F472176

General Info

Members Datasets Scaffolds Average Seq Length
646 293 1292 237

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100027479|Ga0068869_1000274794
Length 255
Sequence MKFGVVVFPGSNCDHDAYHAAKDVLGQDAGFIWHKDTSLNGADVVVLPGGFAHGDYLRTGAIARFSPIMPAILEFARGGGPVIGICNGFQVLLEAGLLPGAMLRNRDLKFHCEQVFVRVEQTDTPFTVRASRGQRLKLPVAHGEGNYYAAPEVVRELEAARRVVFRYCDARGEATDAANPNGALNNIAGICNEARNVVGLMPHPERACEAALGSADGLVLFQSVVEKLSTRHPAYAGSSGGVSPKPTELRAGEGG

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
156 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
159 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
179 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
183 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
184 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
188 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
192 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
193 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
194 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
195 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
196 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
197 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
198 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
215 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
216 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
217 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
218 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
219 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
220 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
267 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
268 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
282 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
283 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
284 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
286 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
287 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
288 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
289 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
290 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
291 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
292 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
293 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.14
Metatranscriptomes 0.62
Isolates 1.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 4.64
Rhizosphere 93.96
Stem 0
Stem Tuber 0
Unclassified 0.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100027479 3300005334 Bacteria 3967
2 JGI24751J29686_10015939 3300002459 Bacteria 1550
3 JGI25406J46586_10001471 3300003203 Bacteria 11110
4 JGI25406J46586_10002007 3300003203 Bacteria 9614
5 Ga0065714_10097106 3300005288 Bacteria 1743
6 Ga0065712_10002461 3300005290 Bacteria 8710
7 Ga0065712_10002990 3300005290 Bacteria 5553
8 Ga0065712_10005524 3300005290 Bacteria 6792
9 Ga0065715_10000434 3300005293 Bacteria 20319
10 Ga0065715_10123611 3300005293 Bacteria 2166
11 Ga0065715_10449267 3300005293 Bacteria 828
12 Ga0065707_10017486 3300005295 Bacteria 2774
13 Ga0065707_10109542 3300005295 Bacteria 2465
14 Ga0065707_10179925 3300005295 Bacteria 1425
15 Ga0070676_10070800 3300005328 Bacteria 2093
16 Ga0070683_100558004 3300005329 Bacteria 1095
17 Ga0070683_100839264 3300005329 Bacteria 881
18 Ga0070690_100148796 3300005330 Bacteria 1596
19 Ga0070690_100208990 3300005330 Bacteria 1361
20 Ga0070690_100244118 3300005330 Bacteria 1267
21 Ga0070690_100271621 3300005330 Unclassified 1206
22 Ga0070670_100001473 3300005331 Bacteria 18961
23 Ga0070670_100003924 3300005331 Bacteria 12407
24 Ga0070670_100006859 3300005331 Bacteria 9651
25 Ga0070670_100008006 3300005331 Bacteria 8988
26 Ga0070670_100043598 3300005331 Bacteria 3856
27 Ga0070670_100364626 3300005331 Bacteria 1271
28 Ga0070677_10207166 3300005333 Bacteria 950
29 Ga0070677_10344439 3300005333 Bacteria 770
30 Ga0070666_10098281 3300005335 Bacteria 2015
31 Ga0070666_10210370 3300005335 Bacteria 1369
32 Ga0070682_100136774 3300005337 Bacteria 1665
