4403 |
| 391 | Ga0466965_0286092 | 3300044683 | Bacteria | 891 |
| 392 | Ga0466966_0012173 | 3300044684 | Bacteria | 5700 |
| 393 | Ga0466966_0034327 | 3300044684 | Bacteria | 3280 |
| 394 | Ga0466966_0090057 | 3300044684 | Bacteria | 1905 |
| 395 | Ga0466961_0002853 | 3300044693 | Bacteria | 10721 |
| 396 | Ga0466961_0012402 | 3300044693 | Bacteria | 5451 |
| 397 | Ga0466971_0008173 | 3300044719 | Bacteria | 4560 |
| 398 | Ga0466971_0120538 | 3300044719 | Bacteria | 1214 |
| 399 | Ga0466971_0155615 | 3300044719 | Bacteria | 1068 |
| 400 | Ga0466970_0045460 | 3300044765 | Bacteria | 2338 |
| 401 | Ga0466957_0066702 | 3300044842 | Bacteria | 2219 |
| 402 | Ga0466960_0029095 | 3300044901 | Bacteria | 2533 |
| 403 | Ga0466959_0012689 | 3300045049 | Bacteria | 6096 |
| 404 | Ga0466959_0040398 | 3300045049 | Bacteria | 3446 |
| 405 | Ga0466959_0053621 | 3300045049 | Bacteria | 2947 |
| 406 | Ga0466959_0101950 | 3300045049 | Bacteria | 2054 |
| 407 | Ga0466958_0009244 | 3300045836 | Bacteria | 5487 |
| 408 | Ga0466967_0198801 | 3300045976 | Bacteria | 1898 |
| 409 | Ga0495603_0201932 | 3300046455 | Bacteria | 1149 |
| 410 | Ga0495651_0061031 | 3300046462 | Bacteria | 2886 |
| 411 | Ga0495580_0002711 | 3300046472 | Bacteria | 15306 |
| 412 | Ga0495580_0051968 | 3300046472 | Bacteria | 2896 |
| 413 | Ga0495582_0054618 | 3300046473 | Bacteria | 2202 |
| 414 | Ga0495582_0058109 | 3300046473 | Bacteria | 2133 |
| 415 | Ga0495639_0000709 | 3300046475 | Bacteria | 15271 |
| 416 | Ga0495664_0006373 | 3300046477 | Bacteria | 6522 |
| 417 | Ga0495596_0148696 | 3300046500 | Bacteria | 910 |
| 418 | Ga0495628_0004464 | 3300046516 | Bacteria | 12405 |
| 419 | Ga0495630_0099248 | 3300046517 | Bacteria | 2203 |
| 420 | Ga0495631_0124326 | 3300046518 | Bacteria | 1109 |
| 421 | Ga0495643_0040780 | 3300046522 | Bacteria | 2534 |
| 422 | Ga0495642_0005095 | 3300046528 | Bacteria | 5060 |
| 423 | Ga0495642_0139660 | 3300046528 | Bacteria | 1045 |
| 424 | Ga0495652_0218151 | 3300046529 | Bacteria | 1435 |
| 425 | Ga0495665_0211020 | 3300046531 | Bacteria | 1005 |
| 426 | Ga0495586_0001629 | 3300046535 | Bacteria | 12313 |
| 427 | Ga0495586_0006292 | 3300046535 | Bacteria | 6342 |
| 428 | Ga0495598_0049726 | 3300046537 | Bacteria | 1258 |
| 429 | Ga0495621_0078784 | 3300046539 | Bacteria | 1226 |
| 430 | Ga0495597_0044183 | 3300046542 | Bacteria | 1982 |
| 431 | Ga0495645_0008335 | 3300046543 | Bacteria | 7235 |
| 432 | Ga0495622_0072159 | 3300046557 | Bacteria | 1593 |
| 433 | Ga0495667_0240749 | 3300046559 | Bacteria | 1152 |
| 434 | Ga0495668_0178249 | 3300046616 | Bacteria | 1164 |
| 435 | Ga0495634_0077631 | 3300046642 | Bacteria | 2177 |
| 436 | Ga0495661_0089942 | 3300046665 | Bacteria | 1749 |
| 437 | Ga0495588_0006103 | 3300046674 | Bacteria | 5409 |
| 438 | Ga0495588_0010563 | 3300046674 | Bacteria | 4299 |
| 439 | Ga0495588_0184774 | 3300046674 | Bacteria | 1101 |
| 440 | Ga0495657_0016539 | 3300046675 | Bacteria | 5375 |
| 441 | Ga0495658_0017998 | 3300046683 | Bacteria | 3664 |
| 442 | Ga0495670_0126715 | 3300046691 | Bacteria | 1329 |
| 443 | Ga0495670_0137414 | 3300046691 | Bacteria | 1276 |
| 444 | Ga0495600_0056782 | 3300046809 | Bacteria | 2558 |
| 445 | Ga0495581_0005705 | 3300047315 | Bacteria | 7220 |
| 446 | Ga0495581_0008668 | 3300047315 | Bacteria | 5890 |
| 447 | Ga0495581_0237503 | 3300047315 | Bacteria | 1066 |
| 448 | Ga0495604_0056648 | 3300047317 | Bacteria | 3016 |
| 449 | Ga0495672_0129381 | 3300047320 | Bacteria | 1330 |
| 450 | Ga0495676_0016869 | 3300047321 | Bacteria | 6465 |
| 451 | Ga0495676_0023797 | 3300047321 | Bacteria | 5309 |
| 452 | Ga0495680_0038314 | 3300047322 | Bacteria | 3832 |
| 453 | Ga0495680_0110890 | 3300047322 | Bacteria | 2033 |
| 454 | Ga0495677_0132111 | 3300047445 | Bacteria | 956 |
| 455 | Ga0495684_0103434 | 3300047471 | Bacteria | 2153 |
| 456 | Ga0496100_0002615 | 3300048903 | Bacteria | 9177 |
| 457 | Ga0496100_0131624 | 3300048903 | Bacteria | 1762 |
| 458 | Ga0496100_0303042 | 3300048903 | Bacteria | 1196 |
| 459 | Ga0496100_0337326 | 3300048903 | Bacteria | 1136 |
| 460 | Ga0496101_0039374 | 3300048904 | Bacteria | 3361 |
| 461 | Ga0496101_0053527 | 3300048904 | Bacteria | 2912 |
| 462 | Ga0496101_0122009 | 3300048904 | Bacteria | 1971 |
| 463 | Ga0496101_0146120 | 3300048904 | Bacteria | 1806 |
| 464 | Ga0496102_0025412 | 3300048905 | Bacteria | 5272 |
| 465 | Ga0496102_0051000 | 3300048905 | Bacteria | 3769 |
| 466 | Ga0496102_0056805 | 3300048905 | Bacteria | 3571 |
| 467 | Ga0496102_0639917 | 3300048905 | Bacteria | 986 |
| 468 | Ga0496103_0001053 | 3300048906 | Bacteria | 19227 |
| 469 | Ga0496103_0078916 | 3300048906 | Bacteria | 2068 |
| 470 | Ga0496104_0003873 | 3300048907 | Bacteria | 12944 |
