F472276

General Info

Members Datasets Scaffolds Average Seq Length
647 506 441 259

Family's Representative Sequence

Representative Sequence 3300009765|Ga0123341_1000013|Ga0123341_100001324
Length 262
Sequence MTTTAQNGGQKAMHRPAVVSQTAWDAAWKQMLVKEKAQSHARDALAAERRRMPWMAVEKDYAFEGPQGRVSLLDLFEGRHQLILYRAFYEPGVFGWPEHACRGCSMVADQVAHVAHLNARDTTLVFASRGPQADIARLKARMGWTTIPWVTITDSFDKDFGVDEWHGTNVFYRDGERIFRTYFVNNRGDEQMGGTWNYLDITPLGRQEVWEDSPEGYPQTPTYKWWNWHDSYAADAEPDKKWVEVSDAGEAAFREESAKGKS

Samples

Sample ID Description Type Environment
1 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
7 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
8 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
9 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
12 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
13 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
14 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
15 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
16 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
17 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
18 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
19 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
20 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
21 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
22 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
23 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
24 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
25 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
26 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
27 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
28 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
29 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
30 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
31 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
32 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
33 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
34 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
35 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
36 2643221723 Ensifer sp. Root278 Isolate Unclassified
37 2718217882 Rhizobium sp. N741 Isolate Nodule
38 2718217927 Rhizobium sp. N324 Isolate Nodule
39 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
40 2718218009 Rhizobium sp. N561 Isolate Nodule
41 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
42 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
43 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
44 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
45 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
46 2718218363 Rhizobium sp. N113 Isolate Nodule
47 2718218365 Rhizobium sp. N731 Isolate Nodule
48 2718218366 Rhizobium sp. N621 Isolate Nodule
49 2718218423 Rhizobium sp. N941 Isolate Nodule
50 2721755514 Rhizobium sp. N6212 Isolate Nodule
51 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
52 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
53 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
54 2721755809 Rhizobium sp. N541 Isolate Nodule
55 2721755810 Rhizobium sp. N871 Isolate Nodule
56 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
57 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
58 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
59 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
60 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
61 2728369365 Rhizobium sp. N1341 Isolate Nodule
62 2728369397 Rhizobium sp. N1314 Isolate Nodule
63 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
64 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
65 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
66 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
67 2791355256 Rhizobium sp. M10 Isolate Nodule
68 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
69 2791355260 Rhizobium sp. L9 Isolate Nodule
70 2791355261 Rhizobium sp. J15 Isolate Nodule
71 2791355262 Rhizobium sp. M1 Isolate Nodule
72 2791355263 Rhizobium chutanense C5 Isolate Nodule
73 2791355264 Rhizobium sp. S9 Isolate Nodule
74 2791355265 Rhizobium sp. H4 Isolate Nodule
75 2791355266 Rhizobium sp. L43 Isolate Nodule
76 2791355267 Rhizobium sp. L18 Isolate Nodule
77 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
78 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
79 2802429633 Rhizobium anhuiense J3 Isolate Nodule
80 2802429634 Rhizobium anhuiense S10 Isolate Nodule
81 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
82 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
83 2802429637 Rhizobium anhuiense C15 Isolate Nodule
84 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
85 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
86 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
87 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
88 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
89 2838048938 Rhizobium pisi 27/80 Isolate Nodule
90 2838061910 Rhizobium phaseoli L15 Isolate Nodule
91 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
92 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
93 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
94 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
95 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
96 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
97 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
98 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
99 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
100 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
101 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
102 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
103 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
104 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
105 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
106 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
107 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
108 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
109 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
110 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
111 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
112 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
113 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
114 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
115 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
116 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
117 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
118 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
119 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
120 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
121 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
122 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
123 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
124 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
125 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
126 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
127 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
128 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
129 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
130 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
131 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
132 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
133 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
134 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
135 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
136 2842677519 Variovorax sp. R-72495 Isolate Unclassified
137 2844163670 Ensifer sp. 1H6 Isolate Unclassified
138 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
139 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
140 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
141 2858950400 Achromobacter sp. K91 Isolate Unclassified
142 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
143 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
144 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
145 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
146 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
147 2909042592 Labrys sp. LIt4 Isolate Nodule
148 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
149 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
150 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
151 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
152 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
153 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
154 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
155 2933599457 Rhizobium phaseoli M3 Isolate Nodule
156 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
157 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
158 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
159 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
160 2936381700 Rhizobium chutanense C16 Isolate Unclassified
161 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
162 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
163 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
164 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
165 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
166 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
167 2996893221 Rhizobium sp. R635 Isolate Nodule
168 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
169 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
170 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
171 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
172 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
173 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
174 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
175 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
176 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
177 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
178 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
179 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
180 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
181 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
182 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
183 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
184 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
185 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
186 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
187 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
188 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
189 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
190 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
191 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
192 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
193 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
194 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
195 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
196 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
197 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
198 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
199 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
200 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
201 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
202 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
203 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
204 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
205 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
206 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
207 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
208 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
209 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
210 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
211 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
212 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
213 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
214 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
215 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
216 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
217 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
218 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
219 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
220 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
221 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
222 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
223 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
224 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
225 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
226 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
227 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
228 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
229 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
230 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
231 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
232 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
233 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
234 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
235 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
236 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
237 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
238 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
239 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
240 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
241 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
242 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
243 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
244 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
245 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
246 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
247 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
248 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
249 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
250 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
251 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
252 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
253 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
254 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
255 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
256 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
257 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
258 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
259 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
260 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
261 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
262 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
263 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
264 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
266 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
267 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
269 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
270 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
271 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
273 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
274 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
275 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
277 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
278 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
279 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
306 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
307 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
308 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
309 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
310 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
311 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
312 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
313 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
