F472233

General Info

Members Datasets Scaffolds Average Seq Length
646 293 1292 125

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_1432615|Ga0501036_1432615_66_446
Length 126
Sequence VRRPHPTLTPQELAIMKVVWRLESATVRDVYEALRAERTIAYTTVMTMMRILEDKGYLKKTAGSDRAYVYTPAKPQQQVLGAMVRDFVDRVFDGAPDSLLLHLAKDNKLTPKQRKLVQKLVEDIEE

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
74 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
75 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
147 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
148 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
149 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
150 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
152 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
153 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
154 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
165 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
166 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
167 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
168 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
169 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
170 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
171 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
172 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
173 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
174 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
175 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
176 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
177 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
178 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
179 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
180 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
181 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
182 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
197 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
198 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
232 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
254 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
255 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
256 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
257 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
258 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
259 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
260 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
263 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
264 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
265 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
266 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
271 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
272 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
289 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
290 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
291 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
293 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.39
Nodule 0
Rhizoplane 2.32
Rhizosphere 96.13
Stem 0
Stem Tuber 0
Unclassified 12.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_1432615 3300049572 Bacteria 560
2 JGI24743J22301_10110166 3300001991 Bacteria 598
3 JGI25406J46586_10000086 3300003203 Bacteria 42367
4 Ga0065715_10216942 3300005293 Bacteria 1289
5 Ga0065715_10350951 3300005293 Bacteria 937
6 Ga0065715_10452191 3300005293 Bacteria 825
7 Ga0070676_10144340 3300005328 Bacteria 1518
8 Ga0070690_100695184 3300005330 Bacteria 780
9 Ga0070677_10370571 3300005333 Bacteria 747
10 Ga0068869_100094031 3300005334 Bacteria 2259
11 Ga0068869_101241351 3300005334 Bacteria 656
12 Ga0068868_101179690 3300005338 Bacteria 707
13 Ga0070660_100274280 3300005339 Bacteria 1379
14 Ga0070691_10439192 3300005341 Bacteria 743
15 Ga0070687_100444308 3300005343 Bacteria 861
16 Ga0070661_101425249 3300005344 Bacteria 583
17 Ga0070669_100489695 3300005353 Bacteria 1019
18 Ga0070675_102009963 3300005354 Unclassified 533
19 Ga0070671_100120098 3300005355 Bacteria 2211
20 Ga0070673_100008992 3300005364 Bacteria 6683
21 Ga0070667_100799128 3300005367 Bacteria 876
22 Ga0070701_10191467 3300005438 Bacteria 1204
23 Ga0070700_100212572 3300005441 Bacteria 1365
24 Ga0070678_100126617 3300005456 Bacteria 2023
25 Ga0070662_101116880 3300005457 Bacteria 677
26 Ga0070681_10443492 3300005458 Bacteria 1210
27 Ga0070698_100348506 3300005471 Unclassified 1412
28 Ga0070684_100000002 3300005535 Bacteria 257669
29 Ga0070684_100012937 3300005535 Bacteria 6710
30 Ga0070697_101558173 3300005536 Bacteria 591
31 Ga0070672_100133602 3300005543 Bacteria 2042
32 Ga0070672_100470320 3300005543 Bacteria 1085
33 Ga0070686_100070458 3300005544 Bacteria 2286
34 Ga0070695_101834286 3300005545 Bacteria 509
35 Ga0070693_101170560 3300005547 Bacteria 589
36 Ga0070665_100425906 3300005548 Bacteria 1336
37 Ga0070665_100576846 3300005548 Bacteria 1138
38 Ga0070704_100360082 3300005549 Bacteria 1230
39 Ga0070704_100686108 3300005549 Bacteria 907
40 Ga0068855_100872763 3300005563 Bacteria 952
41 Ga0070664_100189518 3300005564 Bacteria 1832
42 Ga0070664_101645910 3300005564 Unclassified 608
43 Ga0068854_100392497 3300005578 Bacteria 1146
44 Ga0068854_100544888 3300005578 Bacteria 983
45 Ga0068854_101561332 3300005578 Bacteria 600
46 Ga0070702_100514571 3300005615 Bacteria 881
47 Ga0068852_101150583 3300005616 Bacteria 797
48 Ga0068859_100168034 3300005617 Bacteria 2273
49 Ga0068859_100660589 3300005617 Bacteria 1137
50 Ga0068864_101210924 3300005618 Bacteria 754
51 Ga0068861_101585345 3300005719 Bacteria 645
52 Ga0068861_101601279 3300005719 Bacteria 642
53 Ga0068863_100139472 3300005841 Bacteria 2317
54 Ga0068858_100007829 3300005842 Bacteria 10312
55 Ga0068858_100944307 3300005842 Bacteria 844
56 Ga0068858_100997305 3300005842 Bacteria 821
57 Ga0068860_100163712 3300005843 Bacteria 2146
58 Ga0068860_100232268 3300005843 Bacteria 1793
59 Ga0068860_100328287 3300005843 Bacteria 1502
60 Ga0068862_100049562 3300005844 Bacteria 3587
61 Ga0068862_100499676 3300005844 Bacteria 1154
62 Ga0081455_10101876 3300005937 Bacteria 2303
63 Ga0081539_10000012 3300005985 Bacteria 440369
64 Ga0075364_10156693 3300006051 Bacteria 1536
65 Ga0075366_10386281 3300006195 Bacteria 861
66 Ga0097621_100868894 3300006237 Bacteria 839
67 Ga0097621_100956021 3300006237 Bacteria 800