| 471 | Ga0496104_0074204 | 3300048907 | Bacteria | 3238 |
| 472 | Ga0496104_0171212 | 3300048907 | Bacteria | 2082 |
| 473 | Ga0496104_0350751 | 3300048907 | Bacteria | 1388 |
| 474 | Ga0496105_0022976 | 3300048908 | Bacteria | 5056 |
| 475 | Ga0496105_0105065 | 3300048908 | Bacteria | 2331 |
| 476 | Ga0496105_0117617 | 3300048908 | Bacteria | 2192 |
| 477 | Ga0496105_0174735 | 3300048908 | Bacteria | 1760 |
| 478 | Ga0496105_0230459 | 3300048908 | Bacteria | 1505 |
| 479 | Ga0496105_0492806 | 3300048908 | Bacteria | 963 |
| 480 | Ga0496106_0009324 | 3300048909 | Bacteria | 7255 |
| 481 | Ga0496107_0001827 | 3300048910 | Bacteria | 13429 |
| 482 | Ga0496107_0125592 | 3300048910 | Bacteria | 1892 |
| 483 | Ga0496107_0225703 | 3300048910 | Bacteria | 1393 |
| 484 | Ga0496108_0003330 | 3300048911 | Bacteria | 12912 |
| 485 | Ga0496108_0063758 | 3300048911 | Bacteria | 3103 |
| 486 | Ga0496108_0145854 | 3300048911 | Bacteria | 2040 |
| 487 | Ga0496109_0017208 | 3300048912 | Bacteria | 6331 |
| 488 | Ga0496109_0017977 | 3300048912 | Bacteria | 6207 |
| 489 | Ga0496109_0137284 | 3300048912 | Bacteria | 2285 |
| 490 | Ga0496109_0219583 | 3300048912 | Bacteria | 1787 |
| 491 | Ga0496109_0428576 | 3300048912 | Bacteria | 1249 |
| 492 | Ga0496109_0741803 | 3300048912 | Bacteria | 920 |
| 493 | Ga0496110_0016702 | 3300048913 | Bacteria | 6130 |
| 494 | Ga0496110_0103766 | 3300048913 | Bacteria | 2550 |
| 495 | Ga0496110_0143451 | 3300048913 | Bacteria | 2159 |
| 496 | Ga0496110_0383056 | 3300048913 | Bacteria | 1281 |
| 497 | Ga0496111_0007898 | 3300048914 | Bacteria | 7015 |
| 498 | Ga0496111_0012253 | 3300048914 | Bacteria | 5801 |
| 499 | Ga0496111_0013521 | 3300048914 | Bacteria | 5558 |
| 500 | Ga0496111_0119602 | 3300048914 | Bacteria | 1945 |
| 501 | Ga0496112_0018811 | 3300048915 | Bacteria | 6510 |
| 502 | Ga0496112_0027524 | 3300048915 | Bacteria | 5481 |
| 503 | Ga0496112_0032543 | 3300048915 | Bacteria | 5064 |
| 504 | Ga0496112_0047728 | 3300048915 | Bacteria | 4200 |
| 505 | Ga0496112_0065244 | 3300048915 | Bacteria | 3593 |
| 506 | Ga0496112_0102831 | 3300048915 | Bacteria | 2827 |
| 507 | Ga0496112_0116396 | 3300048915 | Bacteria | 2644 |
| 508 | Ga0496112_0127898 | 3300048915 | Bacteria | 2511 |
| 509 | Ga0496112_0697033 | 3300048915 | Bacteria | 943 |
| 510 | Ga0496113_0006096 | 3300048916 | Bacteria | 7605 |
| 511 | Ga0496113_0027305 | 3300048916 | Bacteria | 4091 |
| 512 | Ga0496113_0100666 | 3300048916 | Bacteria | 2239 |
| 513 | Ga0496113_0242695 | 3300048916 | Bacteria | 1437 |
| 514 | Ga0496113_0344005 | 3300048916 | Bacteria | 1196 |
| 515 | Ga0496114_0000927 | 3300048917 | Bacteria | 21944 |
| 516 | Ga0496114_0015494 | 3300048917 | Bacteria | 6129 |
| 517 | Ga0496114_0028899 | 3300048917 | Bacteria | 4554 |
| 518 | Ga0496114_0031942 | 3300048917 | Bacteria | 4331 |
| 519 | Ga0496115_0053224 | 3300048918 | Bacteria | 3248 |
| 520 | Ga0496115_0074107 | 3300048918 | Bacteria | 2764 |
| 521 | Ga0496115_0077473 | 3300048918 | Bacteria | 2703 |
| 522 | Ga0496115_0186605 | 3300048918 | Bacteria | 1713 |
| 523 | Ga0496119_0168427 | 3300048922 | Bacteria | 1159 |
| 524 | Ga0496122_0003688 | 3300048925 | Bacteria | 19851 |
| 525 | Ga0496123_0000142 | 3300048926 | Bacteria | 146932 |
| 526 | Ga0496124_0000461 | 3300048927 | Bacteria | 70566 |
| 527 | Ga0496124_0406811 | 3300048927 | Bacteria | 943 |
| 528 | Ga0496125_0043438 | 3300048928 | Bacteria | 3815 |
| 529 | Ga0496126_0040382 | 3300048929 | Bacteria | 4325 |
| 530 | Ga0496126_0093987 | 3300048929 | Bacteria | 2632 |
| 531 | Ga0496126_0161248 | 3300048929 | Bacteria | 1916 |
| 532 | Ga0496126_0240783 | 3300048929 | Bacteria | 1511 |
| 533 | Ga0501032_0000370 | 3300049569 | Bacteria | 37322 |
| 534 | Ga0501032_0074027 | 3300049569 | Bacteria | 2269 |
| 535 | Ga0501032_0444835 | 3300049569 | Bacteria | 830 |
| 536 | Ga0501034_0000051 | 3300049571 | Bacteria | 210960 |
| 537 | Ga0501034_0026756 | 3300049571 | Bacteria | 5869 |
| 538 | Ga0501036_0191662 | 3300049572 | Bacteria | 1720 |
| 539 | Ga0501036_0302559 | 3300049572 | Bacteria | 1337 |
| 540 | Ga0501036_0483284 | 3300049572 | Bacteria | 1031 |
| 541 | Ga0501037_0013188 | 3300049573 | Bacteria | 6093 |
| 542 | Ga0501037_0017155 | 3300049573 | Bacteria | 5329 |
| 543 | Ga0501037_0029053 | 3300049573 | Bacteria | 4083 |
| 544 | Ga0501037_0093851 | 3300049573 | Bacteria | 2170 |
| 545 | Ga0501037_0156864 | 3300049573 | Bacteria | 1624 |
| 546 | Ga0501038_0000386 | 3300049574 | Bacteria | 38058 |
| 547 | Ga0501038_0015613 | 3300049574 | Bacteria | 6903 |
| 548 | Ga0501038_0064863 | 3300049574 | Bacteria | 3113 |
| 549 | Ga0501039_0121738 | 3300049575 | Bacteria | 2045 |
| 550 | Ga0501039_0329212 | 3300049575 | Bacteria | 1200 |
| 551 | Ga0501043_0012922 | 3300049579 | Bacteria | 6526 |