314 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
315 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
316 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
317 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
318 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
319 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
320 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
321 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
322 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
323 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
324 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
325 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
326 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
327 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
328 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
329 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
330 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
331 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
332 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
333 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
334 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
335 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
336 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
337 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
338 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
339 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
340 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
341 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
342 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
343 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
344 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
345 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
346 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
347 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
348 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
349 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
350 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
351 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
352 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
353 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
354 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
355 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
356 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
357 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
358 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
359 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
360 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
361 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
362 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
363 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
364 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
365 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
366 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
367 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
368 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
369 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
370 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
371 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
372 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
373 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
374 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
375 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
376 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
377 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
378 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
379 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
380 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
381 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
382 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
383 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
384 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
385 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
386 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
387 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
388 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
389 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
390 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
391 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
392 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
393 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
394 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
395 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
396 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
397 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
398 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
399 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
400 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
401 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
402 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
403 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
404 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
405 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
406 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
407 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
408 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
409 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
410 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
411 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
412 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
413 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
414 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
415 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
416 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
417 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
418 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
419 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
420 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
421 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
422 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
423 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
424 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
425 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
426 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
427 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
428 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
429 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
430 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
431 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
432 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
433 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
434 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
435 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
436 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
437 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
438 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
439 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
440 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
441 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
442 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
443 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
444 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
445 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
446 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
447 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
448 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
449 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
450 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
451 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
452 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
453 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
454 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
455 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
456 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
457 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
458 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
459 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
460 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
461 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
462 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
463 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
464 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
465 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
466 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
467 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
468 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
469 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
470 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
471 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
473 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
474 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
475 8005275841 Rhizobium sp. N4311 Isolate Nodule
476 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
477 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
478 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
479 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
480 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
481 8005382845 Rhizobium sp. R634 Isolate Nodule
482 8005395548 Rhizobium sp. R339 Isolate Nodule
483 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
484 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
485 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
486 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
487 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
488 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
489 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
490 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
491 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
492 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
493 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
494 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
495 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
496 8018176218 Rhizobium sp. N122 Isolate Nodule
497 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
498 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
499 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
500 8024501048 Rhizobium sp. H4 Isolate Nodule
501 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
502 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
503 8056382006 Rhizobium croatiense 13T Isolate Nodule
504 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
505 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
506 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 67.85
Metatranscriptomes 0.31
Isolates 31.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.08
Nodule 28.75
Rhizoplane 3.86
Rhizosphere 40.65
Stem 0
Stem Tuber 0
Unclassified 8.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10001546 3300003187 Bacteria 15355
2 JGI25151J46595_10003074 3300003187 Bacteria 9411
3 JGI25151J46595_10016131 3300003187 Bacteria 3273
4 JGI25153J46596_10004881 3300003215 Bacteria 7133
5 JGI25160J50197_1000005 3300003354 Bacteria 417280
6 JGI25160J50197_1000879 3300003354 Bacteria 15801
7 JGI25160J50197_1016142 3300003354 Bacteria 2418
8 JGI25161J50226_1001978 3300003374 Bacteria 5628
9 JGI25161J50226_1004441 3300003374 Bacteria 2935
10 Ga0006562J51391_1028949 3300003578 Bacteria 970
11 Ga0055526_1001412 3300003771 Bacteria 17095
12 Ga0055526_1001916 3300003771 Bacteria 14394
13 Ga0055526_1002113 3300003771 Bacteria 13643
14 Ga0055537_1000369 3300003773 Bacteria 30698
15 Ga0055524_1002450 3300003775 Bacteria 9546
16 Ga0055524_1030762 3300003775 Bacteria 1559
17 Ga0055536_1002736 3300003781 Bacteria 9765
18 Ga0055536_1006992 3300003781 Bacteria 5133
19 Ga0055534_1000044 3300003784 Bacteria 99295
20 Ga0055528_1000175 3300003790 Bacteria 54220
21 Ga0055528_1000269 3300003790 Bacteria 44061
22 Ga0055528_1000801 3300003790 Bacteria 21717
23 Ga0055528_1008848 3300003790 Bacteria 4263
24 Ga0055530_10012997 3300003791 Bacteria 2867
25 Ga0055540_1000192 3300003792 Bacteria 58828
26 Ga0055540_1035094 3300003792 Bacteria 1124
27 Ga0055531_10037896 3300003794 Bacteria 1457
28 Ga0055543_1000324 3300004625 Bacteria 33093
29 Ga0055543_1006342 3300004625 Bacteria 2870
30 Ga0065165_1000002 3300005262 Bacteria 444192
31 Ga0065165_1026156 3300005262 Bacteria 1924
32 Ga0065165_1027360 3300005262 Bacteria 1861
33 Ga0065714_10065424 3300005288 Bacteria 10159
34 Ga0070691_10017967 3300005341 Bacteria 3257
35 Ga0070659_100065667 3300005366 Bacteria 2874
36 Ga0070709_10021133 3300005434 Bacteria 3788
37 Ga0070714_100052883 3300005435 Bacteria 3465
38 Ga0070714_100087697 3300005435 Bacteria 2721
39 Ga0070701_10012359 3300005438 Bacteria 3849
40 Ga0070705_100000079 3300005440 Bacteria 53247
41 Ga0070700_100017375 3300005441 Bacteria 4112
42 Ga0070662_100031568 3300005457 Bacteria 3719
43 Ga0070681_10045659 3300005458 Bacteria 4382
44 Ga0070685_10077737 3300005466 Bacteria 1982
45 Ga0070707_100054109 3300005468 Bacteria 3848
46 Ga0070698_100031007 3300005471 Bacteria 5543
47 Ga0070695_100000380 3300005545 Bacteria 22898
48 Ga0070696_100000425 3300005546 Bacteria 26467
49 Ga0070665_100304300 3300005548 Bacteria 1597
50 Ga0068855_100417224 3300005563 Bacteria 1469
51 Ga0068857_100029877 3300005577 Bacteria 4809
52 Ga0070702_100088864 3300005615 Bacteria 1869
53 Ga0068852_100834043 3300005616 Bacteria 937
54 Ga0068859_100070495 3300005617 Bacteria 3531
55 Ga0068861_100325073 3300005719 Bacteria 1341
56 Ga0068861_100482742 3300005719 Bacteria 1117
57 Ga0068858_100127983 3300005842 Bacteria 2380
58 Ga0081540_1028224 3300005983 Bacteria 3157
59 Ga0081539_10000444 3300005985 Bacteria 88011
60 Ga0070717_10013471 3300006028 Bacteria 6268
61 Ga0075365_10002482 3300006038 Bacteria 9065
62 Ga0075368_10007782 3300006042 Bacteria 3796
63 Ga0075368_10070598 3300006042 Bacteria 1410
64 Ga0075363_100008129 3300006048 Bacteria 4869
65 Ga0075363_100009405 3300006048 Bacteria 4595
66 Ga0075363_100020786 3300006048 Bacteria 3297
67 Ga0075363_100238706 3300006048 Bacteria 1044
68 Ga0075364_10001378 3300006051 Bacteria 13109
69 Ga0075364_10135576 3300006051 Bacteria 1654
70 Ga0070712_100012063 3300006175 Bacteria 5491
71 Ga0075362_10000537 3300006177 Bacteria 11051
72 Ga0075362_10022348 3300006177 Bacteria 2664
73 Ga0075367_10003052 3300006178 Bacteria 7847
74 Ga0075367_10005945 3300006178 Bacteria 6125
75 Ga0075367_10049609 3300006178 Bacteria 2474
76 Ga0075367_10070752 3300006178 Bacteria 2097
77 Ga0075369_10002735 3300006186 Bacteria 6323
78 Ga0075366_10000974 3300006195 Bacteria 13992
79 Ga0075366_10077806 3300006195 Bacteria 1979
80 Ga0097621_100057148 3300006237 Bacteria 3189
81 Ga0075370_10002169 3300006353 Bacteria 8998
82 Ga0075370_10034671 3300006353 Bacteria 2829
83 Ga0075370_10046996 3300006353 Bacteria 2444
84 Ga0068871_100475644 3300006358 Bacteria 1123
85 Ga0075428_100100763 3300006844 Bacteria 3149
86 Ga0075428_100625862 3300006844 Bacteria 1149
87 Ga0075430_100015606 3300006846 Bacteria 6467
88 Ga0075430_100032484 3300006846 Bacteria 4431
89 Ga0075431_100009169 3300006847 Bacteria 9923
90 Ga0075431_100051761 3300006847 Bacteria 4234
91 Ga0075431_100085720 3300006847 Bacteria 3251
92 Ga0075431_100237892 3300006847 Bacteria 1853
93 Ga0075433_10184261 3300006852 Bacteria 1857
94 Ga0075434_100128951 3300006871 Bacteria 2547
95 Ga0075436_100014203 3300006914 Bacteria 5452
96 Ga0097620_100070494 3300006931 Bacteria 3531
97 Ga0099825_1027163 3300006941 Bacteria 2948
98 Ga0099824_1008495 3300006942 Bacteria 13117
99 Ga0099822_1013304 3300006943 Bacteria 9675
100 Ga0079104_1016961 3300006946 Bacteria 2109
101 Ga0099826_10001431 3300006948 Bacteria 14303
102 Ga0075435_100053969 3300007076 Bacteria 3243
