F472273

General Info

Members Datasets Scaffolds Average Seq Length
647 343 564 159

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10496585|Ga0105242_104965852
Length 171
Sequence VSFHPLSFFICTKKTEVRIGFGFDVHQLKEGRPFRLGGIEIVHPKGAEGHSDADVLIHAICDALLGAANLGDIGKHFPDTSNEFKNIDSKILLKRVCKLLKKNNFSIGNIDSTICLEKPKIAAYIPSMVKTLTDVMEIEPNNLSIKATTNEKLGFIGREEGVACYAVALIK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
3 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
4 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
5 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
6 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
7 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
8 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
9 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
10 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
11 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
12 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
13 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
14 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
15 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
16 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
17 2671180694 Paenibacillus sp. A3 Isolate Unclassified
18 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
19 2738541283 Pedobacter sp. OK701 Isolate Unclassified
20 2738541284 Pedobacter sp. YR016 Isolate Unclassified
21 2738541302 Pedobacter sp. CF074 Isolate Unclassified
22 2738543023 Pedobacter sp. OK628 Isolate Unclassified
23 2739367651 Pedobacter sp. OK291 Isolate Unclassified
24 2739367656 Pedobacter sp. CF523 Isolate Unclassified
25 2739367663 Pedobacter sp. YR510 Isolate Unclassified
26 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
27 2818991437 Pedobacter terrae 518 Isolate Unclassified
28 2818991459 Paenibacillus sp. 597 Isolate Unclassified
29 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
30 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
31 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
32 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
33 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
34 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
35 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
36 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
37 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
38 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
39 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
40 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
41 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
42 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
43 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
44 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
45 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
46 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
47 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
48 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
49 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
50 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
51 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
52 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
53 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
54 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
55 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
56 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
57 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
58 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
59 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
60 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
61 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
62 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
63 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
64 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
65 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
66 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
67 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
68 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
69 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
70 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
71 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
72 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
73 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
74 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
75 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
76 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
77 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
78 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
79 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
80 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
81 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
82 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
83 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
84 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
85 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
86 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
87 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
88 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
89 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
90 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
91 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
92 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
93 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
94 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
95 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
96 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
97 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
98 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
99 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
100 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
104 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
105 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
106 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
107 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
108 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
109 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
110 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
111 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
112 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
113 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
114 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
115 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
116 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
117 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
118 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
119 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
120 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
121 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
122 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
123 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
124 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
125 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
126 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
127 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
128 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
129 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
130 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
131 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
132 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
133 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
134 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
135 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
136 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
137 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
138 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
139 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
140 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
141 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
142 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
143 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
144 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
145 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
146 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
147 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
148 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
149 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
150 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
151 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
152 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
153 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
154 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
155 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
156 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
157 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
158 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
159 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
160 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
161 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
162 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
163 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
164 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
165 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
166 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
167 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
168 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
169 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
170 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
171 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
172 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
173 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
174 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
175 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
178 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
179 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
181 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
182 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
183 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
184 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