| 552 | Ga0501043_0015964 | 3300049579 | Bacteria | 5886 |
| 553 | Ga0501043_0021058 | 3300049579 | Bacteria | 5112 |
| 554 | Ga0501046_0016810 | 3300049580 | Bacteria | 6117 |
| 555 | Ga0501046_0019874 | 3300049580 | Bacteria | 5563 |
| 556 | Ga0501047_0022276 | 3300049581 | Bacteria | 6086 |
| 557 | Ga0501047_0026611 | 3300049581 | Bacteria | 5566 |
| 558 | Ga0501070_0039913 | 3300049586 | Bacteria | 3915 |
| 559 | Ga0501070_0156770 | 3300049586 | Bacteria | 1878 |
| 560 | Ga0501074_0433274 | 3300049590 | Bacteria | 932 |
| 561 | Ga0501080_0157150 | 3300049742 | Bacteria | 2100 |
| 562 | Ga0501083_0003465 | 3300049744 | Bacteria | 11030 |
| 563 | Ga0501035_0038120 | 3300049822 | Bacteria | 4352 |
| 564 | Ga0501035_0067877 | 3300049822 | Bacteria | 3163 |
| 565 | Ga0501044_0006148 | 3300049823 | Bacteria | 13260 |
| 566 | Ga0501044_0048330 | 3300049823 | Bacteria | 4395 |
| 567 | nmdc:mga05p37_154014_c1 | 3300050507 | Bacteria | 2810 |
| 568 | nmdc:mga05p37_275147_c1 | 3300050507 | Bacteria | 2010 |
| 569 | nmdc:mga05p37_9718_c1 | 3300050507 | Bacteria | 11405 |
| 570 | nmdc:mga09592_8482_c1 | 3300050508 | Bacteria | 8358 |
| 571 | nmdc:mga0qj67_405449_c1 | 3300050509 | Bacteria | 1100 |
| 572 | nmdc:mga06r32_60156_c1 | 3300050510 | Bacteria | 3655 |
| 573 | nmdc:mga06r32_87767_c1 | 3300050510 | Bacteria | 3036 |
| 574 | nmdc:mga0n895_20064_c1 | 3300050512 | Bacteria | 6224 |
| 575 | nmdc:mga0a205_86888_c1 | 3300050515 | Bacteria | 3021 |
| 576 | Ga0495601_0003077 | 3300053077 | Bacteria | 9516 |
| 577 | Ga0500644_0027806 | 3300053088 | Bacteria | 1763 |
| 578 | Ga0500646_0000237 | 3300053090 | Bacteria | 16818 |
| 579 | Ga0500583_0019648 | 3300053092 | Bacteria | 2774 |
| 580 | Ga0500641_0057740 | 3300053096 | Bacteria | 1610 |
| 581 | Ga0500562_040603 | 3300053108 | Bacteria | 1237 |
| 582 | Ga0500588_0004322 | 3300053146 | Bacteria | 3072 |
| 583 | Ga0500616_0001577 | 3300053153 | Bacteria | 21289 |
| 584 | Ga0500616_0003190 | 3300053153 | Bacteria | 12766 |
| 585 | Ga0500633_0078005 | 3300053160 | Bacteria | 1194 |
| 586 | Ga0501084_0049728 | 3300054114 | Bacteria | 3509 |
| 587 | Ga0501082_0003943 | 3300060353 | Bacteria | 12954 |
| 588 | Ga0466962_0054640 | 3300061719 | Bacteria | 1908 |
| 589 | Ga0530510_0020488 | 3300061734 | Bacteria | 4702 |
| 590 | 2537899772 | 2537561592 | Bacteria | 4348607 |
| 591 | 2644527667 | 2643221694 | Bacteria | 4392972 |
| 592 | 2644670712 | 2643221722 | Bacteria | 4247614 |
| 593 | 2676481218 | 2675903059 | Bacteria | 8644972 |
| 594 | 2691514524 | 2690315906 | Bacteria | 4517044 |
| 595 | 2729906989 | 2728369276 | Bacteria | 5610032 |
| 596 | 2738693430 | 2738541272 | Bacteria | 6848551 |
| 597 | 2739323156 | 2738543027 | Bacteria | 6409078 |
| 598 | 2739607747 | 2739367654 | Bacteria | 6049412 |
| 599 | 2760304239 | 2758568522 | Bacteria | 5953541 |
| 600 | 2760621818 | 2758568621 | Bacteria | 5967089 |
| 601 | 2775655145 | 2775506735 | Bacteria | 4556596 |
| 602 | 2808827604 | 2808606357 | Bacteria | 4466944 |
| 603 | 2808852971 | 2808606360 | Bacteria | 4404006 |
| 604 | 2808878579 | 2808606366 | Bacteria | 4415912 |
| 605 | 2808891855 | 2808606370 | Bacteria | 4942454 |
| 606 | 2808896967 | 2808606371 | Bacteria | 4251511 |
| 607 | 2809026625 | 2808606394 | Bacteria | 6248540 |
| 608 | 2810364159 | 2808606700 | Bacteria | 3482157 |
| 609 | 2812320608 | 2811994871 | Bacteria | 4497550 |
| 610 | 2831938460 | 2831935698 | Bacteria | 5963223 |
| 611 | 2835191138 | 2835188231 | Bacteria | 3476928 |
| 612 | 2844849471 | 2844849076 | Bacteria | 4091819 |
| 613 | 2848552823 | 2848551377 | Bacteria | 3720646 |
| 614 | 2857741389 | 2857740372 | Bacteria | 4782044 |
| 615 | 2861527389 | 2861520306 | Bacteria | 8348283 |
| 616 | 2884994679 | 2884994152 | Bacteria | 4492978 |
| 617 | 2887445806 | 2887443736 | Bacteria | 4426037 |
| 618 | 2904499924 | 2904497146 | Bacteria | 4731781 |
| 619 | 2904776568 | 2904776348 | Bacteria | 4658726 |
| 620 | 2905929128 | 2905926851 | Bacteria | 4423176 |
| 621 | 2910813822 | 2910809715 | Bacteria | 4982797 |
| 622 | 2919037690 | 2919034639 | Bacteria | 4763403 |
| 623 | 2919061762 | 2919059106 | Bacteria | 4991624 |
| 624 | 2919391347 | 2919391150 | Bacteria | 4884741 |
| 625 | 2919542081 | 2919538618 | Bacteria | 4677069 |
| 626 | 2932429174 | 2932426870 | Bacteria | 4547726 |
| 627 | 2933420658 | 2933418574 | Bacteria | 4476724 |
| 628 | 2939598582 | 2939598168 | Bacteria | 4687164 |
| 629 | 2939648938 | 2939647034 | Bacteria | 4681660 |
| 630 | 2939676129 | 2939674588 | Bacteria | 4844420 |
| 631 | 2945918367 | 2945916053 | Bacteria | 4555517 |
| 632 | 2945921347 | 2945920336 | Bacteria | 4501603 |
| 633 | 2945942478 | 2945941187 | Bacteria | 4682474 |