103 Ga0075435_100116554 3300007076 Bacteria 2225
104 Ga0105240_10012018 3300009093 Bacteria 12002
105 Ga0105240_10378179 3300009093 Bacteria 1600
106 Ga0114129_10172476 3300009147 Bacteria 2948
107 Ga0114129_10381802 3300009147 Bacteria 1860
108 Ga0105241_10254760 3300009174 Bacteria 1489
109 Ga0105242_10078243 3300009176 Bacteria 2760
110 Ga0105248_10043201 3300009177 Bacteria 5054
111 Ga0105237_10081785 3300009545 Bacteria 3221
112 Ga0105237_10329964 3300009545 Bacteria 1530
113 Ga0123341_1000013 3300009765 Bacteria 97696
114 Ga0123342_1040019 3300009766 Bacteria 1753
115 Ga0099796_10002227 3300010159 Bacteria 4202
116 Ga0105239_10010843 3300010375 Bacteria 10181
117 Ga0105239_10026693 3300010375 Bacteria 6356
118 Ga0105239_10052716 3300010375 Bacteria 4461
119 Ga0105239_10389707 3300010375 Bacteria 1576
120 Ga0105239_10423576 3300010375 Bacteria 1508
121 Ga0105239_10999789 3300010375 Bacteria 962
122 Ga0157373_10015240 3300013100 Bacteria 5621
123 Ga0163163_10062269 3300014325 Bacteria 3696
124 Ga0182008_10017339 3300014497 Bacteria 3737
125 Ga0157379_10131922 3300014968 Bacteria 2249
126 Ga0182007_10001637 3300015262 Bacteria 11859
127 Ga0182005_1061490 3300015265 Bacteria 1026
128 Ga0183363_1072 3300015690 Bacteria 30043
129 Ga0163161_10037465 3300017792 Bacteria 3477
130 Ga0163161_10206211 3300017792 Bacteria 1517
131 Ga0214542_1017604 3300021321 Bacteria 6377
132 Ga0214543_1000018 3300021327 Bacteria 272335
133 Ga0213875_10000935 3300021388 Bacteria 20990
134 Ga0224572_1001023 3300024225 Bacteria 3880
135 Ga0228598_1000041 3300024227 Bacteria 18143
136 Ga0209436_100162 3300025208 Bacteria 32237
137 Ga0207425_1004352 3300025245 Bacteria 4281
138 Ga0209148_1000037 3300025254 Bacteria 494767
139 Ga0209129_1000771 3300025258 Bacteria 20312
140 Ga0209565_1000039 3300025263 Bacteria 278026
141 Ga0209455_1000036 3300025272 Bacteria 473309
142 Ga0209673_1000013 3300025273 Bacteria 571633
143 Ga0209673_1000146 3300025273 Bacteria 150871
144 Ga0209673_1000325 3300025273 Bacteria 87535
145 Ga0209673_1001202 3300025273 Bacteria 27769
146 Ga0209673_1003962 3300025273 Bacteria 8268
147 Ga0209673_1004764 3300025273 Bacteria 7131
148 Ga0209130_1000010 3300025284 Bacteria 444920
149 Ga0209130_1001943 3300025284 Bacteria 11469
150 Ga0209675_1000030 3300025291 Bacteria 278026
151 Ga0209676_1001612 3300025292 Bacteria 19989
152 Ga0209025_1000534 3300025294 Bacteria 72165
153 Ga0209025_1001166 3300025294 Bacteria 37252
154 Ga0209025_1044413 3300025294 Bacteria 1857
155 Ga0209564_1000264 3300025295 Bacteria 111404
156 Ga0209564_1000473 3300025295 Bacteria 67272
157 Ga0209564_1001458 3300025295 Bacteria 24030
158 Ga0209758_1002424 3300025297 Bacteria 19060
159 Ga0209758_1002732 3300025297 Bacteria 17369
160 Ga0209758_1021304 3300025297 Bacteria 3025
161 Ga0209050_1005318 3300025298 Bacteria 8165
162 Ga0209256_1000245 3300025299 Bacteria 96643
163 Ga0209256_1000369 3300025299 Bacteria 72557
164 Ga0209256_1003331 3300025299 Bacteria 11396
165 Ga0207426_1000036 3300025302 Bacteria 444920
166 Ga0207426_1000039 3300025302 Bacteria 439937
167 Ga0207426_1004254 3300025302 Bacteria 7104
168 Ga0209051_1000253 3300025303 Bacteria 90622
169 Ga0209051_1001000 3300025303 Bacteria 27153
170 Ga0209051_1004287 3300025303 Bacteria 8870
171 Ga0209257_1002124 3300025304 Bacteria 20695
172 Ga0209257_1002174 3300025304 Bacteria 20322
173 Ga0207647_10057971 3300025904 Bacteria 2373
174 Ga0207647_10166069 3300025904 Bacteria 1286
175 Ga0207705_10135921 3300025909 Bacteria 1833
176 Ga0207654_10104890 3300025911 Bacteria 1748
177 Ga0207707_10064452 3300025912 Bacteria 3190
178 Ga0207707_10130705 3300025912 Bacteria 2196
179 Ga0207695_10009269 3300025913 Bacteria 12192
180 Ga0207695_10225033 3300025913 Bacteria 1782
181 Ga0207693_10004440 3300025915 Bacteria 11855
182 Ga0207652_10224722 3300025921 Bacteria 1692
183 Ga0207646_10118854 3300025922 Bacteria 2374
184 Ga0207694_10108647 3300025924 Bacteria 2204
185 Ga0207664_10076908 3300025929 Bacteria 2703
186 Ga0207690_10029561 3300025932 Bacteria 3486
187 Ga0207706_10027974 3300025933 Bacteria 5038
188 Ga0207686_10132535 3300025934 Bacteria 1711
189 Ga0207669_10175823 3300025937 Bacteria 1529
190 Ga0207691_10059778 3300025940 Bacteria 3464
191 Ga0207711_10024664 3300025941 Bacteria 5042
192 Ga0207661_10452307 3300025944 Bacteria 1170
193 Ga0207667_10163358 3300025949 Bacteria 2290
194 Ga0207640_10478058 3300025981 Bacteria 1033
195 Ga0207703_10096887 3300026035 Bacteria 2491
196 Ga0207639_10079660 3300026041 Bacteria 2589
197 Ga0207678_10421090 3300026067 Bacteria 1158
198 Ga0207674_10541377 3300026116 Bacteria 1125
199 Ga0207675_100100763 3300026118 Bacteria 2721
200 Ga0207683_10046502 3300026121 Bacteria 3798
201 Ga0209589_1000001 3300027357 Bacteria 794224
202 Ga0209489_100001 3300027361 Bacteria 794224
203 Ga0209700_100001 3300027363 Bacteria 794224
204 Ga0209282_1012610 3300027666 Bacteria 5372
205 Ga0209813_10017412 3300027866 Bacteria 1972
206 Ga0209813_10056096 3300027866 Bacteria 1246
207 Ga0307515_10082850 3300028794 Bacteria 4141
208 Ga0307511_10061864 3300030521 Bacteria 2848
209 Ga0316176_1140230 3300030732 Bacteria 1667
210 Ga0314311_1034637 3300030733 Bacteria 15856
211 Ga0316178_1014198 3300030735 Bacteria 4251
212 Ga0316180_1096139 3300030736 Bacteria 3016
213 Ga0316183_1198096 3300030742 Bacteria 4176
214 Ga0265340_10082656 3300031247 Bacteria 1510
215 Ga0307516_10125575 3300031730 Bacteria 2351
216 Ga0307410_10216842 3300031852 Bacteria 1470
217 Ga0307412_10099604 3300031911 Bacteria 2052
218 Ga0307412_10125511 3300031911 Bacteria 1856
219 Ga0307412_10188750 3300031911 Bacteria 1556
220 Ga0307412_10303338 3300031911 Bacteria 1263
221 Ga0307409_100580835 3300031995 Bacteria 1105
222 Ga0307409_100926540 3300031995 Bacteria 886
223 Ga0307416_100017075 3300032002 Bacteria 5065
224 Ga0307414_10017846 3300032004 Bacteria 4353
225 Ga0307411_10201290 3300032005 Bacteria 1529
226 Ga0307411_10526205 3300032005 Bacteria 1004
227 Ga0307507_10040471 3300033179 Bacteria 4681
228 Ga0307507_10130146 3300033179 Bacteria 1973
229 Ga0373943_0023748 3300035170 Bacteria 2853
230 Ga0373946_0027093 3300035171 Bacteria 2265
231 Ga0373935_0056492 3300035692 Bacteria 2502
232 Ga0373935_0082763 3300035692 Bacteria 2088
233 Ga0373927_0025557 3300035695 Bacteria 3861
234 Ga0373927_0051139 3300035695 Bacteria 2672
235 Ga0373937_0114014 3300036401 Bacteria 2516
236 Ga0373925_0001247 3300037068 Bacteria 22445
237 Ga0373925_0137337 3300037068 Bacteria 1911
238 Ga0395899_0006774 3300037312 Bacteria 8877
239 Ga0395900_0229005 3300037418 Bacteria 1870
240 Ga0395898_0090669 3300037466 Bacteria 2942
241 Ga0395898_0263943 3300037466 Bacteria 1642
242 Ga0395905_0000017 3300037471 Bacteria 376619
243 Ga0436364_0838310 3300037853 Bacteria 19399
244 Ga0395901_0279056 3300038443 Bacteria 1736
245 Ga0436360_0430836 3300039438 Bacteria 882
246 Ga0436361_0122568 3300039447 Bacteria 6371
247 Ga0436363_0416503 3300039450 Bacteria 1549
248 Ga0439436_0034310 3300041404 Bacteria 1467
249 Ga0439436_0046417 3300041404 Bacteria 1235
250 Ga0439465_0003131 3300041413 Bacteria 5400
251 Ga0451793_0446925 3300041452 Bacteria 1278
252 Ga0451798_0284410 3300041458 Bacteria 944
253 Ga0451835_0043983 3300041492 Bacteria 2482
254 Ga0451837_0861550 3300041494 Bacteria 1083
255 Ga0451841_0595127 3300041498 Bacteria 2049
256 Ga0451847_0393698 3300041503 Bacteria 3245
257 Ga0451851_0019019 3300041507 Bacteria 3265
258 Ga0451853_1819537 3300041512 Bacteria 4472
259 Ga0439445_0084393 3300042004 Bacteria 890
260 Ga0439432_003954 3300042006 Bacteria 5453
261 Ga0439449_0013213 3300042007 Bacteria 3106
262 Ga0450896_001581 3300042133 Bacteria 2831
263 Ga0450908_000341 3300042184 Bacteria 9076
264 Ga0450918_000211 3300042531 Bacteria 13202
265 Ga0466966_0002487 3300044684 Bacteria 12067
266 Ga0466961_0000081 3300044693 Bacteria 59450
267 Ga0466963_0121735 3300044694 Bacteria 1796
268 Ga0466964_0129745 3300044706 Bacteria 1146
269 Ga0466970_0305838 3300044765 Bacteria 897
270 Ga0466957_0090186 3300044842 Bacteria 1920
271 Ga0466959_0125080 3300045049 Bacteria 1825
272 Ga0466967_0424355 3300045976 Bacteria 1296
273 Ga0495629_0047870 3300046459 Bacteria 2998
274 Ga0495638_0082547 3300046460 Bacteria 1949
275 Ga0495651_0003650 3300046462 Bacteria 11786
276 Ga0495653_0057422 3300046463 Bacteria 2962
277 Ga0495653_0087548 3300046463 Bacteria 2287
278 Ga0495580_0170031 3300046472 Bacteria 1507
279 Ga0495605_0065117 3300046474 Bacteria 1734
280 Ga0495639_0001912 3300046475 Bacteria 9238
281 Ga0495662_0012048 3300046476 Bacteria 4225
282 Ga0495662_0196590 3300046476 Bacteria 994
283 Ga0495664_0001054 3300046477 Bacteria 14241
284 Ga0495664_0016951 3300046477 Bacteria 4160
285 Ga0495585_0063684 3300046492 Bacteria 2023
286 Ga0495596_0065572 3300046500 Bacteria 1412
287 Ga0495608_0067924 3300046511 Bacteria 2331
288 Ga0495608_0068135 3300046511 Bacteria 2327
289 Ga0495610_0033331 3300046512 Bacteria 2664
290 Ga0495618_0084114 3300046514 Bacteria 2033
291 Ga0495628_0008616 3300046516 Bacteria 8739
292 Ga0495628_0142173 3300046516 Bacteria 1831
293 Ga0495630_0018994 3300046517 Bacteria 5051
294 Ga0495637_0091506 3300046520 Bacteria 1199
295 Ga0495648_0063919 3300046524 Bacteria 2170
296 Ga0495648_0079339 3300046524 Bacteria 1874
297 Ga0495666_0083834 3300046526 Bacteria 1506
298 Ga0495652_0021740 3300046529 Bacteria 5703
299 Ga0495652_0065611 3300046529 Bacteria 3049
300 Ga0495654_0169572 3300046530 Bacteria 952
301 Ga0495665_0056410 3300046531 Bacteria 2074
302 Ga0495640_0080553 3300046533 Bacteria 2165
303 Ga0495587_0033155 3300046536 Bacteria 3119
304 Ga0495587_0059856 3300046536 Bacteria 2234
305 Ga0495597_0027694 3300046542 Bacteria 2597
306 Ga0495645_0002549 3300046543 Bacteria 12363
307 Ga0495645_0012442 3300046543 Bacteria 5997
308 Ga0495633_0032691 3300046558 Bacteria 2512
309 Ga0495667_0021678 3300046559 Bacteria 4335
310 Ga0495667_0062588 3300046559 Bacteria 2438
311 Ga0495656_0001532 3300046615 Bacteria 7550
312 Ga0495634_0017423 3300046642 Bacteria 5124
313 Ga0495634_0036534 3300046642 Bacteria 3360
314 Ga0495611_0017259 3300046648 Bacteria 3086
315 Ga0495625_0000052 3300046660 Bacteria 190656
316 Ga0495625_0037865 3300046660 Bacteria 3533
317 Ga0495625_0060852 3300046660 Bacteria 2674
318 Ga0495625_0100603 3300046660 Bacteria 1987
319 Ga0495635_0011793 3300046663 Bacteria 6128
320 Ga0495635_0027868 3300046663 Bacteria 3928
321 Ga0495661_0035454 3300046665 Bacteria 3130
322 Ga0495661_0077054 3300046665 Bacteria 1933
323 Ga0495588_0001503 3300046674 Bacteria 9988
324 Ga0495657_0016350 3300046675 Bacteria 5406
325 Ga0495657_0018110 3300046675 Bacteria 5104
326 Ga0495657_0036331 3300046675 Bacteria 3405
327 Ga0495599_0005248 3300046678 Bacteria 7730
328 Ga0495599_0019861 3300046678 Bacteria 4184
329 Ga0495646_0042053 3300046680 Bacteria 2806
330 Ga0495646_0056965 3300046680 Bacteria 2341
331 Ga0495646_0259379 3300046680 Bacteria 929
332 Ga0495613_0028020 3300046689 Bacteria 4192
333 Ga0495613_0091919 3300046689 Bacteria 2198
334 Ga0495624_0015047 3300046690 Bacteria 5237
335 Ga0495649_0006830 3300046694 Bacteria 7065
336 Ga0495600_0005446 3300046809 Bacteria 7673
337 Ga0495600_0049519 3300046809 Bacteria 2741
338 Ga0495660_0015697 3300046810 Bacteria 4373
339 Ga0495604_0003777 3300047317 Bacteria 12054
340 Ga0495604_0016956 3300047317 Bacteria 5825
341 Ga0495674_0031347 3300047319 Bacteria 4830
342 Ga0495674_0182578 3300047319 Bacteria 1747
343 Ga0495672_0020134 3300047320 Bacteria 4380
344 Ga0495676_0062972 3300047321 Bacteria 2893
345 Ga0495680_0043439 3300047322 Bacteria 3558
346 Ga0495687_007286 3300047443 Bacteria 6555
347 Ga0495675_0100549 3300047444 Bacteria 1810
348 Ga0495675_0290095 3300047444 Bacteria 974
349 Ga0495679_015719 3300047446 Bacteria 2760
350 Ga0495681_0038201 3300047470 Bacteria 2356
351 Ga0495684_0389056 3300047471 Bacteria 982
352 Ga0495686_0021410 3300047472 Bacteria 4294
353 Ga0495686_0072945 3300047472 Bacteria 2109
354 Ga0495593_0021553 3300047673 Bacteria 3597
355 Ga0495602_0029168 3300048088 Bacteria 5264
356 Ga0495602_0190339 3300048088 Bacteria 1574
357 Ga0496100_0001473 3300048903 Bacteria 11524
358 Ga0496101_0024641 3300048904 Bacteria 4166
359 Ga0496102_0002386 3300048905 Bacteria 16031
360 Ga0496102_0038016 3300048905 Bacteria 4342
361 Ga0496104_0016340 3300048907 Bacteria 6740
362 Ga0496104_0030085 3300048907 Bacteria 5043
363 Ga0496105_0000649 3300048908 Bacteria 23327
364 Ga0496105_0003866 3300048908 Bacteria 11194
365 Ga0496105_0307746 3300048908 Bacteria 1273
366 Ga0496106_0000298 3300048909 Bacteria 35026
367 Ga0496106_0001140 3300048909 Bacteria 19677
368 Ga0496106_0135520 3300048909 Bacteria 1934
369 Ga0496107_0086733 3300048910 Bacteria 2285
370 Ga0496108_0122490 3300048911 Bacteria 2231
371 Ga0496109_0145240 3300048912 Bacteria 2219
372 Ga0496109_0306938 3300048912 Bacteria 1497
373 Ga0496109_0312476 3300048912 Bacteria 1483
374 Ga0496110_0032013 3300048913 Bacteria 4539
375 Ga0496111_0048660 3300048914 Bacteria 3054
376 Ga0496114_0098737 3300048917 Bacteria 2490
377 Ga0496115_0033160 3300048918 Bacteria 4076
378 Ga0496115_0175866 3300048918 Bacteria 1770
379 Ga0496117_0000939 3300048920 Bacteria 44634
380 Ga0496117_0011684 3300048920 Bacteria 7836
381 Ga0496118_0001769 3300048921 Bacteria 31259
382 Ga0496118_0003337 3300048921 Bacteria 20313
383 Ga0496118_0010658 3300048921 Bacteria 9067
384 Ga0496118_0082496 3300048921 Bacteria 2252
385 Ga0496119_0013564 3300048922 Bacteria 6475
386 Ga0496120_0021302 3300048923 Bacteria 4099
387 Ga0496121_0000668 3300048924 Bacteria 64093
388 Ga0496121_0007858 3300048924 Bacteria 12756
389 Ga0496121_0106532 3300048924 Bacteria 2149
390 Ga0496121_0406222 3300048924 Bacteria 890
391 Ga0496124_0003401 3300048927 Bacteria 19546
392 Ga0496124_0147643 3300048927 Bacteria 1849
393 Ga0496126_0006242 3300048929 Bacteria 13320
394 Ga0496126_0018073 3300048929 Bacteria 7003
395 Ga0496126_0084081 3300048929 Bacteria 2807
396 Ga0496126_0324382 3300048929 Bacteria 1265
397 Ga0501076_0567385 3300049592 Bacteria 936
398 Ga0501079_0324061 3300049741 Bacteria 1206
399 Ga0501044_0659112 3300049823 Bacteria 935
400 nmdc:mga03683_27341_c1 3300050489 Bacteria 2258
401 nmdc:mga03683_33832_c1 3300050489 Bacteria 2066
402 nmdc:mga03n38_17798_c1 3300050490 Bacteria 2790
403 nmdc:mga03n38_58687_c1 3300050490 Bacteria 1744
404 nmdc:mga0yw44_11147_c1 3300050492 Bacteria 4624
405 nmdc:mga0yw44_17487_c1 3300050492 Bacteria 3903
406 nmdc:mga0k408_11233_c1 3300050493 Bacteria 4869
407 nmdc:mga0k408_267910_c1 3300050493 Bacteria 1020
408 nmdc:mga06z11_15600_c2 3300050494 Bacteria 2849
409 nmdc:mga06z11_276082_c1 3300050494 Bacteria 995
410 nmdc:mga06z11_405871_c1 3300050494 Bacteria 820
411 nmdc:mga04h51_20610_c1 3300050495 Bacteria 1971
412 nmdc:mga07m45_11528_c1 3300050496 Bacteria 4648
413 nmdc:mga07m45_9175_c1 3300050496 Bacteria 5115
414 nmdc:mga07m45_9404_c1 3300050496 Bacteria 5069
415 nmdc:mga05p37_142895_c1 3300050507 Bacteria 2931
416 nmdc:mga09592_54565_c1 3300050508 Bacteria 3377
417 nmdc:mga0qj67_13985_c1 3300050509 Bacteria 6061
418 nmdc:mga0qj67_547527_c1 3300050509 Bacteria 928
419 nmdc:mga06r32_26094_c1 3300050510 Bacteria 5444
420 nmdc:mga06r32_5610_c1 3300050510 Bacteria 11287
421 nmdc:mga06r32_91699_c1 3300050510 Bacteria 2970
422 nmdc:mga0n895_26135_c1 3300050512 Bacteria 5525
423 nmdc:mga0rr50_32950_c1 3300050513 Bacteria 3697
424 nmdc:mga0rr50_46252_c1 3300050513 Bacteria 3204
425 nmdc:mga08x19_28688_c1 3300050514 Bacteria 3488
426 nmdc:mga0a205_38507_c1 3300050515 Bacteria 4601
427 nmdc:mga0sz30_6761_c1 3300050516 Bacteria 4277
428 Ga0495655_0070867 3300053083 Bacteria 974
429 Ga0500651_0000009 3300053093 Bacteria 270362
430 Ga0500651_0002750 3300053093 Bacteria 9403
431 Ga0500566_0087528 3300053094 Bacteria 1725
432 Ga0500650_0217429 3300053098 Bacteria 866
433 Ga0500556_0004389 3300053104 Bacteria 4018
434 Ga0500595_015254 3300053119 Bacteria 2888
435 Ga0500658_0002671 3300053134 Bacteria 6848
436 Ga0500559_0057717 3300053136 Bacteria 1725
437 Ga0500568_0000205 3300053139 Bacteria 51687
438 Ga0500636_0004048 3300053177 Bacteria 8272
439 Ga0501084_0206887 3300054114 Bacteria 1656
440 Ga0501084_0231516 3300054114 Bacteria 1560
441 Ga0587101_003345 3300059623 Bacteria 1621