68 Ga0068871_101387574 3300006358 Unclassified 662
69 Ga0075428_100000520 3300006844 Bacteria 39099
70 Ga0075428_100091613 3300006844 Bacteria 3315
71 Ga0075428_101733694 3300006844 Unclassified 651
72 Ga0075430_100003461 3300006846 Bacteria 13209
73 Ga0075430_100322740 3300006846 Bacteria 1276
74 Ga0075430_100613535 3300006846 Bacteria 897
75 Ga0075430_100726477 3300006846 Bacteria 819
76 Ga0075431_100001758 3300006847 Bacteria 20399
77 Ga0075431_100334468 3300006847 Bacteria 1525
78 Ga0075431_100448281 3300006847 Bacteria 1286
79 Ga0075433_10004102 3300006852 Bacteria 11299
80 Ga0075433_10076901 3300006852 Unclassified 2940
81 Ga0075433_11237150 3300006852 Bacteria 648
82 Ga0075434_100000255 3300006871 Bacteria 37590
83 Ga0075434_100016596 3300006871 Bacteria 7080
84 Ga0075434_100041749 3300006871 Bacteria 4545
85 Ga0075434_100089413 3300006871 Bacteria 3081
86 Ga0075429_100003784 3300006880 Bacteria 12906
87 Ga0075429_100110223 3300006880 Bacteria 2406
88 Ga0075429_100221357 3300006880 Bacteria 1658
89 Ga0097620_100168032 3300006931 Bacteria 2273
90 Ga0097620_100660608 3300006931 Bacteria 1137
91 Ga0097620_101058173 3300006931 Bacteria 892
92 Ga0075435_100007181 3300007076 Bacteria 7923
93 Ga0075435_101160963 3300007076 Unclassified 675
94 Ga0105240_10050602 3300009093 Bacteria 5236
95 Ga0105240_10260686 3300009093 Bacteria 2000
96 Ga0111539_10001401 3300009094 Bacteria 32090
97 Ga0111539_10001731 3300009094 Bacteria 29064
98 Ga0111539_10003547 3300009094 Bacteria 20567
99 Ga0111539_10010561 3300009094 Bacteria 11628
100 Ga0111539_10019636 3300009094 Bacteria 8338
101 Ga0111539_10026764 3300009094 Bacteria 7048
102 Ga0111539_10061493 3300009094 Bacteria 4449
103 Ga0111539_10108897 3300009094 Bacteria 3251
104 Ga0111539_10112414 3300009094 Bacteria 3195
105 Ga0111539_10148875 3300009094 Bacteria 2740
106 Ga0111539_10294682 3300009094 Bacteria 1888
107 Ga0111539_10483731 3300009094 Bacteria 1442
108 Ga0111539_13017932 3300009094 Bacteria 544
109 Ga0105245_10102966 3300009098 Bacteria 2644
110 Ga0105245_11158076 3300009098 Bacteria 820
111 Ga0105245_11404444 3300009098 Bacteria 748
112 Ga0105245_11756347 3300009098 Bacteria 673
113 Ga0105247_10141609 3300009101 Bacteria 1576
114 Ga0105247_11520209 3300009101 Bacteria 547
115 Ga0114129_10001729 3300009147 Bacteria 29783
116 Ga0114129_10003143 3300009147 Bacteria 23175
117 Ga0114129_10016613 3300009147 Bacteria 10483
118 Ga0114129_10026062 3300009147 Bacteria 8279
119 Ga0114129_10027056 3300009147 Bacteria 8120
120 Ga0114129_10047132 3300009147 Bacteria 6057
121 Ga0114129_10094847 3300009147 Bacteria 4132
122 Ga0114129_10153125 3300009147 Bacteria 3155
123 Ga0114129_10211754 3300009147 Unclassified 2620
124 Ga0114129_10226921 3300009147 Bacteria 2517
125 Ga0114129_10239839 3300009147 Bacteria 2437
126 Ga0114129_10378534 3300009147 Bacteria 1870
127 Ga0114129_10824857 3300009147 Unclassified 1181
128 Ga0114129_11885184 3300009147 Bacteria 725
129 Ga0105243_12308489 3300009148 Unclassified 576
130 Ga0105241_10183629 3300009174 Bacteria 1737
131 Ga0105242_10015594 3300009176 Bacteria 5903
132 Ga0105242_12582981 3300009176 Bacteria 557
133 Ga0105248_10018790 3300009177 Bacteria 7644
134 Ga0105248_10042223 3300009177 Bacteria 5114
135 Ga0105248_10059334 3300009177 Bacteria 4297
136 Ga0105248_10443122 3300009177 Bacteria 1463
137 Ga0105248_10582249 3300009177 Bacteria 1263
138 Ga0105248_10854395 3300009177 Archaea 1027
139 Ga0105248_11485810 3300009177 Bacteria 767
140 Ga0105237_10023143 3300009545 Bacteria 6370
141 Ga0105237_10662622 3300009545 Unclassified 1050
142 Ga0105237_12136782 3300009545 Bacteria 569
143 Ga0105238_10097518 3300009551 Bacteria 2925
144 Ga0105249_10022138 3300009553 Bacteria 5692
145 Ga0105249_10049781 3300009553 Bacteria 3821
146 Ga0105249_10327727 3300009553 Bacteria 1544
147 Ga0105249_10686289 3300009553 Bacteria 1083
148 Ga0105249_10779945 3300009553 Bacteria 1019
149 Ga0105249_10844540 3300009553 Bacteria 981
150 Ga0105249_10917984 3300009553 Bacteria 943
151 Ga0105249_11168115 3300009553 Bacteria 840
152 Ga0105249_11202959 3300009553 Bacteria 829
153 Ga0105239_10440575 3300010375 Bacteria 1477
154 Ga0105239_10458773 3300010375 Unclassified 1446
155 Ga0105239_11972939 3300010375 Bacteria 677
156 Ga0105246_10122875 3300011119 Bacteria 1926
157 Ga0105246_10959731 3300011119 Bacteria 771
158 Ga0105246_12377911 3300011119 Bacteria 519
159 Ga0157337_1027404 3300012483 Bacteria 564
160 Ga0157313_1058842 3300012503 Bacteria 520
161 Ga0157316_1037153 3300012510 Bacteria 619
162 Ga0157373_11118768 3300013100 Unclassified 591
163 Ga0157371_11462698 3300013102 Bacteria 532
164 Ga0157370_11704397 3300013104 Unclassified 566
165 Ga0157369_10279282 3300013105 Bacteria 1739
166 Ga0157374_10060347 3300013296 Bacteria 3549
167 Ga0157374_10202827 3300013296 Bacteria 1942
168 Ga0157374_11226477 3300013296 Unclassified 771
169 Ga0157378_10212319 3300013297 Bacteria 1836
170 Ga0157378_10905404 3300013297 Bacteria 913
171 Ga0157378_10949242 3300013297 Bacteria 892
172 Ga0157378_11044101 3300013297 Bacteria 853
173 Ga0157378_11712686 3300013297 Bacteria 676
174 Ga0163162_10180764 3300013306 Bacteria 2235
175 Ga0157372_10218842 3300013307 Bacteria 2207
176 Ga0157372_10954405 3300013307 Bacteria 994
177 Ga0157372_11986058 3300013307 Unclassified 668
178 Ga0157372_12479163 3300013307 Bacteria 595
179 Ga0157375_10217045 3300013308 Bacteria 2071
180 Ga0157375_11971880 3300013308 Unclassified 694
181 Ga0157375_12471589 3300013308 Unclassified 620
182 Ga0163163_10953911 3300014325 Bacteria 921
183 Ga0163163_11207767 3300014325 Bacteria 819
184 Ga0163163_11508786 3300014325 Bacteria 733
185 Ga0157380_10007780 3300014326 Bacteria 7627
186 Ga0157380_10032908 3300014326 Bacteria 3990
187 Ga0157380_10053390 3300014326 Bacteria 3204
188 Ga0157380_10416620 3300014326 Bacteria 1280
189 Ga0157380_10624523 3300014326 Bacteria 1070
190 Ga0157380_11104808 3300014326 Bacteria 832
191 Ga0157380_11114854 3300014326 Bacteria 829
192 Ga0157380_12261015 3300014326 Bacteria 608
193 Ga0157377_10009057 3300014745 Bacteria 4876
194 Ga0157377_10247743 3300014745 Bacteria 1153
195 Ga0157377_10822214 3300014745 Bacteria 687
196 Ga0157379_10027898 3300014968 Bacteria 5025
197 Ga0157379_10099223 3300014968 Bacteria 2614
198 Ga0157376_10044899 3300014969 Bacteria 3635
199 Ga0157376_10304152 3300014969 Bacteria 1511
200 Ga0163161_11072404 3300017792 Bacteria 691