188 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
189 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
230 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
231 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
232 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
233 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
234 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
235 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
236 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
237 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
238 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
239 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
240 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
241 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
242 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
243 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
244 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
245 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
246 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
247 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
248 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
249 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
250 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
251 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
252 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
255 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
256 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
257 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
258 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
259 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
260 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
261 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
262 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
263 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
264 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
265 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
266 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
267 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
268 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
269 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
270 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
271 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
272 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
273 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
274 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
275 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
276 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
277 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
278 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
279 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
280 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
281 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
282 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
283 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
284 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
285 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
286 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
287 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
288 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
289 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
290 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
291 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
292 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
293 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
294 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
295 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
296 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
297 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
298 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
299 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
300 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
301 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
302 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
303 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
304 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
305 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
306 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
309 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
310 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
311 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
312 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
313 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
314 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
315 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
316 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
317 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
318 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
319 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
322 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
323 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
324 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
325 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
326 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
327 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
328 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
329 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
330 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
331 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
332 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
333 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
334 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
335 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
336 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
337 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
338 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
339 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
340 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
341 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
342 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
343 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.71
Metatranscriptomes 0.46
Isolates 12.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.12
Nodule 0.15
Rhizoplane 1.39
Rhizosphere 76.66
Stem 0
Stem Tuber 0
Unclassified 12.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2733172 2162886007 Bacteria 2171
2 SwRhRL2b_contig_283825 2162886007 Bacteria 3292
3 SwRhRL2b_contig_2893490 2162886007 Bacteria 810
4 JGI24736J21556_1009589 3300001904 Bacteria 1594
5 JGI24739J22299_10004683 3300001989 Bacteria 5231
6 JGI24739J22299_10098258 3300001989 Bacteria 885
7 JGI24737J22298_10000797 3300001990 Bacteria 11180
8 JGI24737J22298_10001612 3300001990 Bacteria 8027
9 JGI24737J22298_10016443 3300001990 Bacteria 2388
10 JGI24735J21928_10000032 3300002067 Bacteria 72360
11 JGI25162J39368_1000118 3300002737 Bacteria 87343
12 JGI25162J39368_1000562 3300002737 Bacteria 27227
13 JGI25164J39214_1001737 3300002772 Bacteria 4356
14 JGI25152J39213_1000064 3300002773 Bacteria 70321
15 JGI25150J39212_1000004 3300002774 Bacteria 417320
16 JGI25151J46595_10000002 3300003187 Bacteria 731381
17 JGI25151J46595_10014070 3300003187 Bacteria 3581
18 JGI25165J46597_1001048 3300003214 Bacteria 17982
19 JGI25153J46596_10000037 3300003215 Bacteria 182199
20 rootH1_10018888 3300003316 Bacteria 30592
21 rootH1_10028516 3300003316 Bacteria 6722
22 rootH2_10012714 3300003320 Bacteria 66260
23 rootH2_10046324 3300003320 Bacteria 15867
24 rootH2_10053205 3300003320 Bacteria 3197
25 rootL2_10112871 3300003322 Bacteria 3757
26 rootH1_10012646 3300003323 Bacteria 62371
27 rootH1_10024376 3300003323 Bacteria 1844
28 rootH1_10164405 3300003323 Bacteria 9397
29 rootH1_10253128 3300003323 Bacteria 1533
30 rootH1_10278146 3300003323 Bacteria 1305
31 Ga0055535_1002867 3300003761 Bacteria 5411
32 Ga0055536_1000006 3300003781 Bacteria 347733
33 Ga0055530_10000821 3300003791 Bacteria 25754
34 Ga0055541_1000148 3300003841 Bacteria 34526
35 Ga0058863_11413600 3300004799 Bacteria 2026
36 Ga0058861_10496864 3300004800 Bacteria 1141
37 Ga0058862_11751476 3300004803 Bacteria 1881
38 Ga0065714_10002951 3300005288 Bacteria 10050
39 Ga0065714_10004653 3300005288 Bacteria 14074
40 Ga0065714_10008230 3300005288 Bacteria 3909
41 Ga0065714_10064490 3300005288 Bacteria 50332
42 Ga0065714_10068662 3300005288 Bacteria 4595
43 Ga0065714_10100646 3300005288 Bacteria 1660
44 Ga0065714_10122187 3300005288 Bacteria 1326
45 Ga0065714_10201071 3300005288 Bacteria 889
46 Ga0065714_10270620 3300005288 Bacteria 740
47 Ga0065704_10001598 3300005289 Bacteria 9936
48 Ga0065704_10070884 3300005289 Bacteria 15045
49 Ga0065704_10206978 3300005289 Bacteria 1123
50 Ga0065704_10267696 3300005289 Bacteria 950
51 Ga0070658_10000008 3300005327 Bacteria 319912
52 Ga0070658_10004224 3300005327 Bacteria 11752
53 Ga0070658_10451575 3300005327 Bacteria 1107
54 Ga0070658_10590516 3300005327 Bacteria 962
55 Ga0070676_10004519 3300005328 Bacteria 7324
56 Ga0070683_100026462 3300005329 Bacteria 5224
57 Ga0070670_100062063 3300005331 Bacteria 3209
58 Ga0070670_100888810 3300005331 Unclassified 807
59 Ga0070680_101344676 3300005336 Bacteria 618
60 Ga0070680_101432069 3300005336 Bacteria 598
61 Ga0070682_100009063 3300005337 Bacteria 5625
62 Ga0070682_101397334 3300005337 Bacteria 598
63 Ga0068868_100072594 3300005338 Bacteria 2746
64 Ga0068868_100551056 3300005338 Unclassified 1016
65 Ga0070660_100005767 3300005339 Bacteria 8579
66 Ga0070660_100207525 3300005339 Bacteria 1590
67 Ga0070660_100282556 3300005339 Bacteria 1358
68 Ga0070660_101152348 3300005339 Bacteria 657
69 Ga0070661_100089270 3300005344 Unclassified 2282
70 Ga0070671_101094187 3300005355 Unclassified 700
71 Ga0070674_100053817 3300005356 Bacteria 2781
72 Ga0070673_100002154 3300005364 Bacteria 11936
73 Ga0070659_100000134 3300005366 Bacteria 56651
74 Ga0070659_100017362 3300005366 Bacteria 5414
75 Ga0070659_100162586 3300005366 Bacteria 1826
76 Ga0070659_100848600 3300005366 Bacteria 796
77 Ga0070667_100115641 3300005367 Bacteria 2330
78 Ga0070705_100953161 3300005440 Bacteria 693
79 Ga0070663_100159195 3300005455 Bacteria 1737
80 Ga0070678_100003269 3300005456 Bacteria 9009