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050509 nmdc:mga0qj67_547527_c1 nmdc:mga0qj67_547527_c1_124_870 243
2 3300005616 Ga0068852_100834043 Ga0068852_1008340431 244
3 3300025937 Ga0207669_10175823 Ga0207669_101758232 245
4 3300005563 Ga0068855_100417224 Ga0068855_1004172242 246
5 3300006042 Ga0075368_10070598 Ga0075368_100705982 246
6 3300006051 Ga0075364_10135576 Ga0075364_101355762 246
7 3300006178 Ga0075367_10049609 Ga0075367_100496093 246
8 3300010375 Ga0105239_10423576 Ga0105239_104235762 246
9 3300014497 Ga0182008_10017339 Ga0182008_100173394 246
10 3300017792 Ga0163161_10206211 Ga0163161_102062112 246
11 3300025254 Ga0209148_1000037 Ga0209148_1000037378 246
12 3300025272 Ga0209455_1000036 Ga0209455_1000036355 246
13 3300025904 Ga0207647_10166069 Ga0207647_101660692 246
14 3300025909 Ga0207705_10135921 Ga0207705_101359212 246
15 3300025911 Ga0207654_10104890 Ga0207654_101048903 246
16 3300025949 Ga0207667_10163358 Ga0207667_101633581 246
17 3300026116 Ga0207674_10541377 Ga0207674_105413771 246
18 3300027866 Ga0209813_10056096 Ga0209813_100560962 246
19 3300047444 Ga0495675_0290095 Ga0495675_0290095_25_771 246
20 iso_pu_bacteria 2977872689 2977877131 246
21 3300009545 Ga0105237_10081785 Ga0105237_100817851 247
22 3300014325 Ga0163163_10062269 Ga0163163_100622692 247
23 3300014968 Ga0157379_10131922 Ga0157379_101319222 247
24 3300026067 Ga0207678_10421090 Ga0207678_104210901 247
25 3300048923 Ga0496120_0021302 Ga0496120_0021302_3089_3841 247
26 3300050494 nmdc:mga06z11_405871_c1 nmdc:mga06z11_405871_c1_38_784 247
27 3300009093 Ga0105240_10378179 Ga0105240_103781792 248
28 3300010375 Ga0105239_10010843 Ga0105239_100108435 248
29 3300025297 Ga0209758_1021304 Ga0209758_10213042 248
30 3300025912 Ga0207707_10130705 Ga0207707_101307052 248
31 3300025913 Ga0207695_10225033 Ga0207695_102250332 248
32 3300041452 Ga0451793_0446925 Ga0451793_0446925_342_1088 248
33 3300041458 Ga0451798_0284410 Ga0451798_0284410_75_821 248
34 3300053093 Ga0500651_0002750 Ga0500651_0002750_4992_5738 248
35 3300005341 Ga0070691_10017967 Ga0070691_100179673 249
36 3300005434 Ga0070709_10021133 Ga0070709_100211335 249
37 3300005435 Ga0070714_100087697 Ga0070714_1000876973 249
38 3300005438 Ga0070701_10012359 Ga0070701_100123591 249
39 3300005440 Ga0070705_100000079 Ga0070705_10000007925 249
40 3300005441 Ga0070700_100017375 Ga0070700_1000173754 249
41 3300005458 Ga0070681_10045659 Ga0070681_100456594 249
42 3300005545 Ga0070695_100000380 Ga0070695_10000038011 249
43 3300005546 Ga0070696_100000425 Ga0070696_10000042516 249
44 3300005615 Ga0070702_100088864 Ga0070702_1000888641 249
45 3300005617 Ga0068859_100070495 Ga0068859_1000704954 249
46 3300005842 Ga0068858_100127983 Ga0068858_1001279832 249
47 3300005985 Ga0081539_10000444 Ga0081539_1000044470 249
48 3300006048 Ga0075363_100238706 Ga0075363_1002387062 249
49 3300006051 Ga0075364_10001378 Ga0075364_1000137812 249
50 3300006175 Ga0070712_100012063 Ga0070712_1000120633 249
51 3300006844 Ga0075428_100625862 Ga0075428_1006258622 249
52 3300006846 Ga0075430_100032484 Ga0075430_1000324843 249
53 3300006914 Ga0075436_100014203 Ga0075436_1000142035 249
54 3300006931 Ga0097620_100070494 Ga0097620_1000704944 249
55 3300007076 Ga0075435_100053969 Ga0075435_1000539693 249
56 3300009093 Ga0105240_10012018 Ga0105240_100120184 249
57 3300009147 Ga0114129_10172476 Ga0114129_101724762 249
58 3300009147 Ga0114129_10381802 Ga0114129_103818022 249
59 3300009177 Ga0105248_10043201 Ga0105248_100432011 249
60 3300010159 Ga0099796_10002227 Ga0099796_100022274 249
61 3300010375 Ga0105239_10026693 Ga0105239_100266933 249
62 3300010375 Ga0105239_10389707 Ga0105239_103897072 249
63 3300025912 Ga0207707_10064452 Ga0207707_100644521 249
64 3300025913 Ga0207695_10009269 Ga0207695_100092693 249
65 3300025915 Ga0207693_10004440 Ga0207693_100044402 249
66 3300026035 Ga0207703_10096887 Ga0207703_100968872 249
67 3300026118 Ga0207675_100100763 Ga0207675_1001007632 249
68 3300036401 Ga0373937_0114014 Ga0373937_0114014_820_1578 249
69 3300037418 Ga0395900_0229005 Ga0395900_0229005_140_889 249
70 3300037466 Ga0395898_0263943 Ga0395898_0263943_116_865 249
71 3300038443 Ga0395901_0279056 Ga0395901_0279056_25_774 249
72 3300041413 Ga0439465_0003131 Ga0439465_0003131_3751_4500 249
73 3300041494 Ga0451837_0861550 Ga0451837_0861550_47_796 249
74 3300042004 Ga0439445_0084393 Ga0439445_0084393_19_768 249
75 3300042006 Ga0439432_003954 Ga0439432_003954_2093_2842 249
76 3300042007 Ga0439449_0013213 Ga0439449_0013213_2329_3078 249
77 3300046462 Ga0495651_0003650 Ga0495651_0003650_9607_10365 249
78 3300046463 Ga0495653_0057422 Ga0495653_0057422_820_1578 249
79 3300046472 Ga0495580_0170031 Ga0495580_0170031_595_1344 249
80 3300046476 Ga0495662_0012048 Ga0495662_0012048_2992_3750 249
81 3300046477 Ga0495664_0001054 Ga0495664_0001054_10924_11682 249
82 3300046511 Ga0495608_0068135 Ga0495608_0068135_558_1316 249
83 3300046516 Ga0495628_0008616 Ga0495628_0008616_1697_2455 249
84 3300046517 Ga0495630_0018994 Ga0495630_0018994_3602_4360 249
85 3300046520 Ga0495637_0091506 Ga0495637_0091506_399_1148 249
86 3300046524 Ga0495648_0063919 Ga0495648_0063919_922_1671 249
87 3300046529 Ga0495652_0065611 Ga0495652_0065611_76_834 249
88 3300046531 Ga0495665_0056410 Ga0495665_0056410_116_874 249
89 3300046536 Ga0495587_0059856 Ga0495587_0059856_1207_1965 249
90 3300046543 Ga0495645_0002549 Ga0495645_0002549_10957_11715 249
91 3300046559 Ga0495667_0021678 Ga0495667_0021678_2884_3642 249
92 3300046615 Ga0495656_0001532 Ga0495656_0001532_4403_5152 249
93 3300046642 Ga0495634_0017423 Ga0495634_0017423_3577_4335 249
94 3300046663 Ga0495635_0027868 Ga0495635_0027868_2530_3288 249
95 3300046675 Ga0495657_0018110 Ga0495657_0018110_645_1403 249
96 3300046678 Ga0495599_0019861 Ga0495599_0019861_1203_1961 249
97 3300046680 Ga0495646_0056965 Ga0495646_0056965_554_1312 249
98 3300046689 Ga0495613_0028020 Ga0495613_0028020_501_1259 249
99 3300046689 Ga0495613_0091919 Ga0495613_0091919_666_1415 249
100 3300046809 Ga0495600_0005446 Ga0495600_0005446_1921_2679 249
101 3300047319 Ga0495674_0031347 Ga0495674_0031347_610_1368 249
102 3300047320 Ga0495672_0020134 Ga0495672_0020134_2097_2846 249
103 3300047443 Ga0495687_007286 Ga0495687_007286_1631_2380 249
104 3300047446 Ga0495679_015719 Ga0495679_015719_229_978 249
105 3300048905 Ga0496102_0038016 Ga0496102_0038016_2675_3424 249
106 3300048909 Ga0496106_0000298 Ga0496106_0000298_6197_6946 249
107 3300048909 Ga0496106_0135520 Ga0496106_0135520_213_962 249
108 3300048910 Ga0496107_0086733 Ga0496107_0086733_951_1700 249
109 3300048918 Ga0496115_0175866 Ga0496115_0175866_809_1558 249
110 3300048924 Ga0496121_0406222 Ga0496121_0406222_89_838 249
111 3300048929 Ga0496126_0018073 Ga0496126_0018073_653_1402 249
112 3300048929 Ga0496126_0324382 Ga0496126_0324382_312_1061 249
113 3300049592 Ga0501076_0567385 Ga0501076_0567385_110_859 249
114 3300049741 Ga0501079_0324061 Ga0501079_0324061_281_1030 249
115 3300049823 Ga0501044_0659112 Ga0501044_0659112_171_920 249
116 3300050492 nmdc:mga0yw44_17487_c1 nmdc:mga0yw44_17487_c1_1084_1833 249
117 3300050494 nmdc:mga06z11_276082_c1 nmdc:mga06z11_276082_c1_24_773 249
118 3300050496 nmdc:mga07m45_9175_c1 nmdc:mga07m45_9175_c1_2836_3585 249
119 3300050507 nmdc:mga05p37_142895_c1 nmdc:mga05p37_142895_c1_763_1512 249
120 3300050510 nmdc:mga06r32_26094_c1 nmdc:mga06r32_26094_c1_1773_2522 249
121 3300050510 nmdc:mga06r32_5610_c1 nmdc:mga06r32_5610_c1_6779_7528 249
122 3300054114 Ga0501084_0206887 Ga0501084_0206887_425_1174 249
123 iso_pu_bacteria 2941499720 2941502726 249
124 3300005468 Ga0070707_100054109 Ga0070707_1000541092 250
125 3300006028 Ga0070717_10013471 Ga0070717_100134713 250
126 3300046665 Ga0495661_0035454 Ga0495661_0035454_1451_2212 250
127 3300053093 Ga0500651_0000009 Ga0500651_0000009_84071_84832 250
128 3300005262 Ga0065165_1027360 Ga0065165_10273602 251
129 3300005719 Ga0068861_100482742 Ga0068861_1004827421 251
130 3300021388 Ga0213875_10000935 Ga0213875_100009354 251
131 3300035170 Ga0373943_0023748 Ga0373943_0023748_374_1177 251
132 3300035171 Ga0373946_0027093 Ga0373946_0027093_863_1666 251
133 3300035692 Ga0373935_0082763 Ga0373935_0082763_975_1778 251
134 3300035695 Ga0373927_0051139 Ga0373927_0051139_1487_2290 251
135 3300037068 Ga0373925_0001247 Ga0373925_0001247_18573_19376 251
136 3300037853 Ga0436364_0838310 Ga0436364_0838310_11520_12290 251
137 3300046526 Ga0495666_0083834 Ga0495666_0083834_305_1108 251
138 3300047319 Ga0495674_0182578 Ga0495674_0182578_334_1137 251
139 3300047471 Ga0495684_0389056 Ga0495684_0389056_119_922 251
140 3300048908 Ga0496105_0307746 Ga0496105_0307746_473_1246 251
141 3300050513 nmdc:mga0rr50_32950_c1 nmdc:mga0rr50_32950_c1_685_1488 251
142 3300050514 nmdc:mga08x19_28688_c1 nmdc:mga08x19_28688_c1_1728_2531 251
143 iso_pu_bacteria 2513237138 2513871779 251
144 iso_pu_bacteria 2582581279 2585147596 251
145 iso_pu_bacteria 2909042592 2909047301 251
146 iso_pu_bacteria 2923556063 2923561912 251
147 3300006048 Ga0075363_100020786 Ga0075363_1000207868 252
148 3300006178 Ga0075367_10005945 Ga0075367_100059451 252
149 3300006237 Ga0097621_100057148 Ga0097621_1000571485 252
150 3300006358 Ga0068871_100475644 Ga0068871_1004756441 252