201 Ga0206356_10629357 3300020070 Bacteria 651
202 Ga0207682_10172251 3300025893 Bacteria 985
203 Ga0207710_10180930 3300025900 Bacteria 1034
204 Ga0207688_10008248 3300025901 Bacteria 5662
205 Ga0207680_10871997 3300025903 Bacteria 645
206 Ga0207645_10001823 3300025907 Bacteria 17186
207 Ga0207645_10020752 3300025907 Bacteria 4296
208 Ga0207645_10148047 3300025907 Bacteria 1532
209 Ga0207705_10178836 3300025909 Unclassified 1600
210 Ga0207654_10093133 3300025911 Bacteria 1841
211 Ga0207707_10138265 3300025912 Unclassified 2130
212 Ga0207695_10183396 3300025913 Bacteria 2013
213 Ga0207695_10647193 3300025913 Bacteria 938
214 Ga0207660_10762235 3300025917 Bacteria 790
215 Ga0207657_10398711 3300025919 Bacteria 1082
216 Ga0207657_11111299 3300025919 Unclassified 604
217 Ga0207681_10073201 3300025923 Unclassified 2396
218 Ga0207681_10254762 3300025923 Bacteria 1372
219 Ga0207681_10556987 3300025923 Bacteria 944
220 Ga0207650_10101826 3300025925 Bacteria 2212
221 Ga0207650_10139540 3300025925 Bacteria 1904
222 Ga0207659_11163410 3300025926 Bacteria 663
223 Ga0207659_11344520 3300025926 Unclassified 613
224 Ga0207659_11584384 3300025926 Bacteria 559
225 Ga0207687_10223755 3300025927 Bacteria 1483
226 Ga0207644_10124840 3300025931 Bacteria 1963
227 Ga0207644_10742426 3300025931 Unclassified 820
228 Ga0207690_10016713 3300025932 Bacteria 4470
229 Ga0207706_10012124 3300025933 Bacteria 7851
230 Ga0207706_10032614 3300025933 Bacteria 4637
231 Ga0207686_10522007 3300025934 Bacteria 924
232 Ga0207670_10211874 3300025936 Bacteria 1478
233 Ga0207669_10182684 3300025937 Bacteria 1505
234 Ga0207669_10244538 3300025937 Bacteria 1332
235 Ga0207704_10396012 3300025938 Bacteria 1088
236 Ga0207691_10013561 3300025940 Bacteria 7792
237 Ga0207691_10182794 3300025940 Bacteria 1831
238 Ga0207711_10011726 3300025941 Bacteria 7280
239 Ga0207711_10771729 3300025941 Bacteria 896
240 Ga0207689_10148649 3300025942 Bacteria 1931
241 Ga0207689_10156479 3300025942 Bacteria 1879
242 Ga0207661_10004527 3300025944 Bacteria 9742
243 Ga0207679_10786151 3300025945 Bacteria 867
244 Ga0207667_11110241 3300025949 Bacteria 774
245 Ga0207651_10008853 3300025960 Bacteria 5465
246 Ga0207651_10180087 3300025960 Bacteria 1676
247 Ga0207712_11591346 3300025961 Bacteria 586
248 Ga0207640_10530649 3300025981 Bacteria 985
249 Ga0207640_10585845 3300025981 Bacteria 942
250 Ga0207658_10039509 3300025986 Bacteria 3405
251 Ga0207677_10351266 3300026023 Bacteria 1236
252 Ga0207703_10490171 3300026035 Bacteria 1152
253 Ga0207703_10814807 3300026035 Bacteria 892
254 Ga0207703_11000518 3300026035 Bacteria 802
255 Ga0207708_10061970 3300026075 Bacteria 2857
256 Ga0207641_10064629 3300026088 Bacteria 3128
257 Ga0207648_10036131 3300026089 Bacteria 4352
258 Ga0207648_12105740 3300026089 Unclassified 525
259 Ga0207676_10035071 3300026095 Bacteria 3804
260 Ga0207676_10902305 3300026095 Unclassified 867
261 Ga0207675_100137880 3300026118 Bacteria 2316
262 Ga0207683_10220069 3300026121 Bacteria 1730
263 Ga0207698_10075342 3300026142 Bacteria 2696
264 Ga0207698_10459762 3300026142 Bacteria 1231
265 Ga0207428_10000207 3300027907 Bacteria 81801
266 Ga0207428_10006871 3300027907 Bacteria 10427
267 Ga0207428_10031947 3300027907 Bacteria 4335
268 Ga0207428_10664958 3300027907 Bacteria 747
269 Ga0268266_10516587 3300028379 Bacteria 1142
270 Ga0268266_11029159 3300028379 Bacteria 797
271 Ga0268265_10057448 3300028380 Bacteria 2966
272 Ga0268265_11541830 3300028380 Unclassified 669
273 Ga0268264_10700449 3300028381 Bacteria 1006
274 Ga0268264_10960016 3300028381 Bacteria 860
275 Ga0265325_10161988 3300031241 Bacteria 1052
276 Ga0307413_10174123 3300031824 Unclassified 1527
277 Ga0307410_10096342 3300031852 Bacteria 2112
278 Ga0307407_10216383 3300031903 Bacteria 1293
279 Ga0307407_11185017 3300031903 Unclassified 596
280 Ga0307407_11669130 3300031903 Bacteria 507
281 Ga0307412_10254094 3300031911 Bacteria 1366
282 Ga0307409_101075045 3300031995 Bacteria 825
283 Ga0307409_101604961 3300031995 Unclassified 679
284 Ga0307414_10086639 3300032004 Unclassified 2312
285 Ga0307414_12227568 3300032004 Unclassified 512
286 Ga0307411_10098496 3300032005 Unclassified 2061
287 Ga0307415_100009581 3300032126 Bacteria 5440
288 Ga0307415_101249337 3300032126 Bacteria 702
289 Ga0373930_0105271 3300034816 Bacteria 674
290 Ga0373940_0180193 3300035088 Bacteria 687
291 Ga0373949_0015209 3300035090 Bacteria 1717
292 Ga0373952_0140144 3300035092 Bacteria 671
293 Ga0373952_0158945 3300035092 Bacteria 639
294 Ga0373936_0262161 3300035113 Bacteria 774
295 Ga0373939_0043630 3300035114 Bacteria 1362
296 Ga0373939_0260480 3300035114 Bacteria 678
297 Ga0373941_0211473 3300035115 Bacteria 742
298 Ga0373945_0507717 3300035116 Unclassified 538
299 Ga0373953_0401859 3300035117 Unclassified 603
300 Ga0373954_0576229 3300035118 Unclassified 558
301 Ga0373954_0664688 3300035118 Unclassified 516
302 Ga0373956_0268874 3300035119 Bacteria 811
303 Ga0373956_0395977 3300035119 Bacteria 659
304 Ga0373946_0240021 3300035171 Bacteria 881
305 Ga0373946_0411861 3300035171 Bacteria 684
306 Ga0373946_0551381 3300035171 Bacteria 595
307 Ga0373961_0051929 3300035241 Bacteria 1219
308 Ga0373931_0092677 3300035691 Bacteria 1686
309 Ga0373931_0096792 3300035691 Bacteria 1654
310 Ga0373931_0178932 3300035691 Unclassified 1255
311 Ga0373935_0052859 3300035692 Bacteria 2584
312 Ga0373933_0585103 3300035724 Bacteria 733
313 Ga0373937_0179846 3300036401 Bacteria 1986
314 Ga0373937_0784197 3300036401 Bacteria 901
315 Ga0373937_0825367 3300036401 Unclassified 875
316 Ga0373937_1086070 3300036401 Bacteria 749
317 Ga0373925_0667528 3300037068 Bacteria 857
318 Ga0439453_0002116 3300041408 Unclassified 2688
319 Ga0439453_0024059 3300041408 Bacteria 1115
320 Ga0439453_0041466 3300041408 Bacteria 904
321 Ga0451802_1138671 3300041460 Bacteria 702
322 Ga0451853_2457291 3300041512 Bacteria 1309
323 Ga0439431_0028192 3300041997 Bacteria 1382
324 Ga0439433_0024752 3300041999 Bacteria 1353
325 Ga0439437_049715 3300042000 Bacteria 555
326 Ga0439445_0113348 3300042004 Bacteria 775
327 Ga0439449_0100527 3300042007 Bacteria 1069
328 Ga0439451_044180 3300042009 Unclassified 893
329 Ga0450921_006295 3300042123 Bacteria 920
330 Ga0450888_008092 3300042126 Bacteria 1177
331 Ga0450896_038753 3300042133 Bacteria 738
332 Ga0439446_0015406 3300042156 Bacteria 2120
333 Ga0439446_0056385 3300042156 Bacteria 1181
334 Ga0450908_009700 3300042184 Bacteria 1785