81 Ga0070662_100000090 3300005457 Bacteria 49884
82 Ga0070681_10005773 3300005458 Bacteria 11968
83 Ga0068867_100003393 3300005459 Bacteria 11209
84 Ga0068867_102214217 3300005459 Unclassified 522
85 Ga0070679_100002981 3300005530 Bacteria 15450
86 Ga0070679_100005255 3300005530 Bacteria 11986
87 Ga0070679_100581620 3300005530 Bacteria 1063
88 Ga0070684_100101239 3300005535 Bacteria 2574
89 Ga0070684_100379153 3300005535 Bacteria 1302
90 Ga0070684_101049501 3300005535 Bacteria 765
91 Ga0068853_100015227 3300005539 Bacteria 6320
92 Ga0068853_100043996 3300005539 Bacteria 3821
93 Ga0068853_100047801 3300005539 Bacteria 3672
94 Ga0070665_100000118 3300005548 Bacteria 149830
95 Ga0068855_100000155 3300005563 Bacteria 86903
96 Ga0068855_100010314 3300005563 Bacteria 11268
97 Ga0068855_100011033 3300005563 Bacteria 10903
98 Ga0068855_100056851 3300005563 Bacteria 4587
99 Ga0068855_100423323 3300005563 Bacteria 1456
100 Ga0068857_100088391 3300005577 Bacteria 2772
101 Ga0068857_100716644 3300005577 Bacteria 951
102 Ga0068856_100060164 3300005614 Bacteria 3752
103 Ga0068856_100510419 3300005614 Bacteria 1223
104 Ga0068856_100976807 3300005614 Bacteria 865
105 Ga0068852_100009862 3300005616 Bacteria 7106
106 Ga0068852_100018311 3300005616 Bacteria 5518
107 Ga0068852_100257805 3300005616 Bacteria 1673
108 Ga0068852_100483357 3300005616 Bacteria 1231
109 Ga0068852_100733637 3300005616 Bacteria 999
110 Ga0068852_101103168 3300005616 Bacteria 814
111 Ga0068851_10343428 3300005834 Bacteria 867
112 Ga0068870_10432741 3300005840 Bacteria 863
113 Ga0068858_100243652 3300005842 Bacteria 1706
114 Ga0068860_100019108 3300005843 Bacteria 6654
115 Ga0068860_100655516 3300005843 Bacteria 1058
116 Ga0075366_10000242 3300006195 Bacteria 24270
117 Ga0097621_100000015 3300006237 Bacteria 92182
118 Ga0075370_10357985 3300006353 Bacteria 872
119 Ga0075370_10639686 3300006353 Bacteria 645
120 Ga0068871_100000051 3300006358 Bacteria 64844
121 Ga0075433_10133807 3300006852 Bacteria 2203
122 Ga0075434_100300906 3300006871 Bacteria 1624
123 Ga0075434_100488156 3300006871 Unclassified 1253
124 Ga0068865_100001125 3300006881 Bacteria 15478
125 Ga0068865_101771045 3300006881 Bacteria 558
126 Ga0075435_100006722 3300007076 Bacteria 8157
127 Ga0105251_10072086 3300009011 Bacteria 1607
128 Ga0105244_10022593 3300009036 Bacteria 3461
129 Ga0105244_10048390 3300009036 Bacteria 2176
130 Ga0105244_10056174 3300009036 Bacteria 1993
131 Ga0105240_10000082 3300009093 Bacteria 195184
132 Ga0105240_10044171 3300009093 Bacteria 5665
133 Ga0105240_10044210 3300009093 Bacteria 5663
134 Ga0105240_10364459 3300009093 Bacteria 1636
135 Ga0105240_10374680 3300009093 Bacteria 1609
136 Ga0105240_10477862 3300009093 Bacteria 1390
137 Ga0105240_10568422 3300009093 Bacteria 1252
138 Ga0105240_11076910 3300009093 Bacteria 856
139 Ga0105240_11314749 3300009093 Bacteria 762
140 Ga0114129_10025078 3300009147 Bacteria 8450
141 Ga0114129_10093153 3300009147 Bacteria 4174
142 Ga0105243_10018802 3300009148 Bacteria 5235
143 Ga0105241_10009764 3300009174 Bacteria 7054
144 Ga0105241_10011972 3300009174 Bacteria 6370
145 Ga0105241_10019476 3300009174 Bacteria 5004
146 Ga0105241_10046289 3300009174 Unclassified 3303
147 Ga0105241_10169742 3300009174 Bacteria 1801
148 Ga0105241_10236746 3300009174 Bacteria 1541
149 Ga0105241_10880554 3300009174 Bacteria 830
150 Ga0105242_10496585 3300009176 Bacteria 1160
151 Ga0105237_10000310 3300009545 Bacteria 67887
152 Ga0105237_10001895 3300009545 Bacteria 26705
153 Ga0105237_10002169 3300009545 Bacteria 24637
154 Ga0105237_10002529 3300009545 Bacteria 22637
155 Ga0105237_10031412 3300009545 Bacteria 5386
156 Ga0105237_10103937 3300009545 Bacteria 2833
157 Ga0105237_10254106 3300009545 Bacteria 1760
158 Ga0105237_10443527 3300009545 Bacteria 1304
159 Ga0105238_10011265 3300009551 Bacteria 9000
160 Ga0105238_10087074 3300009551 Bacteria 3111
161 Ga0105238_11093450 3300009551 Bacteria 820
162 Ga0105249_10101934 3300009553 Bacteria 2701
163 Ga0105249_10668260 3300009553 Unclassified 1097
164 Ga0105239_10000049 3300010375 Bacteria 177578
165 Ga0105239_10000166 3300010375 Bacteria 94743
166 Ga0105239_10001978 3300010375 Bacteria 26646
167 Ga0105239_10003206 3300010375 Bacteria 20226
168 Ga0105239_10005378 3300010375 Bacteria 15038
169 Ga0105239_10011865 3300010375 Bacteria 9721
170 Ga0105239_10043036 3300010375 Bacteria 4948
171 Ga0105239_10106505 3300010375 Bacteria 3106
172 Ga0105239_10474330 3300010375 Bacteria 1421
173 Ga0105239_10712691 3300010375 Bacteria 1148
174 Ga0105246_10006870 3300011119 Bacteria 6964
175 Ga0105246_10049066 3300011119 Bacteria 2889
176 Ga0105246_11759175 3300011119 Bacteria 591
177 Ga0157373_10000086 3300013100 Bacteria 80524
178 Ga0157373_10000203 3300013100 Bacteria 49252
179 Ga0157373_10001332 3300013100 Bacteria 18906
180 Ga0157373_10001726 3300013100 Bacteria 16609
181 Ga0157373_10017488 3300013100 Bacteria 5222
182 Ga0157373_10031249 3300013100 Bacteria 3833
183 Ga0157373_10134140 3300013100 Unclassified 1741
184 Ga0157373_10263929 3300013100 Bacteria 1219
185 Ga0157371_10000027 3300013102 Bacteria 269243
186 Ga0157371_10000107 3300013102 Bacteria 126477
187 Ga0157371_10001277 3300013102 Bacteria 26563
188 Ga0157371_10001603 3300013102 Bacteria 23199
189 Ga0157371_10001877 3300013102 Bacteria 21017
190 Ga0157371_10007359 3300013102 Bacteria 8922
191 Ga0157371_10011077 3300013102 Bacteria 6985
192 Ga0157371_10065842 3300013102 Bacteria 2566
193 Ga0157371_10092508 3300013102 Bacteria 2143
194 Ga0157371_10229482 3300013102 Bacteria 1334
195 Ga0157370_10008966 3300013104 Bacteria 10741
196 Ga0157370_10026070 3300013104 Bacteria 5776
197 Ga0157370_10039044 3300013104 Bacteria 4589
198 Ga0157370_10042655 3300013104 Bacteria 4370
199 Ga0157370_10044015 3300013104 Bacteria 4295
200 Ga0157370_10062210 3300013104 Bacteria 3541
201 Ga0157370_10092280 3300013104 Bacteria 2842
202 Ga0157370_10101930 3300013104 Bacteria 2688
203 Ga0157370_10102986 3300013104 Bacteria 2672
204 Ga0157370_10202474 3300013104 Bacteria 1841
205 Ga0157370_10386809 3300013104 Bacteria 1288
206 Ga0157370_10448955 3300013104 Bacteria 1185
207 Ga0157370_10886518 3300013104 Bacteria 810
208 Ga0157370_11191034 3300013104 Bacteria 687
209 Ga0157369_10000053 3300013105 Bacteria 162962
210 Ga0157369_10040066 3300013105 Bacteria 5117
211 Ga0157369_10061574 3300013105 Bacteria 4045
212 Ga0157369_10063353 3300013105 Bacteria 3983
213 Ga0157369_10932849 3300013105 Bacteria 890
214 Ga0157374_10000301 3300013296 Bacteria 45768
215 Ga0157374_10009375 3300013296 Bacteria 8399
216 Ga0157374_10361817 3300013296 Bacteria 1443
217 Ga0157374_10716104 3300013296 Bacteria 1014
218 Ga0157374_11223450 3300013296 Bacteria 772
219 Ga0157374_12186261 3300013296 Unclassified 580
220 Ga0157378_10010959 3300013297 Bacteria 7931
221 Ga0157378_10016728 3300013297 Bacteria 6427
222 Ga0157378_10322712 3300013297 Unclassified 1501
223 Ga0157378_10986556 3300013297 Bacteria 876
224 Ga0163162_10000012 3300013306 Bacteria 292674
225 Ga0163162_10000078 3300013306 Bacteria 89842
226 Ga0163162_10002069 3300013306 Bacteria 18857
227 Ga0163162_10004278 3300013306 Bacteria 13738
228 Ga0163162_10353345 3300013306 Bacteria 1602
229 Ga0163162_10888363 3300013306 Bacteria 1005
230 Ga0157372_10000039 3300013307 Bacteria 165839
231 Ga0157372_10000238 3300013307 Bacteria 60988
232 Ga0157372_10001301 3300013307 Bacteria 27001
233 Ga0157372_10003139 3300013307 Bacteria 17808
234 Ga0157372_10008473 3300013307 Bacteria 10913
235 Ga0157372_10031160 3300013307 Bacteria 5838
236 Ga0157372_10927267 3300013307 Bacteria 1010
237 Ga0157372_11037272 3300013307 Bacteria 949
238 Ga0157375_10014117 3300013308 Bacteria 7124
239 Ga0157375_10038349 3300013308 Bacteria 4601
240 Ga0157375_11080480 3300013308 Bacteria 939
241 Ga0182008_10000020 3300014497 Bacteria 228333
242 Ga0182008_10000053 3300014497 Bacteria 102934
243 Ga0182008_10000334 3300014497 Bacteria 37000
244 Ga0157377_10017537 3300014745 Bacteria 3703
245 Ga0157376_12639411 3300014969 Bacteria 542
246 Ga0182006_1000755 3300015261 Bacteria 22108
247 Ga0182006_1000787 3300015261 Bacteria 21397
248 Ga0182006_1001428 3300015261 Bacteria 14459
249 Ga0182006_1001644 3300015261 Bacteria 13198
250 Ga0182006_1007443 3300015261 Bacteria 5008
251 Ga0182007_10000005 3300015262 Bacteria 442702
252 Ga0183373_1007 3300015682 Bacteria 282776
253 Ga0163161_10000869 3300017792 Bacteria 23538
254 Ga0163161_10001505 3300017792 Bacteria 17233
255 Ga0163161_10002083 3300017792 Bacteria 14500
256 Ga0163161_10002901 3300017792 Bacteria 12132
257 Ga0163161_10064718 3300017792 Bacteria 2668
258 Ga0163161_10276478 3300017792 Bacteria 1316
259 Ga0213872_10061935 3300021361 Bacteria 1691
260 Ga0213876_10034466 3300021384 Bacteria 2669
261 Ga0209784_100141 3300025224 Bacteria 67045
262 Ga0209566_100531 3300025225 Bacteria 25949
263 Ga0209566_102062 3300025225 Bacteria 4184
264 Ga0209566_109700 3300025225 Bacteria 994
265 Ga0207427_100122 3300025231 Bacteria 99064
266 Ga0209437_100048 3300025233 Bacteria 405107
267 Ga0209437_100102 3300025233 Bacteria 224216
268 Ga0209437_100331 3300025233 Bacteria 58796
269 Ga0209258_101019 3300025242 Bacteria 12680
270 Ga0207425_1000003 3300025245 Bacteria 1145342
271 Ga0209026_1000562 3300025250 Bacteria 25249
272 Ga0209026_1002144 3300025250 Bacteria 7704
273 Ga0209129_1000022 3300025258 Bacteria 440876
274 Ga0209233_1000029 3300025261 Bacteria 641642
275 Ga0209233_1003157 3300025261 Bacteria 5846
276 Ga0209233_1013999 3300025261 Bacteria 2275
277 Ga0209455_1002140 3300025272 Bacteria 7846
278 Ga0209675_1006323 3300025291 Bacteria 4776
279 Ga0209676_1000039 3300025292 Bacteria 443158
280 Ga0209025_1000007 3300025294 Bacteria 1145109
281 Ga0209025_1003050 3300025294 Bacteria 16506
282 Ga0209025_1050011 3300025294 Bacteria 1676
283 Ga0209758_1000012 3300025297 Bacteria 949866
284 Ga0209050_1000033 3300025298 Bacteria 442615
285 Ga0207655_1003621 3300025728 Bacteria 11414
286 Ga0207655_1030133 3300025728 Bacteria 2528
287 Ga0207655_1134860 3300025728 Bacteria 800
288 Ga0207642_10034191 3300025899 Unclassified 2159
289 Ga0207647_10000018 3300025904 Bacteria 124816
290 Ga0207647_10000071 3300025904 Bacteria 79170
291 Ga0207647_10232139 3300025904 Bacteria 1061
292 Ga0207647_10273839 3300025904 Bacteria 964
293 Ga0207645_10000229 3300025907 Bacteria 46502
294 Ga0207705_10000026 3300025909 Bacteria 256051
295 Ga0207705_10018144 3300025909 Bacteria 5030
296 Ga0207654_10005694 3300025911 Bacteria 6296
297 Ga0207654_10019576 3300025911 Bacteria 3575