151 3300039438 Ga0436360_0430836 Ga0436360_0430836_36_797 252
152 3300006846 Ga0075430_100015606 Ga0075430_1000156064 253
153 3300006847 Ga0075431_100085720 Ga0075431_1000857202 253
154 3300039447 Ga0436361_0122568 Ga0436361_0122568_773_1537 253
155 3300050509 nmdc:mga0qj67_13985_c1 nmdc:mga0qj67_13985_c1_1601_2368 253
156 3300050510 nmdc:mga06r32_91699_c1 nmdc:mga06r32_91699_c1_602_1369 253
157 iso_pu_bacteria 2582581867 2585403185 253
158 3300003354 JGI25160J50197_1016142 JGI25160J50197_10161422 254
159 3300006844 Ga0075428_100100763 Ga0075428_1001007632 254
160 3300006847 Ga0075431_100051761 Ga0075431_1000517616 254
161 3300006852 Ga0075433_10184261 Ga0075433_101842613 254
162 3300006871 Ga0075434_100128951 Ga0075434_1001289512 254
163 3300007076 Ga0075435_100116554 Ga0075435_1001165543 254
164 3300024225 Ga0224572_1001023 Ga0224572_10010233 254
165 3300024227 Ga0228598_1000041 Ga0228598_100004112 254
166 3300025284 Ga0209130_1001943 Ga0209130_10019437 254
167 3300025302 Ga0207426_1004254 Ga0207426_10042544 254
168 3300025940 Ga0207691_10059778 Ga0207691_100597783 254
169 iso_pu_bacteria 2513237144 2513911405 254
170 iso_pu_bacteria 2858950400 2858950882 254
171 iso_pu_bacteria 2932794094 2932798353 254
172 iso_pu_bacteria 2932801729 2932804149 254
173 iso_pu_bacteria 2935883170 2935884046 254
174 iso_pu_bacteria 3005594810 3005596503 254
175 iso_pu_bacteria 3005710791 3005712573 254
176 iso_pu_bacteria 8019648815 8019650065 254
177 iso_pu_bacteria 8056967851 8056969675 254
178 3300005548 Ga0070665_100304300 Ga0070665_1003043002 255
179 3300010375 Ga0105239_10999789 Ga0105239_109997891 255
180 3300025921 Ga0207652_10224722 Ga0207652_102247223 255
181 3300044706 Ga0466964_0129745 Ga0466964_0129745_37_810 255
182 iso_pu_bacteria 2841864319 2841870724 255
183 iso_pu_bacteria 2844163670 2844166171 255
184 iso_pu_bacteria 3005718088 3005719633 255
185 iso_pu_bacteria 642555112 642598867 255
186 3300046660 Ga0495625_0100603 Ga0495625_0100603_439_1230 256
187 3300048912 Ga0496109_0306938 Ga0496109_0306938_113_889 256
188 3300053098 Ga0500650_0217429 Ga0500650_0217429_16_807 256
189 3300053139 Ga0500568_0000205 Ga0500568_0000205_17621_18427 256
190 iso_pu_bacteria 2508501127 2509141655 256
191 iso_pu_bacteria 2509276021 2509392402 256
192 iso_pu_bacteria 2509276033 2509446664 256
193 iso_pu_bacteria 2597489875 2597813409 256
194 iso_pu_bacteria 2599185352 2600196800 256
195 iso_pu_bacteria 2791355259 2793312493 256
196 iso_pu_bacteria 2791355263 2793344900 256
197 iso_pu_bacteria 2791355266 2793360684 256
198 iso_pu_bacteria 2838042994 2838043668 256
199 iso_pu_bacteria 2842341865 2842345358 256
200 iso_pu_bacteria 2842363717 2842364806 256
201 iso_pu_bacteria 2885312484 2885317644 256
202 iso_pu_bacteria 2936381700 2936387573 256
203 iso_pu_bacteria 2937836603 2937838316 256
204 iso_pu_bacteria 2958071322 2958072739 256
205 iso_pu_bacteria 2970524798 2970530653 256
206 iso_pu_bacteria 8004633249 8004636019 256
207 iso_pu_bacteria 8005695170 8005699759 256
208 iso_pu_bacteria 8055617313 8055621145 256
209 3300031911 Ga0307412_10125511 Ga0307412_101255113 257
210 3300046459 Ga0495629_0047870 Ga0495629_0047870_823_1602 257
211 3300046514 Ga0495618_0084114 Ga0495618_0084114_1237_2016 257
212 3300046660 Ga0495625_0060852 Ga0495625_0060852_1800_2579 257
213 3300046663 Ga0495635_0011793 Ga0495635_0011793_4839_5618 257
214 3300046675 Ga0495657_0016350 Ga0495657_0016350_3740_4519 257
215 3300046680 Ga0495646_0259379 Ga0495646_0259379_99_878 257
216 3300046690 Ga0495624_0015047 Ga0495624_0015047_4390_5169 257
217 3300047317 Ga0495604_0016956 Ga0495604_0016956_948_1727 257
218 3300047321 Ga0495676_0062972 Ga0495676_0062972_1076_1855 257
219 3300047673 Ga0495593_0021553 Ga0495593_0021553_1555_2334 257
220 3300048088 Ga0495602_0190339 Ga0495602_0190339_532_1311 257
221 3300048907 Ga0496104_0030085 Ga0496104_0030085_3368_4147 257
222 3300048908 Ga0496105_0003866 Ga0496105_0003866_9913_10692 257
223 3300048918 Ga0496115_0033160 Ga0496115_0033160_376_1155 257
224 3300048921 Ga0496118_0082496 Ga0496118_0082496_1012_1791 257
225 3300048922 Ga0496119_0013564 Ga0496119_0013564_4695_5474 257
226 3300048924 Ga0496121_0106532 Ga0496121_0106532_14_793 257
227 3300048927 Ga0496124_0147643 Ga0496124_0147643_635_1414 257
228 3300048929 Ga0496126_0084081 Ga0496126_0084081_169_948 257
229 3300053104 Ga0500556_0004389 Ga0500556_0004389_1486_2271 257
230 3300053136 Ga0500559_0057717 Ga0500559_0057717_131_910 257
231 iso_pu_bacteria 2791355260 2793323024 257
232 iso_pu_bacteria 2856342000 2856342468 257
233 3300003773 Ga0055537_1000369 Ga0055537_10003696 258
234 3300003784 Ga0055534_1000044 Ga0055534_100004449 258
235 3300003790 Ga0055528_1000175 Ga0055528_100017525 258
236 3300005288 Ga0065714_10065424 Ga0065714_100654242 258
237 3300005435 Ga0070714_100052883 Ga0070714_1000528833 258
238 3300005983 Ga0081540_1028224 Ga0081540_10282243 258
239 3300006048 Ga0075363_100008129 Ga0075363_1000081295 258
240 3300006177 Ga0075362_10022348 Ga0075362_100223483 258
241 3300006941 Ga0099825_1027163 Ga0099825_10271633 258
242 3300006942 Ga0099824_1008495 Ga0099824_100849512 258
243 3300006943 Ga0099822_1013304 Ga0099822_10133042 258
244 3300006948 Ga0099826_10001431 Ga0099826_100014311 258
245 3300009174 Ga0105241_10254760 Ga0105241_102547601 258
246 3300025263 Ga0209565_1000039 Ga0209565_1000039200 258
247 3300025273 Ga0209673_1000146 Ga0209673_100014664 258
248 3300025273 Ga0209673_1003962 Ga0209673_10039626 258
249 3300025291 Ga0209675_1000030 Ga0209675_1000030200 258
250 3300025294 Ga0209025_1044413 Ga0209025_10444131 258
251 3300025297 Ga0209758_1002424 Ga0209758_100242420 258
252 3300025929 Ga0207664_10076908 Ga0207664_100769082 258
253 3300027357 Ga0209589_1000001 Ga0209589_1000001115 258
254 3300027361 Ga0209489_100001 Ga0209489_100001115 258
255 3300027363 Ga0209700_100001 Ga0209700_100001115 258
256 3300027666 Ga0209282_1012610 Ga0209282_10126106 258
257 3300031852 Ga0307410_10216842 Ga0307410_102168421 258
258 3300031911 Ga0307412_10099604 Ga0307412_100996042 258
259 3300031911 Ga0307412_10303338 Ga0307412_103033382 258
260 3300031995 Ga0307409_100580835 Ga0307409_1005808352 258
261 3300031995 Ga0307409_100926540 Ga0307409_1009265401 258
262 3300032005 Ga0307411_10201290 Ga0307411_102012902 258
263 3300032005 Ga0307411_10526205 Ga0307411_105262051 258
264 3300041404 Ga0439436_0046417 Ga0439436_0046417_268_1089 258
265 3300042133 Ga0450896_001581 Ga0450896_001581_1873_2694 258
266 3300042184 Ga0450908_000341 Ga0450908_000341_1188_2009 258
267 3300042531 Ga0450918_000211 Ga0450918_000211_4277_5098 258
268 3300044765 Ga0466970_0305838 Ga0466970_0305838_50_832 258
269 3300044842 Ga0466957_0090186 Ga0466957_0090186_946_1728 258
270 3300046463 Ga0495653_0087548 Ga0495653_0087548_209_991 258
271 3300046476 Ga0495662_0196590 Ga0495662_0196590_40_822 258
272 3300046477 Ga0495664_0016951 Ga0495664_0016951_1372_2154 258
273 3300046511 Ga0495608_0067924 Ga0495608_0067924_790_1572 258
274 3300046516 Ga0495628_0142173 Ga0495628_0142173_194_976 258
275 3300046529 Ga0495652_0021740 Ga0495652_0021740_2900_3682 258
276 3300046533 Ga0495640_0080553 Ga0495640_0080553_522_1304 258
277 3300046536 Ga0495587_0033155 Ga0495587_0033155_424_1206 258
278 3300046543 Ga0495645_0012442 Ga0495645_0012442_179_961 258
279 3300046559 Ga0495667_0062588 Ga0495667_0062588_385_1167 258
280 3300046642 Ga0495634_0036534 Ga0495634_0036534_2341_3123 258
281 3300046660 Ga0495625_0000052 Ga0495625_0000052_38570_39352 258
282 3300046675 Ga0495657_0036331 Ga0495657_0036331_552_1334 258
283 3300046678 Ga0495599_0005248 Ga0495599_0005248_5575_6357 258
284 3300046680 Ga0495646_0042053 Ga0495646_0042053_662_1444 258
285 3300046809 Ga0495600_0049519 Ga0495600_0049519_314_1096 258
286 3300047317 Ga0495604_0003777 Ga0495604_0003777_3007_3789 258
287 3300047322 Ga0495680_0043439 Ga0495680_0043439_332_1114 258
288 3300047444 Ga0495675_0100549 Ga0495675_0100549_168_950 258
289 3300048088 Ga0495602_0029168 Ga0495602_0029168_4060_4842 258
290 3300050489 nmdc:mga03683_27341_c1 nmdc:mga03683_27341_c1_1243_2025 258
291 3300050490 nmdc:mga03n38_17798_c1 nmdc:mga03n38_17798_c1_292_1074 258
292 iso_pu_bacteria 2508501128 2509149366 258
293 iso_pu_bacteria 2510065019 2510133596 258
294 iso_pu_bacteria 2510461076 2510894998 258
295 iso_pu_bacteria 2513237084 2513573889 258
296 iso_pu_bacteria 2513237085 2513577567 258
297 iso_pu_bacteria 2513237093 2513629787 258
298 iso_pu_bacteria 2513237098 2513676710 258
299 iso_pu_bacteria 2513237103 2513708427 258
300 iso_pu_bacteria 2513237162 2514022439 258
301 iso_pu_bacteria 2513237351 2514589811 258
302 iso_pu_bacteria 2515075009 2515112585 258
303 iso_pu_bacteria 2515154113 2515632936 258
304 iso_pu_bacteria 2515154114 2515640079 258
305 iso_pu_bacteria 2515154116 2515655722 258
306 iso_pu_bacteria 2515154134 2515740175 258
307 iso_pu_bacteria 2516653077 2517036320 258
308 iso_pu_bacteria 2516653085 2517076682 258
309 iso_pu_bacteria 2517093000 2517095455 258
310 iso_pu_bacteria 2517287029 2517407040 258
311 iso_pu_bacteria 2524023210 2524469775 258
312 iso_pu_bacteria 2558860100 2558861898 258
313 iso_pu_bacteria 2585427526 2585527077 258