| 634 | 2945959763 | 2945956166 | Bacteria | 5110334 |
| 635 | 2946005295 | 2946003308 | Bacteria | 3857229 |
| 636 | 2946038407 | 2946037020 | Bacteria | 4900426 |
| 637 | 2946062222 | 2946059875 | Bacteria | 4386623 |
| 638 | 2953999682 | 2953998280 | Bacteria | 4812144 |
| 639 | 2974306393 | 2974302888 | Bacteria | 4369871 |
| 640 | 2995467255 | 2995463766 | Bacteria | 8577691 |
| 641 | 3001890759 | 3001889506 | Bacteria | 2975194 |
| 642 | 8003863431 | 8003856774 | Bacteria | 7675274 |
| 643 | 8004023381 | 8004021418 | Bacteria | 4313954 |
| 644 | 8004027867 | 8004025490 | Bacteria | 4327753 |
| 645 | 8047719856 | 8047710418 | Bacteria | 11023148 |
| 646 | 8054111100 | 8054107350 | Bacteria | 5022511 |
| 647 | 8056582621 | 8056579771 | Bacteria | 5840325 |
| 648 | Ga0495638_0053646 | |||
| 649 | JGI24738J21930_10000450 | |||
| 650 | JGI25152J39213_1000085 | |||
| 651 | JGI25406J46586_10008596 | |||
| 652 | JGI25406J46586_10023330 | |||
| 653 | JGI25406J46586_10068618 | |||
| 654 | JGI25406J46586_10076236 | |||
| 655 | Ga0055542_1011376 | |||
| 656 | Ga0070658_10004438 | |||
| 657 | Ga0070683_100001033 | |||
| 658 | Ga0070683_100044638 | |||
| 659 | Ga0070683_100685071 | |||
| 660 | Ga0068869_100097444 | |||
| 661 | Ga0070666_10135291 | |||
| 662 | Ga0070680_100039261 | |||
| 663 | Ga0068868_100003308 | |||
| 664 | Ga0070660_100059713 | |||
| 665 | Ga0070660_100166771 | |||
| 666 | Ga0070689_100016236 | |||
| 667 | Ga0070691_10113254 | |||
| 668 | Ga0070661_100036378 | |||
| 669 | Ga0070661_100261064 | |||
| 670 | Ga0070661_100337820 | |||
| 671 | Ga0070692_10024631 | |||
| 672 | Ga0070668_100006985 | |||
| 673 | Ga0070668_100029643 | |||
| 674 | Ga0070675_100001082 | |||
| 675 | Ga0070675_100455555 | |||
| 676 | Ga0070674_100214211 | |||
| 677 | Ga0070673_100116914 | |||
| 678 | Ga0070688_100331393 | |||
| 679 | Ga0070659_100010924 | |||
| 680 | Ga0070659_100033946 | |||
| 681 | Ga0070659_100055569 | |||
| 682 | Ga0070709_10032356 | |||
| 683 | Ga0070709_10035005 | |||
| 684 | Ga0070714_100004918 | |||
| 685 | Ga0070714_100024008 | |||
| 686 | Ga0070714_100046143 | |||
| 687 | Ga0070710_10146029 | |||
| 688 | Ga0070710_10193457 | |||
| 689 | Ga0070711_100348180 | |||
| 690 | Ga0070700_100108546 | |||
| 691 | Ga0070694_100076828 | |||
| 692 | Ga0070663_100003520 | |||
| 693 | Ga0070678_100028268 | |||
| 694 | Ga0070662_100003771 | |||
| 695 | Ga0070662_100152724 | |||
| 696 | Ga0070679_100074126 | |||
| 697 | Ga0070684_100026059 | |||
| 698 | Ga0068853_100017947 | |||
| 699 | Ga0070672_100077887 | |||
| 700 | Ga0070672_100287393 | |||
| 701 | Ga0070696_100052375 | |||
| 702 | Ga0070665_100053866 | |||
| 703 | Ga0070665_100066602 | |||
| 704 | Ga0070704_100099269 | |||
| 705 | Ga0068855_100008907 | |||
| 706 | Ga0070664_100012825 | |||
| 707 | Ga0070664_100155914 | |||
| 708 | Ga0070664_100218772 | |||
| 709 | Ga0070664_100361638 | |||
| 710 | Ga0068857_100094322 | |||
| 711 | Ga0068857_100412126 | |||
| 712 | Ga0068854_100124683 | |||
| 713 | Ga0070702_100008289 | |||
| 714 | Ga0070702_100019479 | |||
| 715 | Ga0068864_100003965 | |||
| 716 | Ga0068864_100062750 | |||
| 717 | Ga0068864_100157740 | |||
| 718 | Ga0068861_100032585 | |||
| 719 | Ga0068861_100316907 | |||
| 720 | Ga0068870_10069117 | |||
| 721 | Ga0068863_100115346 | |||
| 722 | Ga0068863_100145002 | |||
| 723 | Ga0068858_100092207 | |||
| 724 | Ga0068860_100058251 | |||
| 725 | Ga0068862_100045932 | |||
| 726 | Ga0081455_10137995 | |||
| 727 | Ga0081540_1016528 | |||
| 728 | Ga0081540_1027777 | |||
| 729 | Ga0081539_10000270 | |||
| 730 | Ga0081539_10002008 | |||
| 731 | Ga0070717_10012134 | |||
| 732 | Ga0070717_10271943 | |||
| 733 | Ga0075363_100215016 | |||
| 734 | Ga0075432_10012200 | |||
| 735 | Ga0075432_10016860 | |||
| 736 | Ga0075428_100005782 | |||
| 737 | Ga0075428_100216708 | |||
| 738 | Ga0075430_100250512 | |||
| 739 | Ga0075431_100006877 | |||
| 740 | Ga0075431_100020526 | |||
| 741 | Ga0075433_10044048 | |||
| 742 | Ga0075429_100000306 | |||
| 743 | Ga0075436_100031561 | |||
| 744 | Ga0105244_10003153 | |||
| 745 | Ga0105244_10029317 | |||
| 746 | Ga0105244_10040733 | |||
| 747 | Ga0105244_10099123 | |||
| 748 | Ga0111539_10005398 | |||
| 749 | Ga0111539_10134871 | |||
| 750 | Ga0111539_10539967 | |||
| 751 | Ga0111539_10565697 | |||
| 752 | Ga0105245_10006496 | |||
| 753 | Ga0105245_10006809 | |||
| 754 | Ga0105245_10175768 | |||
| 755 | Ga0105245_10227602 | |||
| 756 | Ga0105247_10014241 | |||
| 757 | Ga0114129_10130159 | |||
| 758 | Ga0114129_10186215 | |||
| 759 | Ga0114129_10243668 | |||
| 760 | Ga0105243_10006336 | |||
| 761 | Ga0105243_10058605 | |||
| 762 | Ga0105243_10071311 | |||
| 763 | Ga0105241_10200520 | |||
| 764 | Ga0105242_10177582 | |||
| 765 | Ga0105248_10161701 | |||