298 Ga0207654_10096542 3300025911 Bacteria 1813
299 Ga0207654_10188500 3300025911 Bacteria 1350
300 Ga0207654_10632176 3300025911 Bacteria 765
301 Ga0207654_10961876 3300025911 Bacteria 620
302 Ga0207707_10016487 3300025912 Bacteria 6442
303 Ga0207695_10000053 3300025913 Bacteria 396740
304 Ga0207695_10003037 3300025913 Bacteria 24051
305 Ga0207695_10040116 3300025913 Bacteria 5025
306 Ga0207695_10072039 3300025913 Bacteria 3528
307 Ga0207695_10126303 3300025913 Bacteria 2519
308 Ga0207695_10295525 3300025913 Bacteria 1511
309 Ga0207695_10312478 3300025913 Bacteria 1461
310 Ga0207695_10344605 3300025913 Bacteria 1377
311 Ga0207695_10407190 3300025913 Unclassified 1244
312 Ga0207695_10764754 3300025913 Bacteria 846
313 Ga0207671_10000366 3300025914 Bacteria 64454
314 Ga0207671_10001102 3300025914 Bacteria 32573
315 Ga0207671_10002584 3300025914 Bacteria 19130
316 Ga0207671_10003225 3300025914 Bacteria 16410
317 Ga0207671_10004999 3300025914 Bacteria 12412
318 Ga0207671_10007429 3300025914 Bacteria 9508
319 Ga0207671_10010518 3300025914 Bacteria 7626
320 Ga0207671_10172681 3300025914 Bacteria 1679
321 Ga0207660_10424607 3300025917 Bacteria 1073
322 Ga0207657_10022017 3300025919 Bacteria 5985
323 Ga0207657_10028007 3300025919 Bacteria 5149
324 Ga0207657_10056833 3300025919 Bacteria 3374
325 Ga0207649_10448412 3300025920 Bacteria 973
326 Ga0207652_10004543 3300025921 Bacteria 11267
327 Ga0207652_10010171 3300025921 Bacteria 7573
328 Ga0207652_10385960 3300025921 Bacteria 1264
329 Ga0207694_10096319 3300025924 Bacteria 2340
330 Ga0207694_10098223 3300025924 Bacteria 2318
331 Ga0207694_10826289 3300025924 Bacteria 783
332 Ga0207650_10097803 3300025925 Bacteria 2254
333 Ga0207644_10266439 3300025931 Unclassified 1371
334 Ga0207690_10000450 3300025932 Bacteria 26664
335 Ga0207690_10050477 3300025932 Bacteria 2778
336 Ga0207690_10504164 3300025932 Unclassified 979
337 Ga0207706_10000718 3300025933 Bacteria 34581
338 Ga0207686_10834794 3300025934 Bacteria 740
339 Ga0207709_10127254 3300025935 Bacteria 1730
340 Ga0207669_10057130 3300025937 Bacteria 2374
341 Ga0207704_10000047 3300025938 Bacteria 84386
342 Ga0207661_10163367 3300025944 Bacteria 1933
343 Ga0207667_10000015 3300025949 Bacteria 417534
344 Ga0207667_10006798 3300025949 Bacteria 13813
345 Ga0207667_10021180 3300025949 Bacteria 7209
346 Ga0207667_10082439 3300025949 Bacteria 3332
347 Ga0207667_10316223 3300025949 Bacteria 1595
348 Ga0207667_10471717 3300025949 Bacteria 1274
349 Ga0207667_10882778 3300025949 Bacteria 887
350 Ga0207651_10018479 3300025960 Bacteria 4150
351 Ga0207712_10129208 3300025961 Bacteria 1922
352 Ga0207640_10598273 3300025981 Unclassified 933
353 Ga0207640_10874205 3300025981 Bacteria 784
354 Ga0207658_10125387 3300025986 Bacteria 2054
355 Ga0207677_10025568 3300026023 Bacteria 3686
356 Ga0207703_10070693 3300026035 Bacteria 2881
357 Ga0207639_10005333 3300026041 Bacteria 8684
358 Ga0207639_10021979 3300026041 Bacteria 4590
359 Ga0207639_10107068 3300026041 Bacteria 2270
360 Ga0207678_10075848 3300026067 Bacteria 2880
361 Ga0207678_10134907 3300026067 Unclassified 2106
362 Ga0207702_10000163 3300026078 Bacteria 79263
363 Ga0207648_10002322 3300026089 Bacteria 20530
364 Ga0207648_10083248 3300026089 Bacteria 2791
365 Ga0207648_10550199 3300026089 Bacteria 1060
366 Ga0207674_10212810 3300026116 Bacteria 1882
367 Ga0207674_10715847 3300026116 Bacteria 966
368 Ga0207674_11424672 3300026116 Bacteria 662
369 Ga0207683_10003865 3300026121 Bacteria 13002
370 Ga0207698_10003303 3300026142 Bacteria 9694
371 Ga0207698_10010894 3300026142 Bacteria 5871
372 Ga0207698_10538227 3300026142 Bacteria 1143
373 Ga0207698_10546150 3300026142 Bacteria 1135
374 Ga0207698_11139126 3300026142 Bacteria 793
375 Ga0268266_10000121 3300028379 Bacteria 154995
376 Ga0268264_10032362 3300028381 Bacteria 4290
377 Ga0307517_10000198 3300028786 Bacteria 102181
378 Ga0307515_10002441 3300028794 Bacteria 40493
379 Ga0307515_10004266 3300028794 Bacteria 29673
380 Ga0307515_10021815 3300028794 Bacteria 11328
381 Ga0307515_10210901 3300028794 Bacteria 1787
382 Ga0307515_10457422 3300028794 Bacteria 891
383 Ga0316176_1040295 3300030732 Bacteria 2628
384 Ga0314311_1087628 3300030733 Bacteria 1246
385 Ga0316183_1025240 3300030742 Bacteria 70534
386 Ga0316181_1150685 3300030744 Unclassified 1717
387 Ga0316181_1175649 3300030744 Bacteria 3529
388 Ga0265330_10249047 3300031235 Unclassified 749
389 Ga0265327_10000819 3300031251 Bacteria 46924
390 Ga0265327_10067357 3300031251 Bacteria 1804
391 Ga0307509_10217285 3300031507 Bacteria 1729
392 Ga0307408_101652055 3300031548 Bacteria 609
393 Ga0265313_10189902 3300031595 Bacteria 859
394 Ga0316579_10125634 3300031691 Bacteria 1234
395 Ga0307405_10000009 3300031731 Bacteria 259388
396 Ga0307405_10181855 3300031731 Bacteria 1510
397 Ga0307407_10000001 3300031903 Bacteria 570048
398 Ga0307412_10000001 3300031911 Bacteria 822691
399 Ga0307412_10008869 3300031911 Bacteria 5760
400 Ga0307412_10105804 3300031911 Bacteria 1999
401 Ga0307412_10414190 3300031911 Bacteria 1101
402 Ga0307412_11027281 3300031911 Bacteria 730
403 Ga0307409_100028160 3300031995 Bacteria 3997
404 Ga0307416_100000008 3300032002 Bacteria 401343
405 Ga0307414_10000241 3300032004 Bacteria 34897
406 Ga0307414_10002316 3300032004 Bacteria 9953
407 Ga0307414_10003259 3300032004 Bacteria 8650
408 Ga0307414_10007839 3300032004 Bacteria 6022
409 Ga0307414_10223510 3300032004 Bacteria 1547
410 Ga0307414_10326356 3300032004 Bacteria 1308
411 Ga0307414_10376021 3300032004 Bacteria 1227
412 Ga0307414_11508457 3300032004 Bacteria 626
413 Ga0307507_10000099 3300033179 Bacteria 139532
414 Ga0307510_10000417 3300033180 Bacteria 40763
415 Ga0395899_0000024 3300037312 Bacteria 357402
416 Ga0395899_0000027 3300037312 Bacteria 337387
417 Ga0395899_0011907 3300037312 Bacteria 6661
418 Ga0395899_0613211 3300037312 Bacteria 692
419 Ga0395900_0000195 3300037418 Bacteria 97204
420 Ga0395900_0000275 3300037418 Bacteria 78207
421 Ga0395900_0657855 3300037418 Unclassified 984
422 Ga0395898_0007299 3300037466 Bacteria 11734
423 Ga0395905_0004639 3300037471 Bacteria 14216
424 Ga0395905_0069172 3300037471 Bacteria 3307
425 Ga0395901_0000595 3300038443 Bacteria 42132
426 Ga0400490_47141 3300038726 Bacteria 3517
427 Ga0436365_1693925 3300039437 Bacteria 13839
428 Ga0436361_0809011 3300039447 Bacteria 5891
429 Ga0439436_0013119 3300041404 Bacteria 2509
430 Ga0439439_0059786 3300041406 Bacteria 1010
431 Ga0451791_1517152 3300041451 Bacteria 766
432 Ga0451795_1321851 3300041456 Bacteria 595
433 Ga0451802_0760726 3300041460 Bacteria 853
434 Ga0451802_2036595 3300041460 Bacteria 620
435 Ga0451843_1229166 3300041509 Bacteria 624
436 Ga0439448_0002987 3300042005 Bacteria 4643
437 Ga0439449_0000208 3300042007 Bacteria 20706
438 Ga0439457_009259 3300042014 Bacteria 2297
439 Ga0439462_0000024 3300042015 Bacteria 23158
440 Ga0466969_0241979 3300044656 Bacteria 819
441 Ga0466966_0003859 3300044684 Bacteria 9892
442 Ga0466961_0003771 3300044693 Bacteria 9476
443 Ga0453684_0078759 3300044712 Bacteria 4123
444 Ga0466959_0412267 3300045049 Bacteria 917
445 Ga0466959_0730255 3300045049 Bacteria 663
446 Ga0495627_032170 3300046453 Bacteria 1652
447 Ga0495592_0251121 3300046454 Bacteria 1169
448 Ga0495590_0078195 3300046457 Bacteria 1164
449 Ga0495591_036690 3300046458 Bacteria 1425
450 Ga0495651_0075940 3300046462 Bacteria 2546
451 Ga0495650_0000231 3300046471 Bacteria 113969
452 Ga0495650_0098176 3300046471 Bacteria 1103
453 Ga0495605_0155182 3300046474 Bacteria 1019
454 Ga0495585_0000037 3300046492 Bacteria 133335
455 Ga0495585_0001999 3300046492 Bacteria 15127
456 Ga0495596_0025488 3300046500 Bacteria 2390
457 Ga0495583_0009799 3300046506 Bacteria 5682
458 Ga0495606_0000060 3300046507 Bacteria 185907
459 Ga0495606_0008313 3300046507 Bacteria 9047
460 Ga0495606_0024862 3300046507 Bacteria 4304
461 Ga0495606_0059371 3300046507 Bacteria 2454
462 Ga0495606_0111563 3300046507 Bacteria 1649
463 Ga0495610_0000108 3300046512 Bacteria 96839
464 Ga0495610_0000129 3300046512 Bacteria 83051
465 Ga0495610_0002235 3300046512 Bacteria 16384
466 Ga0495616_0003119 3300046513 Bacteria 10712
467 Ga0495631_0029365 3300046518 Bacteria 2501
468 Ga0495632_0472035 3300046519 Bacteria 543
469 Ga0495637_0081935 3300046520 Bacteria 1285
470 Ga0495637_0093421 3300046520 Bacteria 1184
471 Ga0495648_0004667 3300046524 Bacteria 11621
472 Ga0495648_0147504 3300046524 Bacteria 1230
473 Ga0495652_0294149 3300046529 Bacteria 1183
474 Ga0495609_0041901 3300046538 Bacteria 2057
475 Ga0495609_0046561 3300046538 Bacteria 1942
476 Ga0495597_0124038 3300046542 Bacteria 1075
477 Ga0495633_0000015 3300046558 Bacteria 254484
478 Ga0495633_0013382 3300046558 Bacteria 4327
479 Ga0495633_0024972 3300046558 Bacteria 2948
480 Ga0495668_0000041 3300046616 Bacteria 229462
481 Ga0495668_0576925 3300046616 Bacteria 621
482 Ga0495625_0000191 3300046660 Bacteria 97363
483 Ga0495625_0000634 3300046660 Bacteria 50477
484 Ga0495625_0006948 3300046660 Bacteria 9985
485 Ga0495625_0030925 3300046660 Bacteria 3988
486 Ga0495625_0068145 3300046660 Bacteria 2502
487 Ga0495625_0073838 3300046660 Bacteria 2390
488 Ga0495625_0093901 3300046660 Bacteria 2070
489 Ga0495625_0478616 3300046660 Bacteria 765
490 Ga0495661_0018652 3300046665 Bacteria 4556
491 Ga0495661_0031520 3300046665 Bacteria 3362
492 Ga0495661_0041258 3300046665 Bacteria 2856
493 Ga0495661_0183094 3300046665 Bacteria 1109
494 Ga0495658_0132967 3300046683 Bacteria 1516
495 Ga0495671_0302663 3300046692 Bacteria 769
496 Ga0495671_0327587 3300046692 Bacteria 735
497 Ga0495649_0000061 3300046694 Bacteria 97338
498 Ga0495649_0121704 3300046694 Bacteria 1380
499 Ga0495649_0440785 3300046694 Bacteria 651
500 Ga0495589_0213985 3300046794 Bacteria 907
501 Ga0495660_0008593 3300046810 Bacteria 5977
502 Ga0495660_0028371 3300046810 Bacteria 3163
503 Ga0495660_0301971 3300046810 Bacteria 725
504 Ga0495687_000570 3300047443 Bacteria 43484
505 Ga0495687_002643 3300047443 Bacteria 14001
506 Ga0495681_0119035 3300047470 Bacteria 1135
507 Ga0495686_0000697 3300047472 Bacteria 45366
508 Ga0495686_0006114 3300047472 Bacteria 9327
509 Ga0495686_0029704 3300047472 Bacteria 3555
510 Ga0495686_0030715 3300047472 Bacteria 3488
511 Ga0495686_0515808 3300047472 Bacteria 628
512 Ga0495614_0029800 3300048089 Bacteria 2348
513 Ga0495626_0057647 3300048091 Bacteria 1777
514 Ga0496113_0941051 3300048916 Bacteria 682
515 Ga0496115_0055026 3300048918 Bacteria 3196
516 Ga0496115_1167335 3300048918 Bacteria 580
517 Ga0496116_0002747 3300048919 Bacteria 18082