314 iso_pu_bacteria 2585427528 2585537827 258
315 iso_pu_bacteria 2585427593 2585835777 258
316 iso_pu_bacteria 2599185170 2599414666 258
317 iso_pu_bacteria 2615840624 2616292247 258
318 iso_pu_bacteria 2643221723 2644674703 258
319 iso_pu_bacteria 2718217882 2719181501 258
320 iso_pu_bacteria 2718217927 2719386009 258
321 iso_pu_bacteria 2718217997 2719665825 258
322 iso_pu_bacteria 2718218009 2719732165 258
323 iso_pu_bacteria 2718218199 2720492245 258
324 iso_pu_bacteria 2718218232 2720613600 258
325 iso_pu_bacteria 2718218233 2720620384 258
326 iso_pu_bacteria 2718218235 2720631806 258
327 iso_pu_bacteria 2718218269 2720775534 258
328 iso_pu_bacteria 2718218363 2721147593 258
329 iso_pu_bacteria 2718218365 2721159039 258
330 iso_pu_bacteria 2718218366 2721164428 258
331 iso_pu_bacteria 2718218423 2721399790 258
332 iso_pu_bacteria 2721755514 2722840598 258
333 iso_pu_bacteria 2721755556 2723027154 258
334 iso_pu_bacteria 2721755684 2723560766 258
335 iso_pu_bacteria 2721755685 2723567353 258
336 iso_pu_bacteria 2721755809 2724038603 258
337 iso_pu_bacteria 2721755810 2724044921 258
338 iso_pu_bacteria 2721755819 2724090141 258
339 iso_pu_bacteria 2721755822 2724104618 258
340 iso_pu_bacteria 2721755823 2724110433 258
341 iso_pu_bacteria 2724679232 2725950563 258
342 iso_pu_bacteria 2728369352 2730108090 258
343 iso_pu_bacteria 2728369365 2730164736 258
344 iso_pu_bacteria 2728369397 2730298671 258
345 iso_pu_bacteria 2738541333 2739032486 258
346 iso_pu_bacteria 2751185846 2753567586 258
347 iso_pu_bacteria 2765235942 2766066839 258
348 iso_pu_bacteria 2791355094 2792641396 258
349 iso_pu_bacteria 2791355256 2793294908 258
350 iso_pu_bacteria 2791355261 2793330706 258
351 iso_pu_bacteria 2791355262 2793337235 258
352 iso_pu_bacteria 2791355264 2793349890 258
353 iso_pu_bacteria 2791355265 2793352827 258
354 iso_pu_bacteria 2791355267 2793366970 258
355 iso_pu_bacteria 2802429605 2805925928 258
356 iso_pu_bacteria 2802429606 2805937571 258
357 iso_pu_bacteria 2802429633 2806043461 258
358 iso_pu_bacteria 2802429634 2806050605 258
359 iso_pu_bacteria 2802429635 2806057422 258
360 iso_pu_bacteria 2802429636 2806064803 258
361 iso_pu_bacteria 2802429637 2806072070 258
362 iso_pu_bacteria 2821443989 2821444811 258
363 iso_pu_bacteria 2838016132 2838017984 258
364 iso_pu_bacteria 2838022645 2838026190 258
365 iso_pu_bacteria 2838035591 2838042304 258
366 iso_pu_bacteria 2838048938 2838054798 258
367 iso_pu_bacteria 2838061910 2838068473 258
368 iso_pu_bacteria 2838068647 2838074432 258
369 iso_pu_bacteria 2838661181 2838667891 258
370 iso_pu_bacteria 2838668709 2838673626 258
371 iso_pu_bacteria 2838686498 2838692069 258
372 iso_pu_bacteria 2838701080 2838706022 258
373 iso_pu_bacteria 2838729681 2838732785 258
374 iso_pu_bacteria 2838742623 2838749757 258
375 iso_pu_bacteria 2840764183 2840764886 258
376 iso_pu_bacteria 2841851746 2841855879 258
377 iso_pu_bacteria 2842110456 2842114110 258
378 iso_pu_bacteria 2842146304 2842150875 258
379 iso_pu_bacteria 2842156927 2842157129 258
380 iso_pu_bacteria 2842163707 2842167789 258
381 iso_pu_bacteria 2842180545 2842181287 258
382 iso_pu_bacteria 2842192696 2842194277 258
383 iso_pu_bacteria 2842198810 2842201877 258
384 iso_pu_bacteria 2842205361 2842205806 258
385 iso_pu_bacteria 2842217011 2842217544 258
386 iso_pu_bacteria 2842229732 2842230662 258
387 iso_pu_bacteria 2842243621 2842245238 258
388 iso_pu_bacteria 2842250916 2842255836 258
389 iso_pu_bacteria 2842257432 2842259051 258
390 iso_pu_bacteria 2842264693 2842265818 258
391 iso_pu_bacteria 2842271015 2842276279 258
392 iso_pu_bacteria 2842278818 2842279263 258
393 iso_pu_bacteria 2842285085 2842285907 258
394 iso_pu_bacteria 2842304105 2842304578 258
395 iso_pu_bacteria 2842311132 2842314472 258
396 iso_pu_bacteria 2842317721 2842323033 258
397 iso_pu_bacteria 2842395702 2842398929 258
398 iso_pu_bacteria 2842402390 2842403266 258
399 iso_pu_bacteria 2842409023 2842409361 258
400 iso_pu_bacteria 2842415677 2842416014 258
401 iso_pu_bacteria 2842422224 2842428191 258
402 iso_pu_bacteria 2842428310 2842429545 258
403 iso_pu_bacteria 2842434925 2842436158 258
404 iso_pu_bacteria 2842441272 2842442505 258
405 iso_pu_bacteria 2842447887 2842450808 258
406 iso_pu_bacteria 2842462802 2842463966 258
407 iso_pu_bacteria 2842469257 2842470487 258
408 iso_pu_bacteria 2842489311 2842490258 258
409 iso_pu_bacteria 2842495871 2842495945 258
410 iso_pu_bacteria 2842677519 2842678531 258
411 iso_pu_bacteria 2844454524 2844458876 258
412 iso_pu_bacteria 2857516855 2857520001 258
413 iso_pu_bacteria 2874123672 2874126502 258
414 iso_pu_bacteria 2883087390 2883090237 258
415 iso_pu_bacteria 2885192300 2885195660 258
416 iso_pu_bacteria 2903768456 2903772371 258
417 iso_pu_bacteria 2919462493 2919465054 258
418 iso_pu_bacteria 2920822456 2920828053 258
419 iso_pu_bacteria 2933570622 2933571850 258
420 iso_pu_bacteria 2933586486 2933590206 258
421 iso_pu_bacteria 2933599457 2933604888 258
422 iso_pu_bacteria 2935901341 2935905398 258
423 iso_pu_bacteria 2936367885 2936372429 258
424 iso_pu_bacteria 2936375103 2936376581 258
425 iso_pu_bacteria 2996893221 2996898491 258
426 iso_pu_bacteria 3005409236 3005415050 258
427 iso_pu_bacteria 639633055 639648826 258
428 iso_pu_bacteria 8005275841 8005280796 258
429 iso_pu_bacteria 8005282627 8005285268 258
430 iso_pu_bacteria 8005289223 8005293319 258
431 iso_pu_bacteria 8005301065 8005302790 258
432 iso_pu_bacteria 8005307578 8005312452 258
433 iso_pu_bacteria 8005376324 8005379496 258
434 iso_pu_bacteria 8005382845 8005385475 258
435 iso_pu_bacteria 8005395548 8005396530 258
436 iso_pu_bacteria 8005430974 8005431686 258
437 iso_pu_bacteria 8005460587 8005463260 258
438 iso_pu_bacteria 8005497431 8005500558 258
439 iso_pu_bacteria 8005556819 8005557414 258
440 iso_pu_bacteria 8005563573 8005568593 258
441 iso_pu_bacteria 8005570704 8005574543 258
442 iso_pu_bacteria 8005619151 8005621937 258
443 iso_pu_bacteria 8005626139 8005627176 258
444 iso_pu_bacteria 8005668836 8005671976 258
445 iso_pu_bacteria 8005688590 8005694811 258
446 iso_pu_bacteria 8018127388 8018130133 258
447 iso_pu_bacteria 8018163183 8018166499 258
448 iso_pu_bacteria 8018176218 8018178754 258
449 iso_pu_bacteria 8023680758 8023685097 258
450 iso_pu_bacteria 8024479707 8024483252 258
451 iso_pu_bacteria 8024501048 8024501406 258
452 iso_pu_bacteria 8056375014 8056376855 258
453 iso_pu_bacteria 8056382006 8056388079 258
454 iso_pu_bacteria 8056681323 8056685116 258
455 iso_pu_bacteria 8057874678 8057874748 258
456 3300005366 Ga0070659_100065667 Ga0070659_1000656673 259
457 3300005457 Ga0070662_100031568 Ga0070662_1000315682 259
458 3300025904 Ga0207647_10057971 Ga0207647_100579714 259
459 3300025932 Ga0207690_10029561 Ga0207690_100295613 259
460 3300025933 Ga0207706_10027974 Ga0207706_100279744 259
461 3300026041 Ga0207639_10079660 Ga0207639_100796604 259
462 3300037471 Ga0395905_0000017 Ga0395905_0000017_304612_305397 259
463 3300039450 Ga0436363_0416503 Ga0436363_0416503_139_936 259
464 3300044684 Ga0466966_0002487 Ga0466966_0002487_9298_10083 259
465 3300044693 Ga0466961_0000081 Ga0466961_0000081_21140_21925 259
466 3300044694 Ga0466963_0121735 Ga0466963_0121735_502_1287 259
467 3300045049 Ga0466959_0125080 Ga0466959_0125080_453_1238 259
468 3300045976 Ga0466967_0424355 Ga0466967_0424355_368_1153 259
469 3300050508 nmdc:mga09592_54565_c1 nmdc:mga09592_54565_c1_1562_2377 259
470 3300050512 nmdc:mga0n895_26135_c1 nmdc:mga0n895_26135_c1_3072_3887 259
471 3300050513 nmdc:mga0rr50_46252_c1 nmdc:mga0rr50_46252_c1_2155_2970 259
472 3300050515 nmdc:mga0a205_38507_c1 nmdc:mga0a205_38507_c1_1619_2434 259
473 3300059623 Ga0587101_003345 Ga0587101_003345_773_1558 259
474 3300005466 Ga0070685_10077737 Ga0070685_100777372 260
475 3300006195 Ga0075366_10077806 Ga0075366_100778061 260
476 3300006353 Ga0075370_10034671 Ga0075370_100346711 260
477 3300009176 Ga0105242_10078243 Ga0105242_100782433 260
478 3300009765 Ga0123341_1000013 Ga0123341_100001324 260
479 3300009766 Ga0123342_1040019 Ga0123342_10400193 260
480 3300015262 Ga0182007_10001637 Ga0182007_1000163710 260
481 3300015265 Ga0182005_1061490 Ga0182005_10614902 260
482 3300017792 Ga0163161_10037465 Ga0163161_100374653 260
483 3300025934 Ga0207686_10132535 Ga0207686_101325352 260
484 3300026121 Ga0207683_10046502 Ga0207683_100465025 260
485 3300031247 Ga0265340_10082656 Ga0265340_100826563 260
486 3300046475 Ga0495639_0001912 Ga0495639_0001912_806_1594 260
487 3300046674 Ga0495588_0001503 Ga0495588_0001503_1679_2467 260
488 3300046694 Ga0495649_0006830 Ga0495649_0006830_116_904 260
489 3300048903 Ga0496100_0001473 Ga0496100_0001473_2079_2867 260
490 3300048904 Ga0496101_0024641 Ga0496101_0024641_2397_3185 260
491 3300048905 Ga0496102_0002386 Ga0496102_0002386_5761_6549 260
492 3300048907 Ga0496104_0016340 Ga0496104_0016340_728_1516 260
493 3300048908 Ga0496105_0000649 Ga0496105_0000649_728_1516 260
494 3300048911 Ga0496108_0122490 Ga0496108_0122490_765_1553 260
495 3300048912 Ga0496109_0145240 Ga0496109_0145240_477_1265 260
496 3300048912 Ga0496109_0312476 Ga0496109_0312476_164_952 260
497 3300048913 Ga0496110_0032013 Ga0496110_0032013_3667_4455 260