| 766 | Ga0105248_10391040 | |||
| 767 | Ga0105248_10438570 | |||
| 768 | Ga0105248_10914644 | |||
| 769 | Ga0105238_10026906 | |||
| 770 | Ga0105238_10242563 | |||
| 771 | Ga0105249_10004106 | |||
| 772 | Ga0105249_10096861 | |||
| 773 | Ga0105249_10236971 | |||
| 774 | Ga0105239_10185856 | |||
| 775 | Ga0105239_10512879 | |||
| 776 | Ga0105246_10002983 | |||
| 777 | Ga0105246_10003045 | |||
| 778 | Ga0105246_10010929 | |||
| 779 | Ga0105246_10228077 | |||
| 780 | Ga0105246_10302779 | |||
| 781 | Ga0157373_10010255 | |||
| 782 | Ga0157371_10136640 | |||
| 783 | Ga0157370_10012783 | |||
| 784 | Ga0157370_10061215 | |||
| 785 | Ga0157369_10055355 | |||
| 786 | Ga0157369_10221237 | |||
| 787 | Ga0157374_10145930 | |||
| 788 | Ga0163162_10014986 | |||
| 789 | Ga0163162_10215334 | |||
| 790 | Ga0163162_10293831 | |||
| 791 | Ga0157375_10069034 | |||
| 792 | Ga0157375_10286346 | |||
| 793 | Ga0157375_10331769 | |||
| 794 | Ga0157375_10338841 | |||
| 795 | Ga0163163_10003868 | |||
| 796 | Ga0163163_10061583 | |||
| 797 | Ga0163163_10280530 | |||
| 798 | Ga0163163_10885180 | |||
| 799 | Ga0157380_10015064 | |||
| 800 | Ga0157377_10047177 | |||
| 801 | Ga0157379_10006318 | |||
| 802 | Ga0157376_10093261 | |||
| 803 | Ga0163161_10007540 | |||
| 804 | Ga0163161_10244875 | |||
| 805 | Ga0197907_11498807 | |||
| 806 | Ga0206353_11891345 | |||
| 807 | Ga0209148_1000960 | |||
| 808 | Ga0209759_1013922 | |||
| 809 | Ga0209129_1000028 | |||
| 810 | Ga0209025_1000112 | |||
| 811 | Ga0209051_1001385 | |||
| 812 | Ga0207655_1018358 | |||
| 813 | Ga0207655_1019425 | |||
| 814 | Ga0207692_10012152 | |||
| 815 | Ga0207692_10108219 | |||
| 816 | Ga0207688_10000688 | |||
| 817 | Ga0207688_10089894 | |||
| 818 | Ga0207699_10052375 | |||
| 819 | Ga0207705_10050963 | |||
| 820 | Ga0207707_10153314 | |||
| 821 | Ga0207695_10352965 | |||
| 822 | Ga0207693_10000849 | |||
| 823 | Ga0207663_10031587 | |||
| 824 | Ga0207660_10129646 | |||
| 825 | Ga0207662_10017857 | |||
| 826 | Ga0207657_10034108 | |||
| 827 | Ga0207649_10029038 | |||
| 828 | Ga0207652_10202346 | |||
| 829 | Ga0207694_10013151 | |||
| 830 | Ga0207659_10003231 | |||
| 831 | Ga0207687_10039765 | |||
| 832 | Ga0207687_10414229 | |||
| 833 | Ga0207664_10056087 | |||
| 834 | Ga0207664_10102716 | |||
| 835 | Ga0207664_10170288 | |||
| 836 | Ga0207644_10169250 | |||
| 837 | Ga0207690_10009814 | |||
| 838 | Ga0207690_10021645 | |||
| 839 | Ga0207690_10237799 | |||
| 840 | Ga0207706_10041949 | |||
| 841 | Ga0207706_10097572 | |||
| 842 | Ga0207709_10040032 | |||
| 843 | Ga0207670_10203235 | |||
| 844 | Ga0207669_10205564 | |||
| 845 | Ga0207665_10004230 | |||
| 846 | Ga0207691_10136291 | |||
| 847 | Ga0207711_10397180 | |||
| 848 | Ga0207689_10004145 | |||
| 849 | Ga0207689_10019332 | |||
| 850 | Ga0207661_10018763 | |||
| 851 | Ga0207661_10105806 | |||
| 852 | Ga0207679_10012516 | |||
| 853 | Ga0207679_10048775 | |||
| 854 | Ga0207679_10208853 | |||
| 855 | Ga0207667_10013323 | |||
| 856 | Ga0207712_10137258 | |||
| 857 | Ga0207640_10050138 | |||
| 858 | Ga0207640_10118740 | |||
| 859 | Ga0207677_10003998 | |||
| 860 | Ga0207703_10242406 | |||
| 861 | Ga0207678_10003736 | |||
| 862 | Ga0207678_10088692 | |||
| 863 | Ga0207678_10313294 | |||
| 864 | Ga0207708_10016115 | |||
| 865 | Ga0207641_10012947 | |||
| 866 | Ga0207676_10112351 | |||
| 867 | Ga0207676_10119344 | |||
| 868 | Ga0207676_10376637 | |||
| 869 | Ga0207674_10038684 | |||
| 870 | Ga0207674_10160603 | |||
| 871 | Ga0207674_10551643 | |||
| 872 | Ga0207675_100084196 | |||
| 873 | Ga0207683_10052463 | |||
| 874 | Ga0207683_10243065 | |||
| 875 | Ga0207428_10019442 | |||
| 876 | Ga0207428_10026047 | |||
| 877 | Ga0207428_10035454 | |||
| 878 | Ga0268266_10087083 | |||
| 879 | Ga0268265_10013250 | |||
| 880 | Ga0307515_10000065 | |||
| 881 | Ga0307515_10065068 | |||
| 882 | Ga0307515_10203618 | |||
| 883 | Ga0307515_10456181 | |||
| 884 | Ga0265340_10012498 | |||
| 885 | Ga0307513_10000149 | |||
| 886 | Ga0307513_10199099 | |||
| 887 | Ga0307408_100018562 | |||
| 888 | Ga0307408_100019897 | |||
| 889 | Ga0307408_100045798 | |||
| 890 | Ga0307408_100061342 | |||
| 891 | Ga0307408_100075093 | |||
| 892 | Ga0307408_100106264 | |||
| 893 | Ga0307408_100172426 | |||
| 894 | Ga0307408_100230501 | |||
| 895 | Ga0307408_100558485 | |||
| 896 | Ga0307408_100620005 | |||
| 897 | Ga0307508_10000654 | |||
| 898 | Ga0307405_10021502 | |||
| 899 | Ga0307405_10031079 | |||
| 900 | Ga0307405_10086777 | |||
| 901 | Ga0307405_10125656 | |||
| 902 | Ga0307405_10136053 | |||
| 903 | Ga0307405_10165624 | |||
| 904 | Ga0307405_10255154 | |||
| 905 | Ga0307405_10262707 | |||
| 906 | Ga0307413_10007182 | |||
| 907 | Ga0307413_10016711 | |||
| 908 | Ga0307413_10029131 | |||
| 909 | Ga0307413_10029766 | |||