335 Ga0439434_0050207 3300042435 Bacteria 1292
336 Ga0439435_0001661 3300042436 Bacteria 4187
337 Ga0439435_0011291 3300042436 Bacteria 2141
338 Ga0439435_0033974 3300042436 Bacteria 1400
339 Ga0439435_0058413 3300042436 Bacteria 1119
340 Ga0439435_0075869 3300042436 Bacteria 1002
341 Ga0439444_0083370 3300042437 Unclassified 703
342 Ga0439464_0004391 3300042439 Unclassified 3606
343 Ga0439460_0097595 3300042461 Unclassified 940
344 Ga0439460_0211963 3300042461 Unclassified 662
345 Ga0439460_0263541 3300042461 Bacteria 598
346 Ga0451577_0100834 3300042876 Bacteria 2579
347 Ga0451577_1746804 3300042876 Bacteria 547
348 Ga0466966_0575060 3300044684 Bacteria 678
349 Ga0453684_0061251 3300044712 Bacteria 4832
350 Ga0451576_0068009 3300045051 Bacteria 3707
351 Ga0466958_0106797 3300045836 Unclassified 1746
352 Ga0495592_0082611 3300046454 Unclassified 2321
353 Ga0495651_0011125 3300046462 Bacteria 6921
354 Ga0495580_0069119 3300046472 Bacteria 2468
355 Ga0495580_0079561 3300046472 Bacteria 2286
356 Ga0495580_0359760 3300046472 Bacteria 985
357 Ga0495664_0044426 3300046477 Bacteria 2633
358 Ga0495664_0123338 3300046477 Bacteria 1567
359 Ga0495608_0002722 3300046511 Bacteria 12703
360 Ga0495608_0761354 3300046511 Bacteria 573
361 Ga0495618_0064307 3300046514 Bacteria 2331
362 Ga0495618_0440104 3300046514 Bacteria 792
363 Ga0495618_0752505 3300046514 Bacteria 570
364 Ga0495628_0078037 3300046516 Bacteria 2576
365 Ga0495628_0098811 3300046516 Bacteria 2254
366 Ga0495630_0007651 3300046517 Bacteria 7726
367 Ga0495630_0930184 3300046517 Unclassified 662
368 Ga0495631_0473574 3300046518 Bacteria 533
369 Ga0495637_0279523 3300046520 Bacteria 596
370 Ga0495644_0204954 3300046523 Bacteria 761
371 Ga0495652_0060973 3300046529 Bacteria 3186
372 Ga0495652_0062456 3300046529 Bacteria 3141
373 Ga0495665_0188892 3300046531 Bacteria 1069
374 Ga0495640_0106397 3300046533 Bacteria 1837
375 Ga0495640_0718756 3300046533 Bacteria 598
376 Ga0495586_0139160 3300046535 Bacteria 1362
377 Ga0495586_0233081 3300046535 Bacteria 1048
378 Ga0495586_0532195 3300046535 Bacteria 678
379 Ga0495587_0074388 3300046536 Bacteria 1973
380 Ga0495587_0180314 3300046536 Bacteria 1198
381 Ga0495645_0191861 3300046543 Bacteria 1391
382 Ga0495667_0041532 3300046559 Bacteria 3050
383 Ga0495667_0120477 3300046559 Bacteria 1694
384 Ga0495667_0165694 3300046559 Unclassified 1421
385 Ga0495667_0383236 3300046559 Unclassified 886
386 Ga0495656_0039609 3300046615 Bacteria 1959
387 Ga0495635_0340272 3300046663 Bacteria 1002
388 Ga0495635_0521648 3300046663 Bacteria 781
389 Ga0495657_0213681 3300046675 Bacteria 1172
390 Ga0495623_0030461 3300046679 Bacteria 3470
391 Ga0495623_0221048 3300046679 Bacteria 1079
392 Ga0495623_0347225 3300046679 Bacteria 809
393 Ga0495658_0054974 3300046683 Bacteria 2266
394 Ga0495658_0840017 3300046683 Unclassified 588
395 Ga0495669_0003525 3300046684 Bacteria 6455
396 Ga0495613_0008887 3300046689 Bacteria 7453
397 Ga0495600_0023520 3300046809 Bacteria 3964
398 Ga0495581_0216249 3300047315 Bacteria 1120
399 Ga0495604_0038616 3300047317 Bacteria 3756
400 Ga0495604_0103699 3300047317 Bacteria 2086
401 Ga0495604_0804122 3300047317 Unclassified 592
402 Ga0495674_0010121 3300047319 Bacteria 8935
403 Ga0495674_0112954 3300047319 Bacteria 2301
404 Ga0495674_0116348 3300047319 Bacteria 2262
405 Ga0495674_0273340 3300047319 Bacteria 1386
406 Ga0495674_0291989 3300047319 Bacteria 1333
407 Ga0495680_0032279 3300047322 Bacteria 4252
408 Ga0495675_0005268 3300047444 Bacteria 7877
409 Ga0495675_0280340 3300047444 Bacteria 994
410 Ga0495675_0304937 3300047444 Bacteria 945
411 Ga0495684_0000393 3300047471 Bacteria 35739
412 Ga0495684_0005257 3300047471 Bacteria 10077
413 Ga0495684_0220181 3300047471 Bacteria 1392
414 Ga0495684_0277644 3300047471 Bacteria 1210
415 Ga0495684_0875069 3300047471 Bacteria 581
416 Ga0495602_0004308 3300048088 Bacteria 14817
417 Ga0495602_0581153 3300048088 Unclassified 773
418 Ga0495602_1132921 3300048088 Unclassified 512
419 Ga0496102_1253491 3300048905 Bacteria 661
420 Ga0496103_0825200 3300048906 Bacteria 584
421 Ga0496104_1500462 3300048907 Bacteria 577
422 Ga0496106_0150924 3300048909 Bacteria 1833
423 Ga0496108_1569167 3300048911 Unclassified 546
424 Ga0496109_0252125 3300048912 Bacteria 1662
425 Ga0496109_0622492 3300048912 Bacteria 1016
426 Ga0496109_1595583 3300048912 Unclassified 587
427 Ga0496110_0283739 3300048913 Bacteria 1508
428 Ga0496112_0579512 3300048915 Bacteria 1055
429 Ga0496112_1642306 3300048915 Unclassified 556
430 Ga0496113_0054386 3300048916 Unclassified 2997
431 Ga0496113_0207994 3300048916 Bacteria 1557
432 Ga0496114_0099401 3300048917 Bacteria 2482
433 Ga0501297_059878 3300049520 Bacteria 580
434 Ga0501031_0551832 3300049568 Bacteria 742
435 Ga0501033_0602737 3300049570 Bacteria 753
436 Ga0501034_0116392 3300049571 Unclassified 2661
437 Ga0501034_0122890 3300049571 Bacteria 2582
438 Ga0501036_0220130 3300049572 Bacteria 1594
439 Ga0501036_0332469 3300049572 Bacteria 1269
440 Ga0501036_1558454 3300049572 Unclassified 534
441 Ga0501038_0212258 3300049574 Bacteria 1548
442 Ga0501038_0725124 3300049574 Bacteria 743
443 Ga0501039_0052221 3300049575 Bacteria 3163
444 Ga0501039_0298559 3300049575 Bacteria 1266
445 Ga0501040_0013992 3300049576 Bacteria 5283
446 Ga0501041_0060247 3300049577 Bacteria 2323
447 Ga0501041_0074182 3300049577 Bacteria 2090
448 Ga0501041_0196236 3300049577 Unclassified 1265
449 Ga0501041_0498846 3300049577 Bacteria 774
450 Ga0501042_0056209 3300049578 Bacteria 2808
451 Ga0501042_0472608 3300049578 Bacteria 909
452 Ga0501042_0895863 3300049578 Unclassified 646
453 Ga0501043_0327685 3300049579 Bacteria 1167
454 Ga0501043_0689866 3300049579 Unclassified 747
455 Ga0501046_0124438 3300049580 Bacteria 1960
456 Ga0501046_0165199 3300049580 Bacteria 1663
457 Ga0501046_0967574 3300049580 Unclassified 592
458 Ga0501047_0037052 3300049581 Bacteria 4715
459 Ga0501047_0877292 3300049581 Unclassified 711
460 Ga0501048_0023664 3300049582 Bacteria 4487
461 Ga0501048_0692576 3300049582 Unclassified 732
462 Ga0501067_0142683 3300049583 Bacteria 1334
463 Ga0501067_0284184 3300049583 Bacteria 921
464 Ga0501067_0301131 3300049583 Bacteria 893
465 Ga0501067_0423585 3300049583 Bacteria 743
466 Ga0501068_0314715 3300049584 Bacteria 1003
467 Ga0501069_0292150 3300049585 Bacteria 955
468 Ga0501071_0042593 3300049587 Bacteria 3254
469 Ga0501071_0124934 3300049587 Bacteria 1909