498 3300048914 Ga0496111_0048660 Ga0496111_0048660_2171_2959 260
499 3300048917 Ga0496114_0098737 Ga0496114_0098737_557_1345 260
500 3300050493 nmdc:mga0k408_267910_c1 nmdc:mga0k408_267910_c1_92_919 260
501 3300050496 nmdc:mga07m45_11528_c1 nmdc:mga07m45_11528_c1_1640_2440 260
502 iso_pu_bacteria 2970540015 2970544691 260
503 3300005471 Ga0070698_100031007 Ga0070698_1000310075 261
504 3300025922 Ga0207646_10118854 Ga0207646_101188542 261
505 3300053177 Ga0500636_0004048 Ga0500636_0004048_5451_6239 261
506 3300003187 JGI25151J46595_10001546 JGI25151J46595_100015462 262
507 3300003187 JGI25151J46595_10003074 JGI25151J46595_100030748 262
508 3300003187 JGI25151J46595_10016131 JGI25151J46595_100161313 262
509 3300003215 JGI25153J46596_10004881 JGI25153J46596_100048818 262
510 3300003354 JGI25160J50197_1000005 JGI25160J50197_100000527 262
511 3300003354 JGI25160J50197_1000879 JGI25160J50197_100087912 262
512 3300003374 JGI25161J50226_1001978 JGI25161J50226_10019785 262
513 3300003374 JGI25161J50226_1004441 JGI25161J50226_10044414 262
514 3300003578 Ga0006562J51391_1028949 Ga0006562J51391_10289491 262
515 3300003771 Ga0055526_1001412 Ga0055526_10014128 262
516 3300003771 Ga0055526_1001916 Ga0055526_10019165 262
517 3300003771 Ga0055526_1002113 Ga0055526_10021139 262
518 3300003775 Ga0055524_1002450 Ga0055524_10024509 262
519 3300003775 Ga0055524_1030762 Ga0055524_10307621 262
520 3300003781 Ga0055536_1002736 Ga0055536_10027361 262
521 3300003781 Ga0055536_1006992 Ga0055536_10069925 262
522 3300003790 Ga0055528_1000269 Ga0055528_100026937 262
523 3300003790 Ga0055528_1000801 Ga0055528_100080114 262
524 3300003790 Ga0055528_1008848 Ga0055528_10088481 262
525 3300003791 Ga0055530_10012997 Ga0055530_100129975 262
526 3300003792 Ga0055540_1000192 Ga0055540_100019251 262
527 3300003792 Ga0055540_1035094 Ga0055540_10350941 262
528 3300003794 Ga0055531_10037896 Ga0055531_100378962 262
529 3300004625 Ga0055543_1000324 Ga0055543_10003247 262
530 3300004625 Ga0055543_1006342 Ga0055543_10063424 262
531 3300005262 Ga0065165_1000002 Ga0065165_1000002363 262
532 3300005262 Ga0065165_1026156 Ga0065165_10261561 262
533 3300005577 Ga0068857_100029877 Ga0068857_1000298771 262
534 3300005719 Ga0068861_100325073 Ga0068861_1003250732 262
535 3300006038 Ga0075365_10002482 Ga0075365_100024828 262
536 3300006042 Ga0075368_10007782 Ga0075368_100077821 262
537 3300006048 Ga0075363_100009405 Ga0075363_1000094056 262
538 3300006177 Ga0075362_10000537 Ga0075362_100005374 262
539 3300006178 Ga0075367_10003052 Ga0075367_100030524 262
540 3300006178 Ga0075367_10070752 Ga0075367_100707523 262
541 3300006186 Ga0075369_10002735 Ga0075369_100027355 262
542 3300006195 Ga0075366_10000974 Ga0075366_100009748 262
543 3300006353 Ga0075370_10002169 Ga0075370_100021691 262
544 3300006353 Ga0075370_10046996 Ga0075370_100469962 262
545 3300006847 Ga0075431_100009169 Ga0075431_1000091696 262
546 3300006847 Ga0075431_100237892 Ga0075431_1002378922 262
547 3300006946 Ga0079104_1016961 Ga0079104_10169612 262
548 3300009545 Ga0105237_10329964 Ga0105237_103299641 262
549 3300010375 Ga0105239_10052716 Ga0105239_100527162 262
550 3300013100 Ga0157373_10015240 Ga0157373_100152402 262
551 3300015690 Ga0183363_1072 Ga0183363_107218 262
552 3300021321 Ga0214542_1017604 Ga0214542_10176046 262
553 3300021327 Ga0214543_1000018 Ga0214543_1000018202 262
554 3300025208 Ga0209436_100162 Ga0209436_10016235 262
555 3300025245 Ga0207425_1004352 Ga0207425_10043524 262
556 3300025258 Ga0209129_1000771 Ga0209129_100077110 262
557 3300025273 Ga0209673_1000013 Ga0209673_1000013176 262
558 3300025273 Ga0209673_1000325 Ga0209673_100032583 262
559 3300025273 Ga0209673_1001202 Ga0209673_100120225 262
560 3300025273 Ga0209673_1004764 Ga0209673_10047644 262
561 3300025284 Ga0209130_1000010 Ga0209130_1000010359 262
562 3300025292 Ga0209676_1001612 Ga0209676_100161213 262
563 3300025294 Ga0209025_1000534 Ga0209025_100053415 262
564 3300025294 Ga0209025_1001166 Ga0209025_100116627 262
565 3300025295 Ga0209564_1000264 Ga0209564_100026467 262
566 3300025295 Ga0209564_1000473 Ga0209564_100047355 262
567 3300025295 Ga0209564_1001458 Ga0209564_100145814 262
568 3300025297 Ga0209758_1002732 Ga0209758_10027329 262
569 3300025298 Ga0209050_1005318 Ga0209050_10053184 262
570 3300025299 Ga0209256_1000245 Ga0209256_100024586 262
571 3300025299 Ga0209256_1000369 Ga0209256_100036931 262
572 3300025299 Ga0209256_1003331 Ga0209256_10033318 262
573 3300025302 Ga0207426_1000036 Ga0207426_1000036359 262
574 3300025302 Ga0207426_1000039 Ga0207426_1000039411 262
575 3300025303 Ga0209051_1000253 Ga0209051_100025312 262
576 3300025303 Ga0209051_1001000 Ga0209051_100100024 262
577 3300025303 Ga0209051_1004287 Ga0209051_10042877 262
578 3300025304 Ga0209257_1002124 Ga0209257_100212422 262
579 3300025304 Ga0209257_1002174 Ga0209257_10021748 262
580 3300025924 Ga0207694_10108647 Ga0207694_101086471 262
581 3300025941 Ga0207711_10024664 Ga0207711_100246643 262
582 3300025944 Ga0207661_10452307 Ga0207661_104523072 262
583 3300025981 Ga0207640_10478058 Ga0207640_104780581 262
584 3300027866 Ga0209813_10017412 Ga0209813_100174121 262
585 3300028794 Ga0307515_10082850 Ga0307515_100828504 262
586 3300030521 Ga0307511_10061864 Ga0307511_100618642 262
587 3300030732 Ga0316176_1140230 Ga0316176_11402301 262
588 3300030733 Ga0314311_1034637 Ga0314311_103463714 262
589 3300030735 Ga0316178_1014198 Ga0316178_10141983 262
590 3300030736 Ga0316180_1096139 Ga0316180_10961393 262
591 3300030742 Ga0316183_1198096 Ga0316183_11980965 262
592 3300031730 Ga0307516_10125575 Ga0307516_101255752 262
593 3300031911 Ga0307412_10188750 Ga0307412_101887502 262
594 3300032002 Ga0307416_100017075 Ga0307416_1000170751 262
595 3300032004 Ga0307414_10017846 Ga0307414_100178467 262
596 3300033179 Ga0307507_10040471 Ga0307507_100404713 262
597 3300033179 Ga0307507_10130146 Ga0307507_101301462 262
598 3300035692 Ga0373935_0056492 Ga0373935_0056492_1259_2053 262
599 3300035695 Ga0373927_0025557 Ga0373927_0025557_1698_2492 262
600 3300037068 Ga0373925_0137337 Ga0373925_0137337_186_980 262
601 3300037312 Ga0395899_0006774 Ga0395899_0006774_3740_4534 262
602 3300037466 Ga0395898_0090669 Ga0395898_0090669_55_849 262
603 3300041404 Ga0439436_0034310 Ga0439436_0034310_295_1089 262
604 3300041492 Ga0451835_0043983 Ga0451835_0043983_995_1843 262
605 3300041498 Ga0451841_0595127 Ga0451841_0595127_806_1603 262
606 3300041503 Ga0451847_0393698 Ga0451847_0393698_1957_2805 262
607 3300041507 Ga0451851_0019019 Ga0451851_0019019_2005_2802 262
608 3300041512 Ga0451853_1819537 Ga0451853_1819537_3640_4446 262
609 3300046460 Ga0495638_0082547 Ga0495638_0082547_507_1295 262
610 3300046474 Ga0495605_0065117 Ga0495605_0065117_699_1487 262
611 3300046492 Ga0495585_0063684 Ga0495585_0063684_37_885 262
612 3300046500 Ga0495596_0065572 Ga0495596_0065572_408_1256 262
613 3300046512 Ga0495610_0033331 Ga0495610_0033331_1604_2392 262
614 3300046524 Ga0495648_0079339 Ga0495648_0079339_794_1600 262
615 3300046530 Ga0495654_0169572 Ga0495654_0169572_136_942 262
616 3300046542 Ga0495597_0027694 Ga0495597_0027694_1594_2400 262
617 3300046558 Ga0495633_0032691 Ga0495633_0032691_157_1005 262
618 3300046648 Ga0495611_0017259 Ga0495611_0017259_1510_2439 262
619 3300046660 Ga0495625_0037865 Ga0495625_0037865_1619_2407 262
620 3300046665 Ga0495661_0077054 Ga0495661_0077054_384_1232 262
621 3300046810 Ga0495660_0015697 Ga0495660_0015697_235_1041 262
622 3300047470 Ga0495681_0038201 Ga0495681_0038201_756_1604 262
623 3300047472 Ga0495686_0021410 Ga0495686_0021410_3267_4055 262
624 3300047472 Ga0495686_0072945 Ga0495686_0072945_695_1543 262
625 3300048909 Ga0496106_0001140 Ga0496106_0001140_2515_3309 262
626 3300048920 Ga0496117_0000939 Ga0496117_0000939_38270_39064 262
627 3300048920 Ga0496117_0011684 Ga0496117_0011684_5503_6297 262
628 3300048921 Ga0496118_0001769 Ga0496118_0001769_19168_19962 262
629 3300048921 Ga0496118_0003337 Ga0496118_0003337_5757_6551 262
630 3300048921 Ga0496118_0010658 Ga0496118_0010658_4763_5551 262
631 3300048924 Ga0496121_0000668 Ga0496121_0000668_55454_56248 262
632 3300048924 Ga0496121_0007858 Ga0496121_0007858_934_1848 262
633 3300048927 Ga0496124_0003401 Ga0496124_0003401_8610_9404 262
634 3300048929 Ga0496126_0006242 Ga0496126_0006242_6735_7529 262
635 3300050489 nmdc:mga03683_33832_c1 nmdc:mga03683_33832_c1_1041_1829 262
636 3300050490 nmdc:mga03n38_58687_c1 nmdc:mga03n38_58687_c1_825_1631 262
637 3300050492 nmdc:mga0yw44_11147_c1 nmdc:mga0yw44_11147_c1_1490_2278 262
638 3300050493 nmdc:mga0k408_11233_c1 nmdc:mga0k408_11233_c1_3788_4576 262
639 3300050494 nmdc:mga06z11_15600_c2 nmdc:mga06z11_15600_c2_13_801 262
640 3300050495 nmdc:mga04h51_20610_c1 nmdc:mga04h51_20610_c1_121_909 262
641 3300050496 nmdc:mga07m45_9404_c1 nmdc:mga07m45_9404_c1_1397_2185 262
642 3300050516 nmdc:mga0sz30_6761_c1 nmdc:mga0sz30_6761_c1_966_1754 262
643 3300053083 Ga0495655_0070867 Ga0495655_0070867_112_918 262
644 3300053094 Ga0500566_0087528 Ga0500566_0087528_317_1111 262
645 3300053119 Ga0500595_015254 Ga0500595_015254_1278_2072 262
646 3300053134 Ga0500658_0002671 Ga0500658_0002671_2687_3475 262
647 3300054114 Ga0501084_0231516 Ga0501084_0231516_346_1140 262