| 910 | Ga0307413_10185092 | |||
| 911 | Ga0307413_10268356 | |||
| 912 | Ga0307413_10447525 | |||
| 913 | Ga0307413_10454773 | |||
| 914 | Ga0307410_10002891 | |||
| 915 | Ga0307410_10020949 | |||
| 916 | Ga0307410_10031877 | |||
| 917 | Ga0307410_10033049 | |||
| 918 | Ga0307410_10064186 | |||
| 919 | Ga0307410_10100045 | |||
| 920 | Ga0307410_10163208 | |||
| 921 | Ga0307410_10211154 | |||
| 922 | Ga0307410_10325842 | |||
| 923 | Ga0307406_10006159 | |||
| 924 | Ga0307406_10024287 | |||
| 925 | Ga0307406_10069220 | |||
| 926 | Ga0307406_10072483 | |||
| 927 | Ga0307406_10118594 | |||
| 928 | Ga0307406_10171107 | |||
| 929 | Ga0307406_10192358 | |||
| 930 | Ga0307406_10371335 | |||
| 931 | Ga0307407_10225764 | |||
| 932 | Ga0307407_10448339 | |||
| 933 | Ga0307407_10501669 | |||
| 934 | Ga0307407_10526927 | |||
| 935 | Ga0307412_10021483 | |||
| 936 | Ga0307412_10021500 | |||
| 937 | Ga0307412_10028867 | |||
| 938 | Ga0307412_10032907 | |||
| 939 | Ga0307412_10053406 | |||
| 940 | Ga0307412_10066985 | |||
| 941 | Ga0307412_10072817 | |||
| 942 | Ga0307412_10076121 | |||
| 943 | Ga0307412_10236799 | |||
| 944 | Ga0307412_10361816 | |||
| 945 | Ga0307409_100015197 | |||
| 946 | Ga0307409_100020466 | |||
| 947 | Ga0307409_100062342 | |||
| 948 | Ga0307409_100076918 | |||
| 949 | Ga0307409_100085881 | |||
| 950 | Ga0307409_100121856 | |||
| 951 | Ga0307409_100136999 | |||
| 952 | Ga0307409_100194249 | |||
| 953 | Ga0307409_100234661 | |||
| 954 | Ga0307409_100560631 | |||
| 955 | Ga0307416_100010594 | |||
| 956 | Ga0307416_100044024 | |||
| 957 | Ga0307416_100080602 | |||
| 958 | Ga0307416_100086738 | |||
| 959 | Ga0307416_100088044 | |||
| 960 | Ga0307416_100124610 | |||
| 961 | Ga0307416_100199739 | |||
| 962 | Ga0307416_100202350 | |||
| 963 | Ga0307416_100217114 | |||
| 964 | Ga0307416_100341442 | |||
| 965 | Ga0307416_100476211 | |||
| 966 | Ga0307416_100561222 | |||
| 967 | Ga0307416_100796983 | |||
| 968 | Ga0307414_10066991 | |||
| 969 | Ga0307414_10092908 | |||
| 970 | Ga0307414_10130004 | |||
| 971 | Ga0307414_10161967 | |||
| 972 | Ga0307411_10013910 | |||
| 973 | Ga0307411_10030215 | |||
| 974 | Ga0307411_10054445 | |||
| 975 | Ga0307411_10171497 | |||
| 976 | Ga0307415_100003929 | |||
| 977 | Ga0307415_100034893 | |||
| 978 | Ga0307415_100158165 | |||
| 979 | Ga0307415_100221231 | |||
| 980 | Ga0307415_100400460 | |||
| 981 | Ga0307415_100672139 | |||
| 982 | Ga0307507_10000020 | |||
| 983 | Ga0307507_10039359 | |||
| 984 | Ga0373959_0018113 | |||
| 985 | Ga0373940_0010775 | |||
| 986 | Ga0373944_0058139 | |||
| 987 | Ga0373932_0028763 | |||
| 988 | Ga0373939_0003768 | |||
| 989 | Ga0373941_0011811 | |||
| 990 | Ga0373943_0025178 | |||
| 991 | Ga0373933_0158564 | |||
| 992 | Ga0373947_0025327 | |||
| 993 | Ga0395899_0027132 | |||
| 994 | Ga0395900_0010013 | |||
| 995 | Ga0395900_0020745 | |||
| 996 | Ga0395900_0122747 | |||
| 997 | Ga0395898_0063072 | |||
| 998 | Ga0395898_0398961 | |||
| 999 | Ga0395901_0074690 | |||
| 1000 | Ga0395901_0093049 | |||
| 1001 | Ga0439436_0030758 | |||
| 1002 | Ga0439438_031967 | |||
| 1003 | Ga0439439_0004876 | |||
| 1004 | Ga0439461_0000758 | |||
| 1005 | Ga0439461_0001970 | |||
| 1006 | Ga0439466_0001793 | |||
| 1007 | Ga0439466_0014536 | |||
| 1008 | Ga0439466_0095510 | |||
| 1009 | Ga0451789_0014534 | |||
| 1010 | Ga0451793_1920694 | |||
| 1011 | Ga0451797_0529923 | |||
| 1012 | Ga0451797_1438664 | |||
| 1013 | Ga0451853_0985435 | |||
| 1014 | Ga0439433_0003043 | |||
| 1015 | Ga0439442_000001 | |||
| 1016 | Ga0439442_000068 | |||
| 1017 | Ga0439442_002116 | |||
| 1018 | Ga0439442_005362 | |||
| 1019 | Ga0439448_0032542 | |||
| 1020 | Ga0439449_0000147 | |||
| 1021 | Ga0439449_0002610 | |||
| 1022 | Ga0439449_0016720 | |||
| 1023 | Ga0439457_006366 | |||
| 1024 | Ga0439457_007398 | |||
| 1025 | Ga0439462_0013343 | |||
| 1026 | Ga0439462_0018342 | |||
| 1027 | Ga0450920_004324 | |||
| 1028 | Ga0450907_000102 | |||
| 1029 | Ga0450907_018660 | |||
| 1030 | Ga0450908_002545 | |||
| 1031 | Ga0439434_0000022 | |||
| 1032 | Ga0439434_0000119 | |||
| 1033 | Ga0439434_0000960 | |||
| 1034 | Ga0450918_001152 | |||
| 1035 | Ga0450918_003544 | |||
| 1036 | Ga0466969_0001685 | |||
| 1037 | Ga0466969_0012892 | |||
| 1038 | Ga0466965_0286092 | |||
| 1039 | Ga0466966_0012173 | |||
| 1040 | Ga0466966_0034327 | |||
| 1041 | Ga0466966_0090057 | |||
| 1042 | Ga0466961_0002853 | |||
| 1043 | Ga0466961_0012402 | |||
| 1044 | Ga0466971_0008173 | |||
| 1045 | Ga0466971_0120538 | |||
| 1046 | Ga0466971_0155615 | |||
| 1047 | Ga0466970_0045460 | |||
| 1048 | Ga0466957_0066702 | |||
| 1049 | Ga0466960_0029095 | |||
| 1050 | Ga0466959_0012689 | |||
| 1051 | Ga0466959_0040398 | |||
| 1052 | Ga0466959_0053621 | |||