518 Ga0496116_0016812 3300048919 Bacteria 5708
519 Ga0496116_0040049 3300048919 Bacteria 3231
520 Ga0496116_0063745 3300048919 Bacteria 2373
521 Ga0496118_0287513 3300048921 Unclassified 911
522 Ga0496118_0346848 3300048921 Bacteria 793
523 Ga0496121_0454894 3300048924 Bacteria 824
524 Ga0496122_0000876 3300048925 Bacteria 56653
525 Ga0496122_0094610 3300048925 Bacteria 2022
526 Ga0496122_0280032 3300048925 Bacteria 912
527 Ga0496123_0000777 3300048926 Bacteria 51679
528 Ga0496123_0129947 3300048926 Bacteria 1398
529 Ga0496124_0197835 3300048927 Bacteria 1531
530 Ga0496125_0042886 3300048928 Unclassified 3847
531 Ga0496125_0096393 3300048928 Bacteria 2196
532 Ga0496125_0124625 3300048928 Bacteria 1829
533 Ga0496126_1078223 3300048929 Bacteria 598
534 Ga0495678_005052 3300049459 Bacteria 7417
535 Ga0501223_001718 3300049663 Bacteria 4999
536 Ga0501225_0237447 3300049705 Unclassified 594
537 Ga0501241_008057 3300049758 Bacteria 1929
538 Ga0501035_0132531 3300049822 Bacteria 2172
539 nmdc:mga0k408_31_c1 3300050493 Bacteria 85612
540 nmdc:mga0k408_4284_c1 3300050493 Bacteria 7577
541 nmdc:mga07m45_322523_c1 3300050496 Bacteria 898
542 nmdc:mga07m45_584760_c1 3300050496 Bacteria 645
543 nmdc:mga05p37_864632_c1 3300050507 Unclassified 980
544 nmdc:mga0n895_371713_c1 3300050512 Unclassified 1447
545 nmdc:mga0n895_37837_c1 3300050512 Bacteria 4670
546 nmdc:mga0rr50_15320_c1 3300050513 Bacteria 5058
547 Ga0500635_0000590 3300053080 Bacteria 9620
548 Ga0500635_0096351 3300053080 Bacteria 1083
549 Ga0500647_0211478 3300053091 Bacteria 874
550 Ga0500651_0000058 3300053093 Bacteria 72493
551 Ga0500608_012925 3300053122 Bacteria 3682
552 Ga0500608_285189 3300053122 Bacteria 622
553 Ga0500614_004323 3300053123 Bacteria 3011
554 Ga0500618_000016 3300053125 Bacteria 164049
555 Ga0500618_020994 3300053125 Bacteria 1597
556 Ga0500561_0051779 3300053137 Bacteria 1123
557 Ga0500564_104332 3300053138 Bacteria 1250
558 Ga0500573_0207924 3300053140 Bacteria 1034
559 Ga0500622_0001657 3300053156 Bacteria 17419
560 Ga0500622_0278440 3300053156 Bacteria 722
561 Ga0500624_000243 3300053157 Bacteria 19155
562 Ga0500634_0083198 3300053161 Bacteria 1644
563 Ga0500645_065217 3300053730 Bacteria 1049
564 Ga0466962_0072793 3300061719 Bacteria 1642

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013296 Ga0157374_12186261 Ga0157374_121862611 118
2 3300044712 Ga0453684_0078759 Ga0453684_0078759_3631_4113 140
3 3300005327 Ga0070658_10004224 Ga0070658_100042245 145
4 3300005616 Ga0068852_101103168 Ga0068852_1011031681 145
5 3300005834 Ga0068851_10343428 Ga0068851_103434281 145
6 3300013104 Ga0157370_10202474 Ga0157370_102024741 145
7 3300026142 Ga0207698_10546150 Ga0207698_105461502 145
8 3300005336 Ga0070680_101432069 Ga0070680_1014320691 146
9 3300005337 Ga0070682_100009063 Ga0070682_1000090634 146
10 3300005337 Ga0070682_101397334 Ga0070682_1013973341 146
11 3300005339 Ga0070660_100282556 Ga0070660_1002825561 146
12 3300005344 Ga0070661_100089270 Ga0070661_1000892702 146
13 3300005366 Ga0070659_100848600 Ga0070659_1008486001 146
14 3300005530 Ga0070679_100005255 Ga0070679_1000052558 146
15 3300005535 Ga0070684_101049501 Ga0070684_1010495011 146
16 3300005616 Ga0068852_100009862 Ga0068852_1000098623 146
17 3300005616 Ga0068852_100483357 Ga0068852_1004833572 146
18 3300005843 Ga0068860_100019108 Ga0068860_1000191086 146
19 3300005843 Ga0068860_100655516 Ga0068860_1006555162 146
20 3300009174 Ga0105241_10046289 Ga0105241_100462892 146
21 3300013100 Ga0157373_10134140 Ga0157373_101341403 146
22 3300013102 Ga0157371_10011077 Ga0157371_100110776 146
23 3300013104 Ga0157370_10386809 Ga0157370_103868092 146
24 3300013105 Ga0157369_10932849 Ga0157369_109328492 146
25 3300013307 Ga0157372_10031160 Ga0157372_100311604 146
26 3300013307 Ga0157372_11037272 Ga0157372_110372722 146
27 3300021384 Ga0213876_10034466 Ga0213876_100344664 146
28 3300025917 Ga0207660_10424607 Ga0207660_104246072 146
29 3300025919 Ga0207657_10028007 Ga0207657_100280073 146
30 3300025920 Ga0207649_10448412 Ga0207649_104484122 146
31 3300025921 Ga0207652_10010171 Ga0207652_100101714 146
32 3300025932 Ga0207690_10504164 Ga0207690_105041642 146
33 3300025981 Ga0207640_10598273 Ga0207640_105982731 146
34 3300025981 Ga0207640_10874205 Ga0207640_108742052 146
35 3300026142 Ga0207698_10010894 Ga0207698_100108944 146
36 3300028381 Ga0268264_10032362 Ga0268264_100323622 146
37 3300037471 Ga0395905_0069172 Ga0395905_0069172_1878_2357 146
38 3300039437 Ga0436365_1693925 Ga0436365_1693925_2480_2959 146
39 3300048925 Ga0496122_0094610 Ga0496122_0094610_431_928 146
40 iso_pu_bacteria 2512564039 2512736554 153
41 iso_pu_bacteria 2524023129 2524189970 153
42 iso_pu_bacteria 2548877040 2550903188 153
43 iso_pu_bacteria 2571042143 2571530838 153
44 iso_pu_bacteria 2571042588 2573039785 153
45 iso_pu_bacteria 2576861424 2578338914 153
46 iso_pu_bacteria 2579778775 2580932105 153
47 iso_pu_bacteria 2585428059 2587744101 153
48 iso_pu_bacteria 2600255286 2601641723 153
49 iso_pu_bacteria 2619619294 2621273325 153
50 iso_pu_bacteria 2643221543 2643738814 153
51 iso_pu_bacteria 2643221676 2644424521 153
52 iso_pu_bacteria 2671180694 2673821694 153
53 iso_pu_bacteria 2728368933 2728529861 153
54 iso_pu_bacteria 2818991459 2819676072 153
55 iso_pu_bacteria 2821111986 2821118293 153
56 iso_pu_bacteria 2857453340 2857460075 153
57 iso_pu_bacteria 2864733723 2864738899 153
58 iso_pu_bacteria 2864997549 2865001994 153
59 iso_pu_bacteria 2885526491 2885529943 153
60 iso_pu_bacteria 2889042446 2889048037 153
61 iso_pu_bacteria 2904162308 2904168126 153
62 iso_pu_bacteria 2904490793 2904496977 153
63 iso_pu_bacteria 2904755435 2904755701 153
64 iso_pu_bacteria 2907202186 2907208229 153
65 iso_pu_bacteria 2919160200 2919166220 153
66 iso_pu_bacteria 2919425241 2919432384 153
67 iso_pu_bacteria 2925326138 2925332810 153
68 iso_pu_bacteria 2929206907 2929211910 153
69 iso_pu_bacteria 2931384279 2931385143 153
70 iso_pu_bacteria 2938649242 2938653419 153
71 iso_pu_bacteria 2939679117 2939685095 153
72 iso_pu_bacteria 2945991243 2945996233 153
73 iso_pu_bacteria 2946053406 2946058923 153
74 iso_pu_bacteria 2968558590 2968562396 153
75 iso_pu_bacteria 2971403814 2971406724 153
76 iso_pu_bacteria 2971410472 2971410900 153
77 iso_pu_bacteria 2980182181 2980186788 153
78 iso_pu_bacteria 2988225383 2988229903 153
79 iso_pu_bacteria 2996632988 2996636910 153
80 iso_pu_bacteria 8054465665 8054471342 153
81 iso_pu_bacteria 8054795415 8054802023 153
82 iso_pu_bacteria 8055632911 8055634047 153
83 iso_pu_bacteria 8056533031 8056535637 153
84 iso_pu_bacteria 2585427687 2586206966 154
85 iso_pu_bacteria 2738541283 2738756054 154
86 iso_pu_bacteria 2738541284 2738763321 154
87 iso_pu_bacteria 2738541302 2738854609 154
88 iso_pu_bacteria 2738543023 2739304146 154
89 iso_pu_bacteria 2739367651 2739587120 154
90 iso_pu_bacteria 2739367656 2739615219 154
91 iso_pu_bacteria 2739367663 2739645655 154
92 iso_pu_bacteria 2775506987 2776616073 154
93 iso_pu_bacteria 2818991437 2819547585 154
94 iso_pu_bacteria 2842722452 2842726599 154
95 iso_pu_bacteria 2842903701 2842904753 154
96 iso_pu_bacteria 2842909656 2842911443 154
97 iso_pu_bacteria 2849281842 2849284211 154
98 iso_pu_bacteria 2852627209 2852630682 154
99 iso_pu_bacteria 2857627736 2857627815 154
100 iso_pu_bacteria 2887375801 2887380066 154
101 iso_pu_bacteria 2889295896 2889298973 154
102 iso_pu_bacteria 2890737413 2890740680 154
103 iso_pu_bacteria 2895498888 2895500270 154
104 iso_pu_bacteria 2902048731 2902050030 154
105 iso_pu_bacteria 2904445276 2904449022 154
106 iso_pu_bacteria 2945997725 2946003099 154
107 iso_pu_bacteria 2954016120 2954019958 154
108 iso_pu_bacteria 2981284811 2981289492 154
109 iso_pu_bacteria 2981289755 2981294488 154
110 iso_pu_bacteria 2981980479 2981985144 154
111 iso_pu_bacteria 2981985349 2981990075 154
112 3300006852 Ga0075433_10133807 Ga0075433_101338073 155
113 3300006871 Ga0075434_100300906 Ga0075434_1003009062 155
114 3300006871 Ga0075434_100488156 Ga0075434_1004881562 155
115 3300007076 Ga0075435_100006722 Ga0075435_1000067225 155
116 3300009147 Ga0114129_10093153 Ga0114129_100931534 155
117 3300050507 nmdc:mga05p37_864632_c1 nmdc:mga05p37_864632_c1_119_589 155
118 3300050512 nmdc:mga0n895_371713_c1 nmdc:mga0n895_371713_c1_501_971 155
119 3300050512 nmdc:mga0n895_37837_c1 nmdc:mga0n895_37837_c1_3462_3932 155
120 3300050513 nmdc:mga0rr50_15320_c1 nmdc:mga0rr50_15320_c1_528_998 155
121 iso_pu_bacteria 2599185184 2599481402 155
122 iso_pu_bacteria 2852623160 2852625762 155
123 iso_pu_bacteria 2884933994 2884935713 155
124 iso_pu_bacteria 2919437846 2919443076 155
125 iso_pu_bacteria 2919692658 2919693810 155
126 iso_pu_bacteria 2928078545 2928083304 155
127 iso_pu_bacteria 2928147474 2928152766 155
128 iso_pu_bacteria 2932082852 2932088272 155
129 iso_pu_bacteria 2977232053 2977233994 155
130 3300005367 Ga0070667_100115641 Ga0070667_1001156412 156
131 3300005440 Ga0070705_100953161 Ga0070705_1009531611 156
132 3300005535 Ga0070684_100379153 Ga0070684_1003791532 156
133 3300025986 Ga0207658_10125387 Ga0207658_101253872 156
134 3300038726 Ga0400490_47141 Ga0400490_47141_2417_2902 156
135 3300048916 Ga0496113_0941051 Ga0496113_0941051_170_649 156
136 3300003187 JGI25151J46595_10014070 JGI25151J46595_100140704 157
137 3300003761 Ga0055535_1002867 Ga0055535_10028673 157
138 3300003841 Ga0055541_1000148 Ga0055541_100014822 157
139 3300005338 Ga0068868_100551056 Ga0068868_1005510562 157
140 3300005459 Ga0068867_102214217 Ga0068867_1022142171 157
141 3300006353 Ga0075370_10357985 Ga0075370_103579851 157
142 3300009011 Ga0105251_10072086 Ga0105251_100720862 157
143 3300009036 Ga0105244_10048390 Ga0105244_100483902 157
144 3300009036 Ga0105244_10056174 Ga0105244_100561743 157
145 3300009176 Ga0105242_10496585 Ga0105242_104965852 157
146 3300009553 Ga0105249_10668260 Ga0105249_106682602 157
147 3300011119 Ga0105246_10006870 Ga0105246_100068707 157
148 3300011119 Ga0105246_11759175 Ga0105246_117591751 157
149 3300013102 Ga0157371_10092508 Ga0157371_100925082 157
150 3300013297 Ga0157378_10986556 Ga0157378_109865561 157
151 3300013308 Ga0157375_10038349 Ga0157375_100383495 157
152 3300025224 Ga0209784_100141 Ga0209784_10014163 157
153 3300025225 Ga0209566_100531 Ga0209566_10053122 157
154 3300025225 Ga0209566_102062 Ga0209566_1020625 157
155 3300025225 Ga0209566_109700 Ga0209566_1097002 157
156 3300025233 Ga0209437_100331 Ga0209437_10033163 157
157 3300025242 Ga0209258_101019 Ga0209258_1010197 157
158 3300025291 Ga0209675_1006323 Ga0209675_10063232 157