470 Ga0501071_0155895 3300049587 Bacteria 1705
471 Ga0501071_0379934 3300049587 Bacteria 1077
472 Ga0501071_0495447 3300049587 Bacteria 937
473 Ga0501072_0040218 3300049588 Bacteria 3671
474 Ga0501072_0084985 3300049588 Bacteria 2509
475 Ga0501072_0139365 3300049588 Bacteria 1934
476 Ga0501072_0296699 3300049588 Bacteria 1285
477 Ga0501072_0632001 3300049588 Bacteria 843
478 Ga0501072_0663100 3300049588 Bacteria 821
479 Ga0501073_0175210 3300049589 Bacteria 1484
480 Ga0501073_0465494 3300049589 Bacteria 874
481 Ga0501073_0935243 3300049589 Bacteria 597
482 Ga0501074_0017193 3300049590 Bacteria 5248
483 Ga0501074_0598900 3300049590 Unclassified 779
484 Ga0501075_0008705 3300049591 Bacteria 7075
485 Ga0501075_0135462 3300049591 Bacteria 1876
486 Ga0501075_0343100 3300049591 Bacteria 1138
487 Ga0501075_1252286 3300049591 Bacteria 562
488 Ga0501076_0007531 3300049592 Bacteria 7922
489 Ga0501076_0026016 3300049592 Bacteria 4529
490 Ga0501076_0169150 3300049592 Bacteria 1781
491 Ga0501076_0191797 3300049592 Bacteria 1668
492 Ga0501076_1206519 3300049592 Bacteria 623
493 Ga0501077_0000316 3300049593 Bacteria 28858
494 Ga0501077_0003848 3300049593 Bacteria 9047
495 Ga0501077_0077427 3300049593 Bacteria 2107
496 Ga0501077_0195838 3300049593 Unclassified 1284
497 Ga0501077_0337330 3300049593 Bacteria 961
498 Ga0501077_0377446 3300049593 Bacteria 906
499 Ga0501077_0581126 3300049593 Bacteria 719
500 Ga0501206_054738 3300049653 Bacteria 643
501 Ga0501216_034864 3300049660 Bacteria 944
502 Ga0501223_085300 3300049663 Bacteria 636
503 Ga0501233_158713 3300049668 Bacteria 635
504 Ga0501221_242205 3300049704 Bacteria 515
505 Ga0501225_0216391 3300049705 Bacteria 615
506 Ga0501225_0238832 3300049705 Unclassified 593
507 Ga0501079_0063293 3300049741 Bacteria 2854
508 Ga0501079_0108841 3300049741 Bacteria 2152
509 Ga0501079_0256657 3300049741 Bacteria 1366
510 Ga0501079_0292034 3300049741 Bacteria 1275
511 Ga0501079_0415589 3300049741 Bacteria 1055
512 Ga0501079_0936508 3300049741 Bacteria 682
513 Ga0501080_0012602 3300049742 Bacteria 7752
514 Ga0501080_0064074 3300049742 Bacteria 3420
515 Ga0501080_0091240 3300049742 Bacteria 2830
516 Ga0501080_0117997 3300049742 Bacteria 2460
517 Ga0501080_0411385 3300049742 Bacteria 1216
518 Ga0501081_0022041 3300049743 Bacteria 4259
519 Ga0501081_0194050 3300049743 Bacteria 1471
520 Ga0501081_0351754 3300049743 Bacteria 1086
521 Ga0501081_0518044 3300049743 Bacteria 889
522 Ga0501083_0144569 3300049744 Bacteria 1557
523 Ga0501083_0162076 3300049744 Bacteria 1463
524 Ga0501266_086431 3300049763 Bacteria 539
525 Ga0501273_003780 3300049770 Bacteria 1631
526 Ga0501283_044717 3300049779 Bacteria 773
527 Ga0501035_0103766 3300049822 Bacteria 2494
528 Ga0501044_1090851 3300049823 Unclassified 668
529 Ga0501045_0010007 3300049824 Bacteria 6632
530 Ga0501045_0176457 3300049824 Bacteria 1591
531 Ga0501045_0848798 3300049824 Bacteria 672
532 Ga0501204_063830 3300049850 Bacteria 592
533 Ga0501212_009493 3300049851 Bacteria 1372
534 nmdc:mga03683_285936_c1 3300050489 Bacteria 771
535 nmdc:mga00v17_117229_c1 3300050491 Bacteria 1693
536 nmdc:mga00v17_71216_c1 3300050491 Bacteria 2155
537 nmdc:mga00v17_870858_c1 3300050491 Bacteria 571
538 nmdc:mga0yw44_57469_c1 3300050492 Bacteria 2373
539 nmdc:mga0k408_40201_c1 3300050493 Bacteria 2690
540 nmdc:mga0k408_920008_c1 3300050493 Bacteria 507
541 nmdc:mga05p37_1064428_c1 3300050507 Bacteria 851
542 nmdc:mga05p37_1811154_c1 3300050507 Unclassified 588
543 nmdc:mga05p37_1938_c1 3300050507 Bacteria 24101
544 nmdc:mga05p37_2137_c1 3300050507 Bacteria 23077
545 nmdc:mga05p37_21634_c1 3300050507 Bacteria 7792
546 nmdc:mga05p37_285153_c1 3300050507 Bacteria 1968
547 nmdc:mga05p37_28990_c1 3300050507 Bacteria 6754
548 nmdc:mga05p37_340986_c1 3300050507 Bacteria 1767
549 nmdc:mga05p37_376393_c1 3300050507 Bacteria 1665
550 nmdc:mga05p37_40969_c1 3300050507 Bacteria 5687
551 nmdc:mga05p37_41070_c1 3300050507 Bacteria 5680
552 nmdc:mga05p37_450429_c1 3300050507 Unclassified 1490
553 nmdc:mga05p37_591206_c1 3300050507 Bacteria 1255
554 nmdc:mga05p37_83130_c1 3300050507 Bacteria 3944
555 nmdc:mga09592_1318850_c1 3300050508 Bacteria 593
556 nmdc:mga09592_16200_c1 3300050508 Bacteria 6093
557 nmdc:mga09592_1747221_c1 3300050508 Bacteria 501
558 nmdc:mga09592_23595_c1 3300050508 Bacteria 5081
559 nmdc:mga09592_24389_c1 3300050508 Bacteria 5002
560 nmdc:mga09592_246119_c1 3300050508 Bacteria 1550
561 nmdc:mga09592_26148_c1 3300050508 Bacteria 4834
562 nmdc:mga09592_529486_c1 3300050508 Bacteria 1013
563 nmdc:mga0qj67_100554_c1 3300050509 Bacteria 2331
564 nmdc:mga0qj67_15436_c1 3300050509 Bacteria 5783
565 nmdc:mga0qj67_214819_c1 3300050509 Bacteria 1562
566 nmdc:mga0qj67_2436_c1 3300050509 Bacteria 13251
567 nmdc:mga0qj67_290307_c1 3300050509 Bacteria 1325
568 nmdc:mga0qj67_349214_c1 3300050509 Bacteria 1196
569 nmdc:mga0qj67_44123_c1 3300050509 Bacteria 3512
570 nmdc:mga0qj67_60865_c1 3300050509 Unclassified 2997
571 nmdc:mga0qj67_6274_c1 3300050509 Bacteria 8722
572 nmdc:mga0qj67_6285_c1 3300050509 Bacteria 5865
573 nmdc:mga0qj67_662487_c1 3300050509 Bacteria 832
574 nmdc:mga06r32_1049569_c1 3300050510 Bacteria 766
575 nmdc:mga06r32_1534_c1 3300050510 Bacteria 20791
576 nmdc:mga06r32_188099_c1 3300050510 Bacteria 2052
577 nmdc:mga06r32_26051_c1 3300050510 Bacteria 5448
578 nmdc:mga06r32_3367_c1 3300050510 Bacteria 14308
579 nmdc:mga06r32_390940_c1 3300050510 Bacteria 1373
580 nmdc:mga06r32_421525_c1 3300050510 Unclassified 1316
581 nmdc:mga06r32_558919_c1 3300050510 Bacteria 1118
582 nmdc:mga06r32_598496_c1 3300050510 Bacteria 1074
583 nmdc:mga06r32_68963_c1 3300050510 Bacteria 3417
584 nmdc:mga06r32_73077_c1 3300050510 Bacteria 3321
585 nmdc:mga06r32_76991_c1 3300050510 Bacteria 3240
586 nmdc:mga08y16_10561_c1 3300050511 Bacteria 9692
587 nmdc:mga08y16_108415_c1 3300050511 Bacteria 2891
588 nmdc:mga08y16_12124_c1 3300050511 Bacteria 9058
589 nmdc:mga08y16_1635939_c1 3300050511 Bacteria 601
590 nmdc:mga08y16_166515_c1 3300050511 Bacteria 2290
591 nmdc:mga08y16_1944_c1 3300050511 Bacteria 21097
592 nmdc:mga08y16_2069_c1 3300050511 Bacteria 20567
593 nmdc:mga08y16_216920_c1 3300050511 Bacteria 1981
594 nmdc:mga08y16_231045_c1 3300050511 Bacteria 1913
595 nmdc:mga08y16_271769_c1 3300050511 Bacteria 1749
596 nmdc:mga08y16_279923_c1 3300050511 Bacteria 1721
597 nmdc:mga08y16_31041_c1 3300050511 Bacteria 5620
598 nmdc:mga08y16_356844_c1 3300050511 Bacteria 1501