| 1053 | Ga0466959_0101950 | |||
| 1054 | Ga0466958_0009244 | |||
| 1055 | Ga0466967_0198801 | |||
| 1056 | Ga0495603_0201932 | |||
| 1057 | Ga0495651_0061031 | |||
| 1058 | Ga0495580_0002711 | |||
| 1059 | Ga0495580_0051968 | |||
| 1060 | Ga0495582_0054618 | |||
| 1061 | Ga0495582_0058109 | |||
| 1062 | Ga0495639_0000709 | |||
| 1063 | Ga0495664_0006373 | |||
| 1064 | Ga0495596_0148696 | |||
| 1065 | Ga0495628_0004464 | |||
| 1066 | Ga0495630_0099248 | |||
| 1067 | Ga0495631_0124326 | |||
| 1068 | Ga0495643_0040780 | |||
| 1069 | Ga0495642_0005095 | |||
| 1070 | Ga0495642_0139660 | |||
| 1071 | Ga0495652_0218151 | |||
| 1072 | Ga0495665_0211020 | |||
| 1073 | Ga0495586_0001629 | |||
| 1074 | Ga0495586_0006292 | |||
| 1075 | Ga0495598_0049726 | |||
| 1076 | Ga0495621_0078784 | |||
| 1077 | Ga0495597_0044183 | |||
| 1078 | Ga0495645_0008335 | |||
| 1079 | Ga0495622_0072159 | |||
| 1080 | Ga0495667_0240749 | |||
| 1081 | Ga0495668_0178249 | |||
| 1082 | Ga0495634_0077631 | |||
| 1083 | Ga0495661_0089942 | |||
| 1084 | Ga0495588_0006103 | |||
| 1085 | Ga0495588_0010563 | |||
| 1086 | Ga0495588_0184774 | |||
| 1087 | Ga0495657_0016539 | |||
| 1088 | Ga0495658_0017998 | |||
| 1089 | Ga0495670_0126715 | |||
| 1090 | Ga0495670_0137414 | |||
| 1091 | Ga0495600_0056782 | |||
| 1092 | Ga0495581_0005705 | |||
| 1093 | Ga0495581_0008668 | |||
| 1094 | Ga0495581_0237503 | |||
| 1095 | Ga0495604_0056648 | |||
| 1096 | Ga0495672_0129381 | |||
| 1097 | Ga0495676_0016869 | |||
| 1098 | Ga0495676_0023797 | |||
| 1099 | Ga0495680_0038314 | |||
| 1100 | Ga0495680_0110890 | |||
| 1101 | Ga0495677_0132111 | |||
| 1102 | Ga0495684_0103434 | |||
| 1103 | Ga0496100_0002615 | |||
| 1104 | Ga0496100_0131624 | |||
| 1105 | Ga0496100_0303042 | |||
| 1106 | Ga0496100_0337326 | |||
| 1107 | Ga0496101_0039374 | |||
| 1108 | Ga0496101_0053527 | |||
| 1109 | Ga0496101_0122009 | |||
| 1110 | Ga0496101_0146120 | |||
| 1111 | Ga0496102_0025412 | |||
| 1112 | Ga0496102_0051000 | |||
| 1113 | Ga0496102_0056805 | |||
| 1114 | Ga0496102_0639917 | |||
| 1115 | Ga0496103_0001053 | |||
| 1116 | Ga0496103_0078916 | |||
| 1117 | Ga0496104_0003873 | |||
| 1118 | Ga0496104_0074204 | |||
| 1119 | Ga0496104_0171212 | |||
| 1120 | Ga0496104_0350751 | |||
| 1121 | Ga0496105_0022976 | |||
| 1122 | Ga0496105_0105065 | |||
| 1123 | Ga0496105_0117617 | |||
| 1124 | Ga0496105_0174735 | |||
| 1125 | Ga0496105_0230459 | |||
| 1126 | Ga0496105_0492806 | |||
| 1127 | Ga0496106_0009324 | |||
| 1128 | Ga0496107_0001827 | |||
| 1129 | Ga0496107_0125592 | |||
| 1130 | Ga0496107_0225703 | |||
| 1131 | Ga0496108_0003330 | |||
| 1132 | Ga0496108_0063758 | |||
| 1133 | Ga0496108_0145854 | |||
| 1134 | Ga0496109_0017208 | |||
| 1135 | Ga0496109_0017977 | |||
| 1136 | Ga0496109_0137284 | |||
| 1137 | Ga0496109_0219583 | |||
| 1138 | Ga0496109_0428576 | |||
| 1139 | Ga0496109_0741803 | |||
| 1140 | Ga0496110_0016702 | |||
| 1141 | Ga0496110_0103766 | |||
| 1142 | Ga0496110_0143451 | |||
| 1143 | Ga0496110_0383056 | |||
| 1144 | Ga0496111_0007898 | |||
| 1145 | Ga0496111_0012253 | |||
| 1146 | Ga0496111_0013521 | |||
| 1147 | Ga0496111_0119602 | |||
| 1148 | Ga0496112_0018811 | |||
| 1149 | Ga0496112_0027524 | |||
| 1150 | Ga0496112_0032543 | |||
| 1151 | Ga0496112_0047728 | |||
| 1152 | Ga0496112_0065244 | |||
| 1153 | Ga0496112_0102831 | |||
| 1154 | Ga0496112_0116396 | |||
| 1155 | Ga0496112_0127898 | |||
| 1156 | Ga0496112_0697033 | |||
| 1157 | Ga0496113_0006096 | |||
| 1158 | Ga0496113_0027305 | |||
| 1159 | Ga0496113_0100666 | |||
| 1160 | Ga0496113_0242695 | |||
| 1161 | Ga0496113_0344005 | |||
| 1162 | Ga0496114_0000927 | |||
| 1163 | Ga0496114_0015494 | |||
| 1164 | Ga0496114_0028899 | |||
| 1165 | Ga0496114_0031942 | |||
| 1166 | Ga0496115_0053224 | |||
| 1167 | Ga0496115_0074107 | |||
| 1168 | Ga0496115_0077473 | |||
| 1169 | Ga0496115_0186605 | |||
| 1170 | Ga0496119_0168427 | |||
| 1171 | Ga0496122_0003688 | |||
| 1172 | Ga0496123_0000142 | |||
| 1173 | Ga0496124_0000461 | |||
| 1174 | Ga0496124_0406811 | |||
| 1175 | Ga0496125_0043438 | |||
| 1176 | Ga0496126_0040382 | |||
| 1177 | Ga0496126_0093987 | |||
| 1178 | Ga0496126_0161248 | |||
| 1179 | Ga0496126_0240783 | |||
| 1180 | Ga0501032_0000370 | |||
| 1181 | Ga0501032_0074027 | |||
| 1182 | Ga0501032_0444835 | |||
| 1183 | Ga0501034_0000051 | |||
| 1184 | Ga0501034_0026756 | |||
| 1185 | Ga0501036_0191662 | |||
| 1186 | Ga0501036_0302559 | |||
| 1187 | Ga0501036_0483284 | |||
| 1188 | Ga0501037_0013188 | |||
| 1189 | Ga0501037_0017155 | |||
| 1190 | Ga0501037_0029053 | |||
| 1191 | Ga0501037_0093851 | |||
| 1192 | Ga0501037_0156864 | |||
| 1193 | Ga0501038_0000386 | |||
| 1194 | Ga0501038_0015613 | |||
| 1195 | Ga0501038_0064863 | |||
| 1196 | Ga0501039_0121738 | |||