159 3300025294 Ga0209025_1003050 Ga0209025_100305012 157
160 3300025294 Ga0209025_1050011 Ga0209025_10500112 157
161 3300025728 Ga0207655_1003621 Ga0207655_10036213 157
162 3300025728 Ga0207655_1134860 Ga0207655_11348602 157
163 3300025899 Ga0207642_10034191 Ga0207642_100341912 157
164 3300026089 Ga0207648_10083248 Ga0207648_100832483 157
165 3300031235 Ga0265330_10249047 Ga0265330_102490472 157
166 3300031911 Ga0307412_10414190 Ga0307412_104141902 157
167 3300041404 Ga0439436_0013119 Ga0439436_0013119_966_1448 157
168 3300041406 Ga0439439_0059786 Ga0439439_0059786_351_833 157
169 3300042007 Ga0439449_0000208 Ga0439449_0000208_9896_10378 157
170 3300042014 Ga0439457_009259 Ga0439457_009259_1609_2091 157
171 3300042015 Ga0439462_0000024 Ga0439462_0000024_18895_19377 157
172 3300046457 Ga0495590_0078195 Ga0495590_0078195_463_951 157
173 3300046458 Ga0495591_036690 Ga0495591_036690_544_1032 157
174 3300046520 Ga0495637_0081935 Ga0495637_0081935_298_786 157
175 3300046542 Ga0495597_0124038 Ga0495597_0124038_554_1042 157
176 3300046665 Ga0495661_0183094 Ga0495661_0183094_322_810 157
177 3300046694 Ga0495649_0440785 Ga0495649_0440785_52_540 157
178 3300046810 Ga0495660_0028371 Ga0495660_0028371_1172_1660 157
179 3300048091 Ga0495626_0057647 Ga0495626_0057647_49_537 157
180 3300048919 Ga0496116_0002747 Ga0496116_0002747_4780_5256 157
181 3300048919 Ga0496116_0016812 Ga0496116_0016812_1160_1636 157
182 3300048919 Ga0496116_0040049 Ga0496116_0040049_696_1178 157
183 3300048919 Ga0496116_0063745 Ga0496116_0063745_439_927 157
184 3300048921 Ga0496118_0346848 Ga0496118_0346848_261_749 157
185 3300048924 Ga0496121_0454894 Ga0496121_0454894_310_798 157
186 3300048925 Ga0496122_0280032 Ga0496122_0280032_10_486 157
187 3300048926 Ga0496123_0129947 Ga0496123_0129947_580_1056 157
188 3300048927 Ga0496124_0197835 Ga0496124_0197835_76_552 157
189 3300048928 Ga0496125_0096393 Ga0496125_0096393_1639_2115 157
190 3300048928 Ga0496125_0124625 Ga0496125_0124625_607_1083 157
191 3300050496 nmdc:mga07m45_322523_c1 nmdc:mga07m45_322523_c1_352_828 157
192 2162886007 SwRhRL2b_contig_2733172 SwRhRL2b_0878.00002550 158
193 2162886007 SwRhRL2b_contig_283825 SwRhRL2b_0157.00007180 158
194 2162886007 SwRhRL2b_contig_2893490 SwRhRL2b_0082.00005900 158
195 3300001904 JGI24736J21556_1009589 JGI24736J21556_10095892 158
196 3300001989 JGI24739J22299_10004683 JGI24739J22299_100046832 158
197 3300001989 JGI24739J22299_10098258 JGI24739J22299_100982582 158
198 3300001990 JGI24737J22298_10000797 JGI24737J22298_100007974 158
199 3300001990 JGI24737J22298_10001612 JGI24737J22298_100016124 158
200 3300001990 JGI24737J22298_10016443 JGI24737J22298_100164432 158
201 3300002067 JGI24735J21928_10000032 JGI24735J21928_1000003215 158
202 3300002737 JGI25162J39368_1000118 JGI25162J39368_100011820 158
203 3300002737 JGI25162J39368_1000562 JGI25162J39368_10005627 158
204 3300002772 JGI25164J39214_1001737 JGI25164J39214_10017374 158
205 3300002773 JGI25152J39213_1000064 JGI25152J39213_100006413 158
206 3300002774 JGI25150J39212_1000004 JGI25150J39212_1000004146 158
207 3300003187 JGI25151J46595_10000002 JGI25151J46595_10000002479 158
208 3300003214 JGI25165J46597_1001048 JGI25165J46597_100104811 158
209 3300003215 JGI25153J46596_10000037 JGI25153J46596_10000037149 158
210 3300003316 rootH1_10018888 rootH1_1001888819 158
211 3300003316 rootH1_10028516 rootH1_100285162 158
212 3300003320 rootH2_10012714 rootH2_1001271459 158
213 3300003320 rootH2_10046324 rootH2_100463246 158
214 3300003320 rootH2_10053205 rootH2_100532052 158
215 3300003322 rootL2_10112871 rootL2_101128715 158
216 3300003323 rootH1_10012646 rootH1_1001264639 158
217 3300003323 rootH1_10024376 rootH1_100243762 158
218 3300003323 rootH1_10164405 rootH1_101644053 158
219 3300003323 rootH1_10253128 rootH1_102531281 158
220 3300003323 rootH1_10278146 rootH1_102781462 158
221 3300003781 Ga0055536_1000006 Ga0055536_100000658 158
222 3300003791 Ga0055530_10000821 Ga0055530_100008218 158
223 3300004799 Ga0058863_11413600 Ga0058863_114136002 158
224 3300004800 Ga0058861_10496864 Ga0058861_104968641 158
225 3300004803 Ga0058862_11751476 Ga0058862_117514762 158
226 3300005288 Ga0065714_10002951 Ga0065714_100029512 158
227 3300005288 Ga0065714_10004653 Ga0065714_1000465313 158
228 3300005288 Ga0065714_10008230 Ga0065714_100082302 158
229 3300005288 Ga0065714_10064490 Ga0065714_1006449044 158
230 3300005288 Ga0065714_10068662 Ga0065714_100686624 158
231 3300005288 Ga0065714_10100646 Ga0065714_101006462 158
232 3300005288 Ga0065714_10122187 Ga0065714_101221872 158
233 3300005288 Ga0065714_10201071 Ga0065714_102010711 158
234 3300005288 Ga0065714_10270620 Ga0065714_102706201 158
235 3300005289 Ga0065704_10001598 Ga0065704_1000159813 158
236 3300005289 Ga0065704_10070884 Ga0065704_100708846 158
237 3300005289 Ga0065704_10206978 Ga0065704_102069781 158
238 3300005289 Ga0065704_10267696 Ga0065704_102676961 158
239 3300005327 Ga0070658_10000008 Ga0070658_10000008215 158
240 3300005327 Ga0070658_10451575 Ga0070658_104515752 158
241 3300005327 Ga0070658_10590516 Ga0070658_105905162 158
242 3300005328 Ga0070676_10004519 Ga0070676_100045191 158
243 3300005329 Ga0070683_100026462 Ga0070683_1000264624 158
244 3300005331 Ga0070670_100062063 Ga0070670_1000620632 158
245 3300005331 Ga0070670_100888810 Ga0070670_1008888101 158
246 3300005336 Ga0070680_101344676 Ga0070680_1013446761 158
247 3300005338 Ga0068868_100072594 Ga0068868_1000725942 158
248 3300005339 Ga0070660_100005767 Ga0070660_1000057678 158
249 3300005339 Ga0070660_100207525 Ga0070660_1002075252 158
250 3300005339 Ga0070660_101152348 Ga0070660_1011523481 158
251 3300005355 Ga0070671_101094187 Ga0070671_1010941871 158
252 3300005356 Ga0070674_100053817 Ga0070674_1000538172 158
253 3300005364 Ga0070673_100002154 Ga0070673_1000021542 158
254 3300005366 Ga0070659_100000134 Ga0070659_10000013436 158
255 3300005366 Ga0070659_100017362 Ga0070659_1000173624 158
256 3300005366 Ga0070659_100162586 Ga0070659_1001625862 158
257 3300005455 Ga0070663_100159195 Ga0070663_1001591952 158
258 3300005456 Ga0070678_100003269 Ga0070678_1000032695 158
259 3300005457 Ga0070662_100000090 Ga0070662_10000009021 158
260 3300005458 Ga0070681_10005773 Ga0070681_100057733 158
261 3300005459 Ga0068867_100003393 Ga0068867_1000033934 158
262 3300005530 Ga0070679_100002981 Ga0070679_10000298112 158
263 3300005530 Ga0070679_100581620 Ga0070679_1005816202 158
264 3300005535 Ga0070684_100101239 Ga0070684_1001012391 158
265 3300005539 Ga0068853_100015227 Ga0068853_1000152273 158
266 3300005539 Ga0068853_100043996 Ga0068853_1000439962 158
267 3300005539 Ga0068853_100047801 Ga0068853_1000478012 158
268 3300005548 Ga0070665_100000118 Ga0070665_100000118127 158
269 3300005563 Ga0068855_100000155 Ga0068855_10000015560 158
270 3300005563 Ga0068855_100010314 Ga0068855_1000103144 158
271 3300005563 Ga0068855_100011033 Ga0068855_1000110337 158
272 3300005563 Ga0068855_100056851 Ga0068855_1000568512 158
273 3300005563 Ga0068855_100423323 Ga0068855_1004233232 158
274 3300005577 Ga0068857_100088391 Ga0068857_1000883914 158
275 3300005577 Ga0068857_100716644 Ga0068857_1007166442 158
276 3300005614 Ga0068856_100060164 Ga0068856_1000601642 158
277 3300005614 Ga0068856_100510419 Ga0068856_1005104192 158
278 3300005614 Ga0068856_100976807 Ga0068856_1009768071 158
279 3300005616 Ga0068852_100018311 Ga0068852_1000183113 158
280 3300005616 Ga0068852_100257805 Ga0068852_1002578051 158
281 3300005616 Ga0068852_100733637 Ga0068852_1007336371 158
282 3300005840 Ga0068870_10432741 Ga0068870_104327412 158
283 3300005842 Ga0068858_100243652 Ga0068858_1002436522 158
284 3300006195 Ga0075366_10000242 Ga0075366_100002424 158
285 3300006237 Ga0097621_100000015 Ga0097621_10000001566 158
286 3300006353 Ga0075370_10639686 Ga0075370_106396861 158
287 3300006358 Ga0068871_100000051 Ga0068871_10000005149 158
288 3300006881 Ga0068865_100001125 Ga0068865_10000112510 158
289 3300006881 Ga0068865_101771045 Ga0068865_1017710451 158
290 3300009036 Ga0105244_10022593 Ga0105244_100225932 158
291 3300009093 Ga0105240_10000082 Ga0105240_1000008225 158
292 3300009093 Ga0105240_10044171 Ga0105240_100441712 158
293 3300009093 Ga0105240_10044210 Ga0105240_100442103 158
294 3300009093 Ga0105240_10364459 Ga0105240_103644592 158
295 3300009093 Ga0105240_10374680 Ga0105240_103746802 158
296 3300009093 Ga0105240_10477862 Ga0105240_104778621 158
297 3300009093 Ga0105240_10568422 Ga0105240_105684223 158
298 3300009093 Ga0105240_11076910 Ga0105240_110769101 158
299 3300009093 Ga0105240_11314749 Ga0105240_113147491 158
300 3300009147 Ga0114129_10025078 Ga0114129_100250785 158
301 3300009148 Ga0105243_10018802 Ga0105243_100188022 158
302 3300009174 Ga0105241_10009764 Ga0105241_100097642 158
303 3300009174 Ga0105241_10011972 Ga0105241_100119722 158
304 3300009174 Ga0105241_10019476 Ga0105241_100194764 158
305 3300009174 Ga0105241_10169742 Ga0105241_101697422 158
306 3300009174 Ga0105241_10236746 Ga0105241_102367461 158
307 3300009174 Ga0105241_10880554 Ga0105241_108805542 158
308 3300009545 Ga0105237_10000310 Ga0105237_1000031058 158
309 3300009545 Ga0105237_10001895 Ga0105237_100018957 158
310 3300009545 Ga0105237_10002169 Ga0105237_1000216919 158
311 3300009545 Ga0105237_10002529 Ga0105237_1000252915 158
312 3300009545 Ga0105237_10031412 Ga0105237_100314122 158
313 3300009545 Ga0105237_10103937 Ga0105237_101039372 158
314 3300009545 Ga0105237_10254106 Ga0105237_102541062 158
315 3300009545 Ga0105237_10443527 Ga0105237_104435272 158
316 3300009551 Ga0105238_10011265 Ga0105238_100112655 158
317 3300009551 Ga0105238_10087074 Ga0105238_100870743 158
318 3300009551 Ga0105238_11093450 Ga0105238_110934502 158
319 3300009553 Ga0105249_10101934 Ga0105249_101019343 158
320 3300010375 Ga0105239_10000049 Ga0105239_10000049133 158
321 3300010375 Ga0105239_10000166 Ga0105239_1000016655 158
322 3300010375 Ga0105239_10001978 Ga0105239_1000197810 158
323 3300010375 Ga0105239_10003206 Ga0105239_100032066 158
324 3300010375 Ga0105239_10005378 Ga0105239_100053782 158
325 3300010375 Ga0105239_10011865 Ga0105239_100118657 158
326 3300010375 Ga0105239_10043036 Ga0105239_100430362 158
327 3300010375 Ga0105239_10106505 Ga0105239_101065052 158
328 3300010375 Ga0105239_10474330 Ga0105239_104743301 158
329 3300010375 Ga0105239_10712691 Ga0105239_107126912 158
330 3300011119 Ga0105246_10049066 Ga0105246_100490662 158
331 3300013100 Ga0157373_10000086 Ga0157373_1000008613 158
332 3300013100 Ga0157373_10000203 Ga0157373_1000020341 158