599 nmdc:mga08y16_365833_c1 3300050511 Bacteria 1480
600 nmdc:mga08y16_46291_c1 3300050511 Bacteria 4554
601 nmdc:mga08y16_464583_c1 3300050511 Bacteria 1289
602 nmdc:mga08y16_873_c1 3300050511 Bacteria 29066
603 nmdc:mga0n895_111451_c1 3300050512 Bacteria 2752
604 nmdc:mga0n895_123609_c1 3300050512 Bacteria 2610
605 nmdc:mga0n895_18632_c1 3300050512 Bacteria 6428
606 nmdc:mga0n895_221354_c1 3300050512 Bacteria 1921
607 nmdc:mga0n895_25272_c1 3300050512 Bacteria 5610
608 nmdc:mga0n895_42832_c1 3300050512 Bacteria 4407
609 nmdc:mga0n895_98133_c1 3300050512 Bacteria 2936
610 nmdc:mga0rr50_16488_c1 3300050513 Bacteria 4910
611 nmdc:mga0rr50_19300_c1 3300050513 Bacteria 4598
612 nmdc:mga0rr50_242770_c1 3300050513 Unclassified 1493
613 nmdc:mga08x19_650032_c1 3300050514 Unclassified 748
614 nmdc:mga0a205_139952_c1 3300050515 Bacteria 2320
615 nmdc:mga0a205_296041_c1 3300050515 Bacteria 1492
616 nmdc:mga0a205_36349_c2 3300050515 Bacteria 3668
617 nmdc:mga0a205_7495_c1 3300050515 Bacteria 9882
618 nmdc:mga0a205_91268_c1 3300050515 Bacteria 2943
619 nmdc:mga0a205_965_c1 3300050515 Bacteria 23733
620 Ga0495601_0001649 3300053077 Bacteria 12322
621 Ga0495601_0094799 3300053077 Bacteria 1924
622 Ga0495601_0163900 3300053077 Bacteria 1453
623 Ga0495619_0003114 3300053085 Bacteria 10762
624 Ga0501084_0025178 3300054114 Bacteria 4965
625 Ga0501084_0027362 3300054114 Bacteria 4765
626 Ga0501084_0322630 3300054114 Bacteria 1304
627 Ga0501084_1716324 3300054114 Bacteria 525
628 Ga0590071_000663 3300059421 Bacteria 9747
629 Ga0590071_021532 3300059421 Unclassified 1520
630 Ga0590074_001880 3300059423 Bacteria 3423
631 Ga0590074_002274 3300059423 Bacteria 3154
632 Ga0590075_000197 3300059424 Bacteria 16743
633 Ga0590075_000533 3300059424 Bacteria 10278
634 Ga0590077_000118 3300059426 Bacteria 21266
635 Ga0590077_004436 3300059426 Bacteria 2881
636 Ga0590077_063422 3300059426 Bacteria 839
637 Ga0590077_121088 3300059426 Unclassified 619
638 Ga0501082_0050254 3300060353 Bacteria 3596
639 Ga0501082_0092785 3300060353 Bacteria 2608
640 Ga0501082_0107053 3300060353 Unclassified 2419
641 Ga0501082_0112825 3300060353 Bacteria 2354
642 Ga0501082_0338087 3300060353 Bacteria 1312
643 Ga0501082_0822101 3300060353 Bacteria 813
644 Ga0501082_0952993 3300060353 Unclassified 750
645 Ga0501082_1165354 3300060353 Unclassified 674
646 Ga0530510_0161553 3300061734 Bacteria 1657
647 Ga0501036_1432615
648 JGI24743J22301_10110166
649 JGI25406J46586_10000086
650 Ga0065715_10216942
651 Ga0065715_10350951
652 Ga0065715_10452191
653 Ga0070676_10144340
654 Ga0070690_100695184
655 Ga0070677_10370571
656 Ga0068869_100094031
657 Ga0068869_101241351
658 Ga0068868_101179690
659 Ga0070660_100274280
660 Ga0070691_10439192
661 Ga0070687_100444308
662 Ga0070661_101425249
663 Ga0070669_100489695
664 Ga0070675_102009963
665 Ga0070671_100120098
666 Ga0070673_100008992
667 Ga0070667_100799128
668 Ga0070701_10191467
669 Ga0070700_100212572
670 Ga0070678_100126617
671 Ga0070662_101116880
672 Ga0070681_10443492
673 Ga0070698_100348506
674 Ga0070684_100000002
675 Ga0070684_100012937
676 Ga0070697_101558173
677 Ga0070672_100133602
678 Ga0070672_100470320
679 Ga0070686_100070458
680 Ga0070695_101834286
681 Ga0070693_101170560
682 Ga0070665_100425906
683 Ga0070665_100576846
684 Ga0070704_100360082
685 Ga0070704_100686108
686 Ga0068855_100872763
687 Ga0070664_100189518
688 Ga0070664_101645910
689 Ga0068854_100392497
690 Ga0068854_100544888
691 Ga0068854_101561332
692 Ga0070702_100514571
693 Ga0068852_101150583
694 Ga0068859_100168034
695 Ga0068859_100660589
696 Ga0068864_101210924
697 Ga0068861_101585345
698 Ga0068861_101601279
699 Ga0068863_100139472
700 Ga0068858_100007829
701 Ga0068858_100944307
702 Ga0068858_100997305
703 Ga0068860_100163712
704 Ga0068860_100232268
705 Ga0068860_100328287
706 Ga0068862_100049562
707 Ga0068862_100499676
708 Ga0081455_10101876
709 Ga0081539_10000012
710 Ga0075364_10156693
711 Ga0075366_10386281
712 Ga0097621_100868894
713 Ga0097621_100956021
714 Ga0068871_101387574
715 Ga0075428_100000520
716 Ga0075428_100091613
717 Ga0075428_101733694
718 Ga0075430_100003461
719 Ga0075430_100322740
720 Ga0075430_100613535
721 Ga0075430_100726477
722 Ga0075431_100001758
723 Ga0075431_100334468
724 Ga0075431_100448281
725 Ga0075433_10004102
726 Ga0075433_10076901
727 Ga0075433_11237150
728 Ga0075434_100000255
729 Ga0075434_100016596
730 Ga0075434_100041749
731 Ga0075434_100089413
732 Ga0075429_100003784
733 Ga0075429_100110223
734 Ga0075429_100221357
735 Ga0097620_100168032
736 Ga0097620_100660608
737 Ga0097620_101058173
738 Ga0075435_100007181
739 Ga0075435_101160963
740 Ga0105240_10050602
741 Ga0105240_10260686
742 Ga0111539_10001401
743 Ga0111539_10001731
744 Ga0111539_10003547
745 Ga0111539_10010561
746 Ga0111539_10019636
747 Ga0111539_10026764
748 Ga0111539_10061493
749 Ga0111539_10108897
750 Ga0111539_10112414
751 Ga0111539_10148875
752 Ga0111539_10294682
753 Ga0111539_10483731
754 Ga0111539_13017932
755 Ga0105245_10102966
756 Ga0105245_11158076
757 Ga0105245_11404444
758 Ga0105245_11756347
759 Ga0105247_10141609
760 Ga0105247_11520209
761 Ga0114129_10001729
762 Ga0114129_10003143
763 Ga0114129_10016613
764 Ga0114129_10026062
765 Ga0114129_10027056
766 Ga0114129_10047132
767 Ga0114129_10094847
768 Ga0114129_10153125
769 Ga0114129_10211754
770 Ga0114129_10226921
771 Ga0114129_10239839
772 Ga0114129_10378534
773 Ga0114129_10824857
774 Ga0114129_11885184
775 Ga0105243_12308489
776 Ga0105241_10183629
777 Ga0105242_10015594
778 Ga0105242_12582981
779 Ga0105248_10018790
780 Ga0105248_10042223
781 Ga0105248_10059334
782 Ga0105248_10443122
783 Ga0105248_10582249
784 Ga0105248_10854395
785 Ga0105248_11485810
786 Ga0105237_10023143
787 Ga0105237_10662622
788 Ga0105237_12136782
789 Ga0105238_10097518
790 Ga0105249_10022138
791 Ga0105249_10049781
792 Ga0105249_10327727
793 Ga0105249_10686289
794 Ga0105249_10779945
795 Ga0105249_10844540
796 Ga0105249_10917984
797 Ga0105249_11168115
798 Ga0105249_11202959
799 Ga0105239_10440575
800 Ga0105239_10458773
801 Ga0105239_11972939
802 Ga0105246_10122875
803 Ga0105246_10959731
804 Ga0105246_12377911
805 Ga0157337_1027404
806 Ga0157313_1058842
807 Ga0157316_1037153
808 Ga0157373_11118768
809 Ga0157371_11462698
810 Ga0157370_11704397
811 Ga0157369_10279282
812 Ga0157374_10060347
813 Ga0157374_10202827
814 Ga0157374_11226477
815 Ga0157378_10212319
816 Ga0157378_10905404