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05988

DUF899

Bacterial protein of unknown function (DUF899)

13

232

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kcm-assembly1.cif.gz_A the crystal structure of thioredoxin protein from geobacter metallireducens 0.7039 59 184
4xih-assembly1.cif.gz_B-2 crystal structure of the r116a mutant ahpe from mycobacterium tuberculosis 0.7028 53 187
5um7-assembly2.cif.gz_B crystal structure of the reduced state of the thiol-disulfide reductase sdba from streptococcus gordonii 0.6731 61 192
1xvw-assembly1.cif.gz_B crystal structure of ahpe from mycobacterium tuberculosis, a 1-cys peroxiredoxin 0.6507 53 187
2h1b-assembly2.cif.gz_B resa e80q 0.6464 54 203
ID Description Score Start End Superfamily
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.724 60 185 3.40.30.10
3kcmB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6969 59 201 3.40.30.10
af_A4I174_5_200_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6808 114 154 3.40.50.1000
af_Q9D1A0_27_140_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6666 63 158 3.40.30.10
3erwA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6606 56 193 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1X2FAW9-F1-model_v4 DUF899 domain-containing protein 0.9088 14 234
AF-A0A1X2FAW9-F1-model_v4 DUF899 domain-containing protein 0.9049 14 234
AF-A0A4R4WCJ1-F1-model_v4 DUF899 domain-containing protein 0.9032 13 234
AF-A0A5N0V0U4-F1-model_v4 DUF899 domain-containing protein 0.9013 14 253
AF-A0A7W1J4Q3-F1-model_v4 DUF899 domain-containing protein 0.9005 14 234

Feature Viewer

pLDDT pTM Quality
76.92 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map