333 3300013100 Ga0157373_10001332 Ga0157373_100013328 158
334 3300013100 Ga0157373_10001726 Ga0157373_100017269 158
335 3300013100 Ga0157373_10017488 Ga0157373_100174882 158
336 3300013100 Ga0157373_10031249 Ga0157373_100312492 158
337 3300013100 Ga0157373_10263929 Ga0157373_102639291 158
338 3300013102 Ga0157371_10000027 Ga0157371_1000002727 158
339 3300013102 Ga0157371_10000107 Ga0157371_1000010716 158
340 3300013102 Ga0157371_10001277 Ga0157371_1000127718 158
341 3300013102 Ga0157371_10001603 Ga0157371_1000160313 158
342 3300013102 Ga0157371_10001877 Ga0157371_100018776 158
343 3300013102 Ga0157371_10007359 Ga0157371_100073593 158
344 3300013102 Ga0157371_10065842 Ga0157371_100658422 158
345 3300013102 Ga0157371_10229482 Ga0157371_102294822 158
346 3300013104 Ga0157370_10008966 Ga0157370_100089667 158
347 3300013104 Ga0157370_10026070 Ga0157370_100260703 158
348 3300013104 Ga0157370_10039044 Ga0157370_100390442 158
349 3300013104 Ga0157370_10042655 Ga0157370_100426552 158
350 3300013104 Ga0157370_10044015 Ga0157370_100440152 158
351 3300013104 Ga0157370_10062210 Ga0157370_100622104 158
352 3300013104 Ga0157370_10092280 Ga0157370_100922802 158
353 3300013104 Ga0157370_10101930 Ga0157370_101019302 158
354 3300013104 Ga0157370_10102986 Ga0157370_101029862 158
355 3300013104 Ga0157370_10448955 Ga0157370_104489552 158
356 3300013104 Ga0157370_10886518 Ga0157370_108865182 158
357 3300013104 Ga0157370_11191034 Ga0157370_111910342 158
358 3300013105 Ga0157369_10000053 Ga0157369_10000053132 158
359 3300013105 Ga0157369_10040066 Ga0157369_100400662 158
360 3300013105 Ga0157369_10061574 Ga0157369_100615743 158
361 3300013105 Ga0157369_10063353 Ga0157369_100633532 158
362 3300013296 Ga0157374_10000301 Ga0157374_100003017 158
363 3300013296 Ga0157374_10009375 Ga0157374_100093753 158
364 3300013296 Ga0157374_10361817 Ga0157374_103618172 158
365 3300013296 Ga0157374_10716104 Ga0157374_107161041 158
366 3300013296 Ga0157374_11223450 Ga0157374_112234502 158
367 3300013297 Ga0157378_10010959 Ga0157378_100109592 158
368 3300013297 Ga0157378_10016728 Ga0157378_100167283 158
369 3300013297 Ga0157378_10322712 Ga0157378_103227121 158
370 3300013306 Ga0163162_10000012 Ga0163162_10000012138 158
371 3300013306 Ga0163162_10000078 Ga0163162_1000007826 158
372 3300013306 Ga0163162_10002069 Ga0163162_1000206914 158
373 3300013306 Ga0163162_10004278 Ga0163162_100042782 158
374 3300013306 Ga0163162_10353345 Ga0163162_103533452 158
375 3300013306 Ga0163162_10888363 Ga0163162_108883632 158
376 3300013307 Ga0157372_10000039 Ga0157372_1000003950 158
377 3300013307 Ga0157372_10000238 Ga0157372_100002384 158
378 3300013307 Ga0157372_10001301 Ga0157372_100013013 158
379 3300013307 Ga0157372_10003139 Ga0157372_1000313914 158
380 3300013307 Ga0157372_10008473 Ga0157372_100084734 158
381 3300013307 Ga0157372_10927267 Ga0157372_109272672 158
382 3300013308 Ga0157375_10014117 Ga0157375_100141174 158
383 3300013308 Ga0157375_11080480 Ga0157375_110804802 158
384 3300014497 Ga0182008_10000020 Ga0182008_10000020121 158
385 3300014497 Ga0182008_10000053 Ga0182008_1000005363 158
386 3300014497 Ga0182008_10000334 Ga0182008_1000033415 158
387 3300014745 Ga0157377_10017537 Ga0157377_100175373 158
388 3300014969 Ga0157376_12639411 Ga0157376_126394111 158
389 3300015261 Ga0182006_1000755 Ga0182006_10007555 158
390 3300015261 Ga0182006_1000787 Ga0182006_10007874 158
391 3300015261 Ga0182006_1001428 Ga0182006_10014288 158
392 3300015261 Ga0182006_1001644 Ga0182006_10016442 158
393 3300015261 Ga0182006_1007443 Ga0182006_10074437 158
394 3300015262 Ga0182007_10000005 Ga0182007_10000005283 158
395 3300015682 Ga0183373_1007 Ga0183373_1007195 158
396 3300017792 Ga0163161_10000869 Ga0163161_100008697 158
397 3300017792 Ga0163161_10001505 Ga0163161_100015057 158
398 3300017792 Ga0163161_10002083 Ga0163161_100020837 158
399 3300017792 Ga0163161_10002901 Ga0163161_100029013 158
400 3300017792 Ga0163161_10064718 Ga0163161_100647182 158
401 3300017792 Ga0163161_10276478 Ga0163161_102764782 158
402 3300021361 Ga0213872_10061935 Ga0213872_100619352 158
403 3300025231 Ga0207427_100122 Ga0207427_10012220 158
404 3300025233 Ga0209437_100048 Ga0209437_100048276 158
405 3300025233 Ga0209437_100102 Ga0209437_100102130 158
406 3300025245 Ga0207425_1000003 Ga0207425_1000003368 158
407 3300025250 Ga0209026_1000562 Ga0209026_10005625 158
408 3300025250 Ga0209026_1002144 Ga0209026_10021447 158
409 3300025258 Ga0209129_1000022 Ga0209129_1000022368 158
410 3300025261 Ga0209233_1000029 Ga0209233_1000029100 158
411 3300025261 Ga0209233_1003157 Ga0209233_10031575 158
412 3300025261 Ga0209233_1013999 Ga0209233_10139992 158
413 3300025272 Ga0209455_1002140 Ga0209455_10021404 158
414 3300025292 Ga0209676_1000039 Ga0209676_1000039153 158
415 3300025294 Ga0209025_1000007 Ga0209025_1000007367 158
416 3300025297 Ga0209758_1000012 Ga0209758_1000012368 158
417 3300025298 Ga0209050_1000033 Ga0209050_1000033296 158
418 3300025728 Ga0207655_1030133 Ga0207655_10301333 158
419 3300025904 Ga0207647_10000018 Ga0207647_1000001877 158
420 3300025904 Ga0207647_10000071 Ga0207647_1000007166 158
421 3300025904 Ga0207647_10232139 Ga0207647_102321392 158
422 3300025904 Ga0207647_10273839 Ga0207647_102738392 158
423 3300025907 Ga0207645_10000229 Ga0207645_1000022949 158
424 3300025909 Ga0207705_10000026 Ga0207705_10000026216 158
425 3300025909 Ga0207705_10018144 Ga0207705_100181442 158
426 3300025911 Ga0207654_10005694 Ga0207654_100056943 158
427 3300025911 Ga0207654_10019576 Ga0207654_100195762 158
428 3300025911 Ga0207654_10096542 Ga0207654_100965422 158
429 3300025911 Ga0207654_10188500 Ga0207654_101885001 158
430 3300025911 Ga0207654_10632176 Ga0207654_106321762 158
431 3300025911 Ga0207654_10961876 Ga0207654_109618761 158
432 3300025912 Ga0207707_10016487 Ga0207707_100164873 158
433 3300025913 Ga0207695_10000053 Ga0207695_10000053326 158
434 3300025913 Ga0207695_10003037 Ga0207695_1000303712 158
435 3300025913 Ga0207695_10040116 Ga0207695_100401162 158
436 3300025913 Ga0207695_10072039 Ga0207695_100720392 158
437 3300025913 Ga0207695_10126303 Ga0207695_101263032 158
438 3300025913 Ga0207695_10295525 Ga0207695_102955251 158
439 3300025913 Ga0207695_10312478 Ga0207695_103124782 158
440 3300025913 Ga0207695_10344605 Ga0207695_103446052 158
441 3300025913 Ga0207695_10407190 Ga0207695_104071902 158
442 3300025913 Ga0207695_10764754 Ga0207695_107647542 158
443 3300025914 Ga0207671_10000366 Ga0207671_100003667 158
444 3300025914 Ga0207671_10001102 Ga0207671_1000110230 158
445 3300025914 Ga0207671_10002584 Ga0207671_1000258412 158
446 3300025914 Ga0207671_10003225 Ga0207671_100032259 158
447 3300025914 Ga0207671_10004999 Ga0207671_100049999 158
448 3300025914 Ga0207671_10007429 Ga0207671_100074292 158
449 3300025914 Ga0207671_10010518 Ga0207671_100105183 158
450 3300025914 Ga0207671_10172681 Ga0207671_101726812 158
451 3300025919 Ga0207657_10022017 Ga0207657_100220175 158
452 3300025919 Ga0207657_10056833 Ga0207657_100568332 158
453 3300025921 Ga0207652_10004543 Ga0207652_1000454311 158
454 3300025921 Ga0207652_10385960 Ga0207652_103859602 158
455 3300025924 Ga0207694_10096319 Ga0207694_100963192 158
456 3300025924 Ga0207694_10098223 Ga0207694_100982232 158
457 3300025924 Ga0207694_10826289 Ga0207694_108262892 158
458 3300025925 Ga0207650_10097803 Ga0207650_100978031 158
459 3300025931 Ga0207644_10266439 Ga0207644_102664392 158
460 3300025932 Ga0207690_10000450 Ga0207690_1000045015 158
461 3300025932 Ga0207690_10050477 Ga0207690_100504772 158
462 3300025933 Ga0207706_10000718 Ga0207706_1000071825 158
463 3300025934 Ga0207686_10834794 Ga0207686_108347941 158
464 3300025935 Ga0207709_10127254 Ga0207709_101272542 158
465 3300025937 Ga0207669_10057130 Ga0207669_100571303 158
466 3300025938 Ga0207704_10000047 Ga0207704_1000004725 158
467 3300025944 Ga0207661_10163367 Ga0207661_101633673 158
468 3300025949 Ga0207667_10000015 Ga0207667_10000015366 158
469 3300025949 Ga0207667_10006798 Ga0207667_100067983 158
470 3300025949 Ga0207667_10021180 Ga0207667_100211807 158
471 3300025949 Ga0207667_10082439 Ga0207667_100824392 158
472 3300025949 Ga0207667_10316223 Ga0207667_103162232 158
473 3300025949 Ga0207667_10471717 Ga0207667_104717172 158
474 3300025949 Ga0207667_10882778 Ga0207667_108827782 158
475 3300025960 Ga0207651_10018479 Ga0207651_100184792 158
476 3300025961 Ga0207712_10129208 Ga0207712_101292082 158
477 3300026023 Ga0207677_10025568 Ga0207677_100255682 158
478 3300026035 Ga0207703_10070693 Ga0207703_100706932 158
479 3300026041 Ga0207639_10005333 Ga0207639_100053336 158
480 3300026041 Ga0207639_10021979 Ga0207639_100219792 158
481 3300026041 Ga0207639_10107068 Ga0207639_101070682 158
482 3300026067 Ga0207678_10075848 Ga0207678_100758482 158
483 3300026067 Ga0207678_10134907 Ga0207678_101349072 158
484 3300026078 Ga0207702_10000163 Ga0207702_1000016318 158
485 3300026089 Ga0207648_10002322 Ga0207648_100023225 158
486 3300026089 Ga0207648_10550199 Ga0207648_105501992 158
487 3300026116 Ga0207674_10212810 Ga0207674_102128102 158
488 3300026116 Ga0207674_10715847 Ga0207674_107158472 158
489 3300026116 Ga0207674_11424672 Ga0207674_114246721 158
490 3300026121 Ga0207683_10003865 Ga0207683_100038655 158
491 3300026142 Ga0207698_10003303 Ga0207698_100033035 158
492 3300026142 Ga0207698_10538227 Ga0207698_105382271 158
493 3300026142 Ga0207698_11139126 Ga0207698_111391262 158
494 3300028379 Ga0268266_10000121 Ga0268266_1000012129 158
495 3300028786 Ga0307517_10000198 Ga0307517_1000019827 158
496 3300028794 Ga0307515_10002441 Ga0307515_1000244114 158
497 3300028794 Ga0307515_10004266 Ga0307515_1000426614 158
498 3300028794 Ga0307515_10021815 Ga0307515_100218157 158
499 3300028794 Ga0307515_10210901 Ga0307515_102109011 158
500 3300028794 Ga0307515_10457422 Ga0307515_104574221 158
501 3300030732 Ga0316176_1040295 Ga0316176_10402953 158
502 3300030733 Ga0314311_1087628 Ga0314311_10876282 158
503 3300030742 Ga0316183_1025240 Ga0316183_102524019 158
504 3300030744 Ga0316181_1150685 Ga0316181_11506852 158
505 3300030744 Ga0316181_1175649 Ga0316181_11756492 158
506 3300031251 Ga0265327_10000819 Ga0265327_1000081911 158
507 3300031251 Ga0265327_10067357 Ga0265327_100673572 158
508 3300031507 Ga0307509_10217285 Ga0307509_102172852 158
509 3300031548 Ga0307408_101652055 Ga0307408_1016520552 158
510 3300031595 Ga0265313_10189902 Ga0265313_101899021 158
511 3300031691 Ga0316579_10125634 Ga0316579_101256342 158
512 3300031731 Ga0307405_10000009 Ga0307405_100000092 158
513 3300031731 Ga0307405_10181855 Ga0307405_101818552 158