817 Ga0157378_10949242
818 Ga0157378_11044101
819 Ga0157378_11712686
820 Ga0163162_10180764
821 Ga0157372_10218842
822 Ga0157372_10954405
823 Ga0157372_11986058
824 Ga0157372_12479163
825 Ga0157375_10217045
826 Ga0157375_11971880
827 Ga0157375_12471589
828 Ga0163163_10953911
829 Ga0163163_11207767
830 Ga0163163_11508786
831 Ga0157380_10007780
832 Ga0157380_10032908
833 Ga0157380_10053390
834 Ga0157380_10416620
835 Ga0157380_10624523
836 Ga0157380_11104808
837 Ga0157380_11114854
838 Ga0157380_12261015
839 Ga0157377_10009057
840 Ga0157377_10247743
841 Ga0157377_10822214
842 Ga0157379_10027898
843 Ga0157379_10099223
844 Ga0157376_10044899
845 Ga0157376_10304152
846 Ga0163161_11072404
847 Ga0206356_10629357
848 Ga0207682_10172251
849 Ga0207710_10180930
850 Ga0207688_10008248
851 Ga0207680_10871997
852 Ga0207645_10001823
853 Ga0207645_10020752
854 Ga0207645_10148047
855 Ga0207705_10178836
856 Ga0207654_10093133
857 Ga0207707_10138265
858 Ga0207695_10183396
859 Ga0207695_10647193
860 Ga0207660_10762235
861 Ga0207657_10398711
862 Ga0207657_11111299
863 Ga0207681_10073201
864 Ga0207681_10254762
865 Ga0207681_10556987
866 Ga0207650_10101826
867 Ga0207650_10139540
868 Ga0207659_11163410
869 Ga0207659_11344520
870 Ga0207659_11584384
871 Ga0207687_10223755
872 Ga0207644_10124840
873 Ga0207644_10742426
874 Ga0207690_10016713
875 Ga0207706_10012124
876 Ga0207706_10032614
877 Ga0207686_10522007
878 Ga0207670_10211874
879 Ga0207669_10182684
880 Ga0207669_10244538
881 Ga0207704_10396012
882 Ga0207691_10013561
883 Ga0207691_10182794
884 Ga0207711_10011726
885 Ga0207711_10771729
886 Ga0207689_10148649
887 Ga0207689_10156479
888 Ga0207661_10004527
889 Ga0207679_10786151
890 Ga0207667_11110241
891 Ga0207651_10008853
892 Ga0207651_10180087
893 Ga0207712_11591346
894 Ga0207640_10530649
895 Ga0207640_10585845
896 Ga0207658_10039509
897 Ga0207677_10351266
898 Ga0207703_10490171
899 Ga0207703_10814807
900 Ga0207703_11000518
901 Ga0207708_10061970
902 Ga0207641_10064629
903 Ga0207648_10036131
904 Ga0207648_12105740
905 Ga0207676_10035071
906 Ga0207676_10902305
907 Ga0207675_100137880
908 Ga0207683_10220069
909 Ga0207698_10075342
910 Ga0207698_10459762
911 Ga0207428_10000207
912 Ga0207428_10006871
913 Ga0207428_10031947
914 Ga0207428_10664958
915 Ga0268266_10516587
916 Ga0268266_11029159
917 Ga0268265_10057448
918 Ga0268265_11541830
919 Ga0268264_10700449
920 Ga0268264_10960016
921 Ga0265325_10161988
922 Ga0307413_10174123
923 Ga0307410_10096342
924 Ga0307407_10216383
925 Ga0307407_11185017
926 Ga0307407_11669130
927 Ga0307412_10254094
928 Ga0307409_101075045
929 Ga0307409_101604961
930 Ga0307414_10086639
931 Ga0307414_12227568
932 Ga0307411_10098496
933 Ga0307415_100009581
934 Ga0307415_101249337
935 Ga0373930_0105271
936 Ga0373940_0180193
937 Ga0373949_0015209
938 Ga0373952_0140144
939 Ga0373952_0158945
940 Ga0373936_0262161
941 Ga0373939_0043630
942 Ga0373939_0260480
943 Ga0373941_0211473
944 Ga0373945_0507717
945 Ga0373953_0401859
946 Ga0373954_0576229
947 Ga0373954_0664688
948 Ga0373956_0268874
949 Ga0373956_0395977
950 Ga0373946_0240021
951 Ga0373946_0411861
952 Ga0373946_0551381
953 Ga0373961_0051929
954 Ga0373931_0092677
955 Ga0373931_0096792
956 Ga0373931_0178932
957 Ga0373935_0052859
958 Ga0373933_0585103
959 Ga0373937_0179846
960 Ga0373937_0784197
961 Ga0373937_0825367
962 Ga0373937_1086070
963 Ga0373925_0667528
964 Ga0439453_0002116
965 Ga0439453_0024059
966 Ga0439453_0041466
967 Ga0451802_1138671
968 Ga0451853_2457291
969 Ga0439431_0028192
970 Ga0439433_0024752
971 Ga0439437_049715
972 Ga0439445_0113348
973 Ga0439449_0100527
974 Ga0439451_044180
975 Ga0450921_006295
976 Ga0450888_008092
977 Ga0450896_038753
978 Ga0439446_0015406
979 Ga0439446_0056385
980 Ga0450908_009700
981 Ga0439434_0050207
982 Ga0439435_0001661
983 Ga0439435_0011291
984 Ga0439435_0033974
985 Ga0439435_0058413
986 Ga0439435_0075869
987 Ga0439444_0083370
988 Ga0439464_0004391
989 Ga0439460_0097595
990 Ga0439460_0211963
991 Ga0439460_0263541
992 Ga0451577_0100834
993 Ga0451577_1746804
994 Ga0466966_0575060
995 Ga0453684_0061251
996 Ga0451576_0068009
997 Ga0466958_0106797
998 Ga0495592_0082611
999 Ga0495651_0011125
1000 Ga0495580_0069119
1001 Ga0495580_0079561
1002 Ga0495580_0359760
1003 Ga0495664_0044426
1004 Ga0495664_0123338
1005 Ga0495608_0002722
1006 Ga0495608_0761354
1007 Ga0495618_0064307
1008 Ga0495618_0440104
1009 Ga0495618_0752505
1010 Ga0495628_0078037
1011 Ga0495628_0098811
1012 Ga0495630_0007651
1013 Ga0495630_0930184
1014 Ga0495631_0473574
1015 Ga0495637_0279523
1016 Ga0495644_0204954
1017 Ga0495652_0060973
1018 Ga0495652_0062456
1019 Ga0495665_0188892
1020 Ga0495640_0106397
1021 Ga0495640_0718756
1022 Ga0495586_0139160
1023 Ga0495586_0233081
1024 Ga0495586_0532195
1025 Ga0495587_0074388
1026 Ga0495587_0180314
1027 Ga0495645_0191861
1028 Ga0495667_0041532
1029 Ga0495667_0120477
1030 Ga0495667_0165694
1031 Ga0495667_0383236
1032 Ga0495656_0039609
1033 Ga0495635_0340272
1034 Ga0495635_0521648
1035 Ga0495657_0213681
1036 Ga0495623_0030461
1037 Ga0495623_0221048
1038 Ga0495623_0347225
1039 Ga0495658_0054974
1040 Ga0495658_0840017
1041 Ga0495669_0003525
1042 Ga0495613_0008887
1043 Ga0495600_0023520
1044 Ga0495581_0216249
1045 Ga0495604_0038616
1046 Ga0495604_0103699
1047 Ga0495604_0804122
1048 Ga0495674_0010121
1049 Ga0495674_0112954
1050 Ga0495674_0116348
1051 Ga0495674_0273340
1052 Ga0495674_0291989
1053 Ga0495680_0032279
1054 Ga0495675_0005268
1055 Ga0495675_0280340
1056 Ga0495675_0304937
1057 Ga0495684_0000393
1058 Ga0495684_0005257
1059 Ga0495684_0220181
1060 Ga0495684_0277644
1061 Ga0495684_0875069
1062 Ga0495602_0004308
1063 Ga0495602_0581153
1064 Ga0495602_1132921
1065 Ga0496102_1253491
1066 Ga0496103_0825200
1067 Ga0496104_1500462
1068 Ga0496106_0150924
1069 Ga0496108_1569167
1070 Ga0496109_0252125
1071 Ga0496109_0622492
1072 Ga0496109_1595583
1073 Ga0496110_0283739
1074 Ga0496112_0579512
1075 Ga0496112_1642306
1076 Ga0496113_0054386
1077 Ga0496113_0207994
1078 Ga0496114_0099401
1079 Ga0501297_059878
1080 Ga0501031_0551832
1081 Ga0501033_0602737
1082 Ga0501034_0116392
1083 Ga0501034_0122890
1084 Ga0501036_0220130
1085 Ga0501036_0332469
1086 Ga0501036_1558454
1087 Ga0501038_0212258
1088 Ga0501038_0725124
1089 Ga0501039_0052221
1090 Ga0501039_0298559
1091 Ga0501040_0013992
1092 Ga0501041_0060247
1093 Ga0501041_0074182
1094 Ga0501041_0196236
1095 Ga0501041_0498846
1096 Ga0501042_0056209
1097 Ga0501042_0472608