| 1197 | Ga0501039_0329212 | |||
| 1198 | Ga0501043_0012922 | |||
| 1199 | Ga0501043_0015964 | |||
| 1200 | Ga0501043_0021058 | |||
| 1201 | Ga0501046_0016810 | |||
| 1202 | Ga0501046_0019874 | |||
| 1203 | Ga0501047_0022276 | |||
| 1204 | Ga0501047_0026611 | |||
| 1205 | Ga0501070_0039913 | |||
| 1206 | Ga0501070_0156770 | |||
| 1207 | Ga0501074_0433274 | |||
| 1208 | Ga0501080_0157150 | |||
| 1209 | Ga0501083_0003465 | |||
| 1210 | Ga0501035_0038120 | |||
| 1211 | Ga0501035_0067877 | |||
| 1212 | Ga0501044_0006148 | |||
| 1213 | Ga0501044_0048330 | |||
| 1214 | nmdc:mga05p37_154014_c1 | |||
| 1215 | nmdc:mga05p37_275147_c1 | |||
| 1216 | nmdc:mga05p37_9718_c1 | |||
| 1217 | nmdc:mga09592_8482_c1 | |||
| 1218 | nmdc:mga0qj67_405449_c1 | |||
| 1219 | nmdc:mga06r32_60156_c1 | |||
| 1220 | nmdc:mga06r32_87767_c1 | |||
| 1221 | nmdc:mga0n895_20064_c1 | |||
| 1222 | nmdc:mga0a205_86888_c1 | |||
| 1223 | Ga0495601_0003077 | |||
| 1224 | Ga0500644_0027806 | |||
| 1225 | Ga0500646_0000237 | |||
| 1226 | Ga0500583_0019648 | |||
| 1227 | Ga0500641_0057740 | |||
| 1228 | Ga0500562_040603 | |||
| 1229 | Ga0500588_0004322 | |||
| 1230 | Ga0500616_0001577 | |||
| 1231 | Ga0500616_0003190 | |||
| 1232 | Ga0500633_0078005 | |||
| 1233 | Ga0501084_0049728 | |||
| 1234 | Ga0501082_0003943 | |||
| 1235 | Ga0466962_0054640 | |||
| 1236 | Ga0530510_0020488 | |||
| 1237 | 2537899772 | |||
| 1238 | 2644527667 | |||
| 1239 | 2644670712 | |||
| 1240 | 2676481218 | |||
| 1241 | 2691514524 | |||
| 1242 | 2729906989 | |||
| 1243 | 2738693430 | |||
| 1244 | 2739323156 | |||
| 1245 | 2739607747 | |||
| 1246 | 2760304239 | |||
| 1247 | 2760621818 | |||
| 1248 | 2775655145 | |||
| 1249 | 2808827604 | |||
| 1250 | 2808852971 | |||
| 1251 | 2808878579 | |||
| 1252 | 2808891855 | |||
| 1253 | 2808896967 | |||
| 1254 | 2809026625 | |||
| 1255 | 2810364159 | |||
| 1256 | 2812320608 | |||
| 1257 | 2831938460 | |||
| 1258 | 2835191138 | |||
| 1259 | 2844849471 | |||
| 1260 | 2848552823 | |||
| 1261 | 2857741389 | |||
| 1262 | 2861527389 | |||
| 1263 | 2884994679 | |||
| 1264 | 2887445806 | |||
| 1265 | 2904499924 | |||
| 1266 | 2904776568 | |||
| 1267 | 2905929128 | |||
| 1268 | 2910813822 | |||
| 1269 | 2919037690 | |||
| 1270 | 2919061762 | |||
| 1271 | 2919391347 | |||
| 1272 | 2919542081 | |||
| 1273 | 2932429174 | |||
| 1274 | 2933420658 | |||
| 1275 | 2939598582 | |||
| 1276 | 2939648938 | |||
| 1277 | 2939676129 | |||
| 1278 | 2945918367 | |||
| 1279 | 2945921347 | |||
| 1280 | 2945942478 | |||
| 1281 | 2945959763 | |||
| 1282 | 2946005295 | |||
| 1283 | 2946038407 | |||
| 1284 | 2946062222 | |||
| 1285 | 2953999682 | |||
| 1286 | 2974306393 | |||
| 1287 | 2995467255 | |||
| 1288 | 3001890759 | |||
| 1289 | 8003863431 | |||
| 1290 | 8004023381 | |||
| 1291 | 8004027867 | |||
| 1292 | 8047719856 | |||
| 1293 | 8054111100 | |||
| 1294 | 8056582621 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5zon-assembly1.cif.gz_B | histidinol phosphate phosphatase from mycobacterium tuberculosis | 0.9022 | 5 | 259 |
| 4n81-assembly1.cif.gz_A-2 | another flexible region at the active site of an inositol monophosphatase from zymomonas mobilis | 0.9008 | 11 | 259 |
| 5zon-assembly2.cif.gz_D | histidinol phosphate phosphatase from mycobacterium tuberculosis | 0.9004 | 4 | 259 |
| 5zon-assembly1.cif.gz_B | histidinol phosphate phosphatase from mycobacterium tuberculosis | 0.8986 | 5 | 259 |
| 5yht-assembly1.cif.gz_B | crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate | 0.8972 | 6 | 259 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4n81A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.967 | 146 | 259 | 3.40.190.80 |
| af_A0A1D6FBS3_220_343_3.40.190.80 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9495 | 147 | 259 | 3.40.190.80 |
| 4n81A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9351 | 146 | 259 | 3.40.190.80 |
| af_P95189_145_259_3.40.190.80 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.932 | 147 | 259 | 3.40.190.80 |
| af_A4HWI6_353_462_3.40.190.80 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9192 | 185 | 261 | 3.40.190.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529T5C1-F1-model_v4 | Histidinol-phosphatase | 0.9766 | 129 | 260 |
GO:0006020
GO:0007165 GO:0008934 GO:0046872 |
| AF-A0A661PDV2-F1-model_v4 | Histidinol-phosphatase | 0.9734 | 48 | 257 |
GO:0006020
GO:0007165 GO:0008934 GO:0046872 |
| AF-A0A3M2DM86-F1-model_v4 | Histidinol-phosphatase | 0.9717 | 112 | 260 |
GO:0006020
GO:0007165 GO:0008934 GO:0046872 |
| AF-A0A849F3S8-F1-model_v4 | Histidinol-phosphatase | 0.9695 | 119 | 258 |
GO:0000105
GO:0042578 GO:0046854 GO:0046872 |
| AF-A0A4Q3YZD0-F1-model_v4 | Histidinol-phosphatase | 0.9693 | 81 | 260 |
GO:0006020
GO:0007165 GO:0008934 GO:0046872 |