514 3300031903 Ga0307407_10000001 Ga0307407_10000001184 158
515 3300031911 Ga0307412_10000001 Ga0307412_10000001279 158
516 3300031911 Ga0307412_10008869 Ga0307412_100088695 158
517 3300031911 Ga0307412_10105804 Ga0307412_101058042 158
518 3300031911 Ga0307412_11027281 Ga0307412_110272811 158
519 3300031995 Ga0307409_100028160 Ga0307409_1000281602 158
520 3300032002 Ga0307416_100000008 Ga0307416_100000008205 158
521 3300032004 Ga0307414_10000241 Ga0307414_1000024117 158
522 3300032004 Ga0307414_10002316 Ga0307414_100023168 158
523 3300032004 Ga0307414_10003259 Ga0307414_100032597 158
524 3300032004 Ga0307414_10007839 Ga0307414_100078393 158
525 3300032004 Ga0307414_10223510 Ga0307414_102235102 158
526 3300032004 Ga0307414_10326356 Ga0307414_103263562 158
527 3300032004 Ga0307414_10376021 Ga0307414_103760212 158
528 3300032004 Ga0307414_11508457 Ga0307414_115084571 158
529 3300033179 Ga0307507_10000099 Ga0307507_1000009951 158
530 3300033180 Ga0307510_10000417 Ga0307510_1000041716 158
531 3300037312 Ga0395899_0000024 Ga0395899_0000024_340396_340878 158
532 3300037312 Ga0395899_0000027 Ga0395899_0000027_137583_138065 158
533 3300037312 Ga0395899_0011907 Ga0395899_0011907_2493_2975 158
534 3300037312 Ga0395899_0613211 Ga0395899_0613211_110_589 158
535 3300037418 Ga0395900_0000195 Ga0395900_0000195_7639_8118 158
536 3300037418 Ga0395900_0000275 Ga0395900_0000275_51805_52287 158
537 3300037418 Ga0395900_0657855 Ga0395900_0657855_236_715 158
538 3300037466 Ga0395898_0007299 Ga0395898_0007299_6118_6600 158
539 3300037471 Ga0395905_0004639 Ga0395905_0004639_11711_12193 158
540 3300038443 Ga0395901_0000595 Ga0395901_0000595_31370_31852 158
541 3300039447 Ga0436361_0809011 Ga0436361_0809011_898_1380 158
542 3300041451 Ga0451791_1517152 Ga0451791_1517152_119_598 158
543 3300041456 Ga0451795_1321851 Ga0451795_1321851_35_517 158
544 3300041460 Ga0451802_0760726 Ga0451802_0760726_218_700 158
545 3300041460 Ga0451802_2036595 Ga0451802_2036595_17_511 158
546 3300041509 Ga0451843_1229166 Ga0451843_1229166_71_553 158
547 3300042005 Ga0439448_0002987 Ga0439448_0002987_2739_3221 158
548 3300044656 Ga0466969_0241979 Ga0466969_0241979_68_550 158
549 3300044684 Ga0466966_0003859 Ga0466966_0003859_9367_9849 158
550 3300044693 Ga0466961_0003771 Ga0466961_0003771_7489_7971 158
551 3300045049 Ga0466959_0412267 Ga0466959_0412267_131_613 158
552 3300045049 Ga0466959_0730255 Ga0466959_0730255_110_595 158
553 3300046453 Ga0495627_032170 Ga0495627_032170_236_715 158
554 3300046454 Ga0495592_0251121 Ga0495592_0251121_562_1044 158
555 3300046462 Ga0495651_0075940 Ga0495651_0075940_1482_1982 158
556 3300046471 Ga0495650_0000231 Ga0495650_0000231_16857_17339 158
557 3300046471 Ga0495650_0098176 Ga0495650_0098176_360_845 158
558 3300046474 Ga0495605_0155182 Ga0495605_0155182_328_810 158
559 3300046492 Ga0495585_0000037 Ga0495585_0000037_20989_21471 158
560 3300046492 Ga0495585_0001999 Ga0495585_0001999_12538_13020 158
561 3300046500 Ga0495596_0025488 Ga0495596_0025488_983_1465 158
562 3300046506 Ga0495583_0009799 Ga0495583_0009799_1428_1910 158
563 3300046507 Ga0495606_0000060 Ga0495606_0000060_31385_31867 158
564 3300046507 Ga0495606_0008313 Ga0495606_0008313_3200_3682 158
565 3300046507 Ga0495606_0024862 Ga0495606_0024862_3224_3706 158
566 3300046507 Ga0495606_0059371 Ga0495606_0059371_882_1361 158
567 3300046507 Ga0495606_0111563 Ga0495606_0111563_345_827 158
568 3300046512 Ga0495610_0000108 Ga0495610_0000108_7295_7774 158
569 3300046512 Ga0495610_0000129 Ga0495610_0000129_57973_58452 158
570 3300046512 Ga0495610_0002235 Ga0495610_0002235_970_1452 158
571 3300046513 Ga0495616_0003119 Ga0495616_0003119_1620_2102 158
572 3300046518 Ga0495631_0029365 Ga0495631_0029365_1925_2407 158
573 3300046519 Ga0495632_0472035 Ga0495632_0472035_38_520 158
574 3300046520 Ga0495637_0093421 Ga0495637_0093421_358_840 158
575 3300046524 Ga0495648_0004667 Ga0495648_0004667_7962_8444 158
576 3300046524 Ga0495648_0147504 Ga0495648_0147504_324_806 158
577 3300046529 Ga0495652_0294149 Ga0495652_0294149_641_1141 158
578 3300046538 Ga0495609_0041901 Ga0495609_0041901_459_941 158
579 3300046538 Ga0495609_0046561 Ga0495609_0046561_515_997 158
580 3300046558 Ga0495633_0000015 Ga0495633_0000015_93913_94395 158
581 3300046558 Ga0495633_0013382 Ga0495633_0013382_666_1148 158
582 3300046558 Ga0495633_0024972 Ga0495633_0024972_181_660 158
583 3300046616 Ga0495668_0000041 Ga0495668_0000041_82185_82667 158
584 3300046616 Ga0495668_0576925 Ga0495668_0576925_52_534 158
585 3300046660 Ga0495625_0000191 Ga0495625_0000191_77182_77664 158
586 3300046660 Ga0495625_0000634 Ga0495625_0000634_6160_6642 158
587 3300046660 Ga0495625_0006948 Ga0495625_0006948_8287_8769 158
588 3300046660 Ga0495625_0030925 Ga0495625_0030925_2607_3089 158
589 3300046660 Ga0495625_0068145 Ga0495625_0068145_1858_2340 158
590 3300046660 Ga0495625_0073838 Ga0495625_0073838_23_505 158
591 3300046660 Ga0495625_0093901 Ga0495625_0093901_579_1061 158
592 3300046660 Ga0495625_0478616 Ga0495625_0478616_75_557 158
593 3300046665 Ga0495661_0018652 Ga0495661_0018652_2001_2483 158
594 3300046665 Ga0495661_0031520 Ga0495661_0031520_2072_2554 158
595 3300046665 Ga0495661_0041258 Ga0495661_0041258_1534_2016 158
596 3300046683 Ga0495658_0132967 Ga0495658_0132967_319_801 158
597 3300046692 Ga0495671_0302663 Ga0495671_0302663_161_643 158
598 3300046692 Ga0495671_0327587 Ga0495671_0327587_123_605 158
599 3300046694 Ga0495649_0000061 Ga0495649_0000061_19700_20182 158
600 3300046694 Ga0495649_0121704 Ga0495649_0121704_773_1255 158
601 3300046794 Ga0495589_0213985 Ga0495589_0213985_203_685 158
602 3300046810 Ga0495660_0008593 Ga0495660_0008593_5306_5788 158
603 3300046810 Ga0495660_0301971 Ga0495660_0301971_137_619 158
604 3300047443 Ga0495687_000570 Ga0495687_000570_10146_10628 158
605 3300047443 Ga0495687_002643 Ga0495687_002643_7346_7828 158
606 3300047470 Ga0495681_0119035 Ga0495681_0119035_296_775 158
607 3300047472 Ga0495686_0000697 Ga0495686_0000697_39786_40268 158
608 3300047472 Ga0495686_0006114 Ga0495686_0006114_6803_7285 158
609 3300047472 Ga0495686_0029704 Ga0495686_0029704_2549_3049 158
610 3300047472 Ga0495686_0030715 Ga0495686_0030715_2376_2858 158
611 3300047472 Ga0495686_0515808 Ga0495686_0515808_20_502 158
612 3300048089 Ga0495614_0029800 Ga0495614_0029800_1619_2101 158
613 3300048918 Ga0496115_0055026 Ga0496115_0055026_2593_3072 158
614 3300048918 Ga0496115_1167335 Ga0496115_1167335_74_553 158
615 3300048921 Ga0496118_0287513 Ga0496118_0287513_104_583 158
616 3300048925 Ga0496122_0000876 Ga0496122_0000876_12978_13457 158
617 3300048926 Ga0496123_0000777 Ga0496123_0000777_22513_22992 158
618 3300048928 Ga0496125_0042886 Ga0496125_0042886_2385_2864 158
619 3300048929 Ga0496126_1078223 Ga0496126_1078223_96_578 158
620 3300049459 Ga0495678_005052 Ga0495678_005052_3271_3753 158
621 3300049663 Ga0501223_001718 Ga0501223_001718_1310_1789 158
622 3300049705 Ga0501225_0237447 Ga0501225_0237447_33_518 158
623 3300049758 Ga0501241_008057 Ga0501241_008057_328_810 158
624 3300049822 Ga0501035_0132531 Ga0501035_0132531_981_1460 158
625 3300050493 nmdc:mga0k408_31_c1 nmdc:mga0k408_31_c1_28939_29421 158
626 3300050493 nmdc:mga0k408_4284_c1 nmdc:mga0k408_4284_c1_6563_7045 158
627 3300050496 nmdc:mga07m45_584760_c1 nmdc:mga07m45_584760_c1_137_619 158
628 3300053080 Ga0500635_0000590 Ga0500635_0000590_679_1161 158
629 3300053080 Ga0500635_0096351 Ga0500635_0096351_315_794 158
630 3300053091 Ga0500647_0211478 Ga0500647_0211478_172_654 158
631 3300053093 Ga0500651_0000058 Ga0500651_0000058_52118_52594 158
632 3300053122 Ga0500608_012925 Ga0500608_012925_274_756 158
633 3300053122 Ga0500608_285189 Ga0500608_285189_121_603 158
634 3300053123 Ga0500614_004323 Ga0500614_004323_2259_2741 158
635 3300053125 Ga0500618_000016 Ga0500618_000016_36737_37219 158
636 3300053125 Ga0500618_020994 Ga0500618_020994_1083_1565 158
637 3300053137 Ga0500561_0051779 Ga0500561_0051779_381_863 158
638 3300053138 Ga0500564_104332 Ga0500564_104332_474_956 158
639 3300053140 Ga0500573_0207924 Ga0500573_0207924_506_985 158
640 3300053156 Ga0500622_0001657 Ga0500622_0001657_13782_14264 158
641 3300053156 Ga0500622_0278440 Ga0500622_0278440_132_614 158
642 3300053157 Ga0500624_000243 Ga0500624_000243_2864_3346 158
643 3300053161 Ga0500634_0083198 Ga0500634_0083198_163_642 158
644 3300053730 Ga0500645_065217 Ga0500645_065217_422_901 158
645 3300061719 Ga0466962_0072793 Ga0466962_0072793_1044_1526 158
646 iso_pu_bacteria 2593339198 2595320901 158
647 iso_pu_bacteria 2980125574 2980128546 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02542

YgbB

YgbB family

17

171

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f0g-assembly2.cif.gz_E co-crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase with cmp 0.987 1 156
4c8g-assembly1.cif.gz_C ispf (burkholderia cenocepacia) cmp complex 0.9867 1 158
3k2x-assembly1.cif.gz_A crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei in complex with 5'-iodo-cytosine 0.9865 1 158
3k2x-assembly1.cif.gz_C crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei in complex with 5'-iodo-cytosine 0.9861 1 156
3iew-assembly1.cif.gz_A crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with bound ctp and cdp 0.986 1 156
ID Description Score Start End Superfamily
af_B6TL41_66_225_3.30.1330.50 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9796 1 158 3.30.1330.50
af_B6TL41_66_225_3.30.1330.50 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9736 1 158 3.30.1330.50
5b8fC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9704 2 156 3.30.1330.50
3t80F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9675 2 158 3.30.1330.50
2uzhA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9652 2 156 3.30.1330.50
ID Description Score Start End GO Terms
AF-A0A2T5Y996-F1-model_v4 deleted 0.9966 1 158
AF-A0A1M6M042-F1-model_v4 Bifunctional enzyme IspD/IspF [Includes: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT); 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12)] 0.9963 3 156 GO:0008685
GO:0016114
GO:0019288
GO:0046872
GO:0050518
AF-A0A136P8G2-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.996 4 157 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A2N2Y5V0-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9952 2 156 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A350V2I8-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.995 4 157 GO:0008685
GO:0016114
GO:0019288
GO:0046872

Feature Viewer

pLDDT pTM Quality
96.66 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map