1098 Ga0501042_0895863
1099 Ga0501043_0327685
1100 Ga0501043_0689866
1101 Ga0501046_0124438
1102 Ga0501046_0165199
1103 Ga0501046_0967574
1104 Ga0501047_0037052
1105 Ga0501047_0877292
1106 Ga0501048_0023664
1107 Ga0501048_0692576
1108 Ga0501067_0142683
1109 Ga0501067_0284184
1110 Ga0501067_0301131
1111 Ga0501067_0423585
1112 Ga0501068_0314715
1113 Ga0501069_0292150
1114 Ga0501071_0042593
1115 Ga0501071_0124934
1116 Ga0501071_0155895
1117 Ga0501071_0379934
1118 Ga0501071_0495447
1119 Ga0501072_0040218
1120 Ga0501072_0084985
1121 Ga0501072_0139365
1122 Ga0501072_0296699
1123 Ga0501072_0632001
1124 Ga0501072_0663100
1125 Ga0501073_0175210
1126 Ga0501073_0465494
1127 Ga0501073_0935243
1128 Ga0501074_0017193
1129 Ga0501074_0598900
1130 Ga0501075_0008705
1131 Ga0501075_0135462
1132 Ga0501075_0343100
1133 Ga0501075_1252286
1134 Ga0501076_0007531
1135 Ga0501076_0026016
1136 Ga0501076_0169150
1137 Ga0501076_0191797
1138 Ga0501076_1206519
1139 Ga0501077_0000316
1140 Ga0501077_0003848
1141 Ga0501077_0077427
1142 Ga0501077_0195838
1143 Ga0501077_0337330
1144 Ga0501077_0377446
1145 Ga0501077_0581126
1146 Ga0501206_054738
1147 Ga0501216_034864
1148 Ga0501223_085300
1149 Ga0501233_158713
1150 Ga0501221_242205
1151 Ga0501225_0216391
1152 Ga0501225_0238832
1153 Ga0501079_0063293
1154 Ga0501079_0108841
1155 Ga0501079_0256657
1156 Ga0501079_0292034
1157 Ga0501079_0415589
1158 Ga0501079_0936508
1159 Ga0501080_0012602
1160 Ga0501080_0064074
1161 Ga0501080_0091240
1162 Ga0501080_0117997
1163 Ga0501080_0411385
1164 Ga0501081_0022041
1165 Ga0501081_0194050
1166 Ga0501081_0351754
1167 Ga0501081_0518044
1168 Ga0501083_0144569
1169 Ga0501083_0162076
1170 Ga0501266_086431
1171 Ga0501273_003780
1172 Ga0501283_044717
1173 Ga0501035_0103766
1174 Ga0501044_1090851
1175 Ga0501045_0010007
1176 Ga0501045_0176457
1177 Ga0501045_0848798
1178 Ga0501204_063830
1179 Ga0501212_009493
1180 nmdc:mga03683_285936_c1
1181 nmdc:mga00v17_117229_c1
1182 nmdc:mga00v17_71216_c1
1183 nmdc:mga00v17_870858_c1
1184 nmdc:mga0yw44_57469_c1
1185 nmdc:mga0k408_40201_c1
1186 nmdc:mga0k408_920008_c1
1187 nmdc:mga05p37_1064428_c1
1188 nmdc:mga05p37_1811154_c1
1189 nmdc:mga05p37_1938_c1
1190 nmdc:mga05p37_2137_c1
1191 nmdc:mga05p37_21634_c1
1192 nmdc:mga05p37_285153_c1
1193 nmdc:mga05p37_28990_c1
1194 nmdc:mga05p37_340986_c1
1195 nmdc:mga05p37_376393_c1
1196 nmdc:mga05p37_40969_c1
1197 nmdc:mga05p37_41070_c1
1198 nmdc:mga05p37_450429_c1
1199 nmdc:mga05p37_591206_c1
1200 nmdc:mga05p37_83130_c1
1201 nmdc:mga09592_1318850_c1
1202 nmdc:mga09592_16200_c1
1203 nmdc:mga09592_1747221_c1
1204 nmdc:mga09592_23595_c1
1205 nmdc:mga09592_24389_c1
1206 nmdc:mga09592_246119_c1
1207 nmdc:mga09592_26148_c1
1208 nmdc:mga09592_529486_c1
1209 nmdc:mga0qj67_100554_c1
1210 nmdc:mga0qj67_15436_c1
1211 nmdc:mga0qj67_214819_c1
1212 nmdc:mga0qj67_2436_c1
1213 nmdc:mga0qj67_290307_c1
1214 nmdc:mga0qj67_349214_c1
1215 nmdc:mga0qj67_44123_c1
1216 nmdc:mga0qj67_60865_c1
1217 nmdc:mga0qj67_6274_c1
1218 nmdc:mga0qj67_6285_c1
1219 nmdc:mga0qj67_662487_c1
1220 nmdc:mga06r32_1049569_c1
1221 nmdc:mga06r32_1534_c1
1222 nmdc:mga06r32_188099_c1
1223 nmdc:mga06r32_26051_c1
1224 nmdc:mga06r32_3367_c1
1225 nmdc:mga06r32_390940_c1
1226 nmdc:mga06r32_421525_c1
1227 nmdc:mga06r32_558919_c1
1228 nmdc:mga06r32_598496_c1
1229 nmdc:mga06r32_68963_c1
1230 nmdc:mga06r32_73077_c1
1231 nmdc:mga06r32_76991_c1
1232 nmdc:mga08y16_10561_c1
1233 nmdc:mga08y16_108415_c1
1234 nmdc:mga08y16_12124_c1
1235 nmdc:mga08y16_1635939_c1
1236 nmdc:mga08y16_166515_c1
1237 nmdc:mga08y16_1944_c1
1238 nmdc:mga08y16_2069_c1
1239 nmdc:mga08y16_216920_c1
1240 nmdc:mga08y16_231045_c1
1241 nmdc:mga08y16_271769_c1
1242 nmdc:mga08y16_279923_c1
1243 nmdc:mga08y16_31041_c1
1244 nmdc:mga08y16_356844_c1
1245 nmdc:mga08y16_365833_c1
1246 nmdc:mga08y16_46291_c1
1247 nmdc:mga08y16_464583_c1
1248 nmdc:mga08y16_873_c1
1249 nmdc:mga0n895_111451_c1
1250 nmdc:mga0n895_123609_c1
1251 nmdc:mga0n895_18632_c1
1252 nmdc:mga0n895_221354_c1
1253 nmdc:mga0n895_25272_c1
1254 nmdc:mga0n895_42832_c1
1255 nmdc:mga0n895_98133_c1
1256 nmdc:mga0rr50_16488_c1
1257 nmdc:mga0rr50_19300_c1
1258 nmdc:mga0rr50_242770_c1
1259 nmdc:mga08x19_650032_c1
1260 nmdc:mga0a205_139952_c1
1261 nmdc:mga0a205_296041_c1
1262 nmdc:mga0a205_36349_c2
1263 nmdc:mga0a205_7495_c1
1264 nmdc:mga0a205_91268_c1
1265 nmdc:mga0a205_965_c1
1266 Ga0495601_0001649
1267 Ga0495601_0094799
1268 Ga0495601_0163900
1269 Ga0495619_0003114
1270 Ga0501084_0025178
1271 Ga0501084_0027362
1272 Ga0501084_0322630
1273 Ga0501084_1716324
1274 Ga0590071_000663
1275 Ga0590071_021532
1276 Ga0590074_001880
1277 Ga0590074_002274
1278 Ga0590075_000197
1279 Ga0590075_000533
1280 Ga0590077_000118
1281 Ga0590077_004436
1282 Ga0590077_063422
1283 Ga0590077_121088
1284 Ga0501082_0050254
1285 Ga0501082_0092785
1286 Ga0501082_0107053
1287 Ga0501082_0112825
1288 Ga0501082_0338087
1289 Ga0501082_0822101
1290 Ga0501082_0952993
1291 Ga0501082_1165354
1292 Ga0530510_0161553

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

8

123

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9134 11 73
7ne9-assembly1.cif.gz_DDD a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.8912 6 71
2l02-assembly1.cif.gz_A solution nmr structure of protein bt2368 from bacteroides thetaiotaomicron, northeast structural genomics consortium target btr375 0.8908 12 71
3bz6-assembly1.cif.gz_A crystal structure of a conserved protein of unknown function from pseudomonas syringae pv. tomato str. dc3000 0.888 8 72
1p6r-assembly1.cif.gz_A solution structure of the dna binding domain of the repressor blai. 0.8802 5 75
ID Description Score Start End Superfamily
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.962 9 71 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.956 8 70 1.10.10.10
1sd6A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9559 9 71 1.10.10.10
1sd4B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9542 11 71 1.10.10.10
2d45B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9447 9 71 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A5C8A1Q6-F1-model_v4 deleted 0.9431 6 95
AF-A0A352HCE1-F1-model_v4 deleted 0.9352 6 94
AF-A0A3M2BFY9-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9335 4 89 GO:0003677
GO:0045892
AF-A0A2M8ELZ4-F1-model_v4 CopY family transcriptional regulator 0.9331 3 76 GO:0003677
GO:0045892
AF-A0A6N9A374-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9312 1 78 GO:0003677
GO:0045892

Map