33 Ga0068868_100069764 3300005338 Bacteria 2801
34 Ga0068868_100354302 3300005338 Bacteria 1258
35 Ga0070660_100341137 3300005339 Bacteria 1233
36 Ga0070689_100000437 3300005340 Bacteria 24596
37 Ga0070689_100054247 3300005340 Bacteria 3103
38 Ga0070689_100179620 3300005340 Bacteria 1718
39 Ga0070689_100465465 3300005340 Bacteria 1078
40 Ga0070687_100120151 3300005343 Bacteria 1502
41 Ga0070687_100173089 3300005343 Bacteria 1287
42 Ga0070661_100201476 3300005344 Bacteria 1521
43 Ga0070669_100010029 3300005353 Bacteria 6734
44 Ga0070669_100075626 3300005353 Bacteria 2498
45 Ga0070669_100442111 3300005353 Bacteria 1070
46 Ga0070675_100005737 3300005354 Bacteria 9497
47 Ga0070675_100187998 3300005354 Bacteria 1788
48 Ga0070675_100213816 3300005354 Bacteria 1677
49 Ga0070671_100018425 3300005355 Bacteria 5670
50 Ga0070671_100059240 3300005355 Bacteria 3187
51 Ga0070671_100116914 3300005355 Bacteria 2242
52 Ga0070671_100157052 3300005355 Bacteria 1922
53 Ga0070671_100323508 3300005355 Bacteria 1314
54 Ga0070671_100439063 3300005355 Bacteria 1119
55 Ga0070674_100071410 3300005356 Bacteria 2455
56 Ga0070674_100185254 3300005356 Bacteria 1597
57 Ga0070674_100635192 3300005356 Bacteria 906
58 Ga0070673_100000574 3300005364 Bacteria 19910
59 Ga0070673_100033605 3300005364 Bacteria 3875
60 Ga0070673_100108483 3300005364 Bacteria 2299
61 Ga0070688_100002629 3300005365 Bacteria 9108
62 Ga0070688_100012057 3300005365 Bacteria 4828
63 Ga0070688_100074911 3300005365 Bacteria 2175
64 Ga0070659_100096069 3300005366 Bacteria 2381
65 Ga0070667_100023919 3300005367 Bacteria 5073
66 Ga0070667_100256522 3300005367 Bacteria 1564
67 Ga0070667_100299922 3300005367 Bacteria 1447
68 Ga0070714_100003779 3300005435 Bacteria 11354
69 Ga0070701_10002431 3300005438 Bacteria 7180
70 Ga0070701_10025693 3300005438 Bacteria 2863
71 Ga0070701_10205423 3300005438 Bacteria 1167
72 Ga0070705_100041716 3300005440 Bacteria 2618
73 Ga0070700_100000177 3300005441 Bacteria 36034
74 Ga0070694_100000140 3300005444 Bacteria 36469
75 Ga0070694_100023892 3300005444 Bacteria 3938
76 Ga0070694_100612919 3300005444 Bacteria 878
77 Ga0070663_100445092 3300005455 Bacteria 1067
78 Ga0070663_100661283 3300005455 Bacteria 885
79 Ga0070678_100130968 3300005456 Bacteria 1993
80 Ga0070678_100216891 3300005456 Bacteria 1588
81 Ga0070662_100079475 3300005457 Bacteria 2439
82 Ga0070662_100081160 3300005457 Bacteria 2415
83 Ga0070662_100227476 3300005457 Bacteria 1491
84 Ga0070662_100278251 3300005457 Bacteria 1354
85 Ga0070681_10009781 3300005458 Bacteria 9436
86 Ga0070681_10200838 3300005458 Bacteria 1912
87 Ga0070681_10544659 3300005458 Bacteria 1074
88 Ga0068867_100011071 3300005459 Bacteria 6363
89 Ga0068867_100660065 3300005459 Bacteria 918
90 Ga0070685_10000196 3300005466 Bacteria 40614
91 Ga0070685_10016066 3300005466 Bacteria 3982
92 Ga0070685_10047821 3300005466 Bacteria 2462
93 Ga0070685_10220193 3300005466 Bacteria 1243
94 Ga0070706_100119217 3300005467 Bacteria 2459
95 Ga0070706_100535922 3300005467 Bacteria 1089
96 Ga0070707_100000248 3300005468 Bacteria 53897
97 Ga0070707_100000974 3300005468 Bacteria 28298
98 Ga0070707_100296915 3300005468 Bacteria 1570
99 Ga0070707_100681088 3300005468 Bacteria 991
100 Ga0070698_100148109 3300005471 Bacteria 2296
101 Ga0070698_100208233 3300005471 Bacteria 1891
102 Ga0070698_100989498 3300005471 Bacteria 788
103 Ga0070699_100083371 3300005518 Bacteria 2788
104 Ga0070699_100145365 3300005518 Bacteria 2095
105 Ga0070699_100238787 3300005518 Bacteria 1621
106 Ga0070679_100128287 3300005530 Bacteria 2518
107 Ga0070679_100199295 3300005530 Bacteria 1969
108 Ga0070679_100591390 3300005530 Bacteria 1053
109 Ga0070697_100000685 3300005536 Bacteria 25463
110 Ga0070697_100048851 3300005536 Bacteria 3432
111 Ga0070697_100061543 3300005536 Bacteria 3062
112 Ga0068853_100339756 3300005539 Unclassified 1395
113 Ga0070672_100003190 3300005543 Bacteria 10614
114 Ga0070672_100005451 3300005543 Bacteria 8433
115 Ga0070672_100011165 3300005543 Bacteria 6256
116 Ga0070672_100047492 3300005543 Bacteria 3332
117 Ga0070672_100208061 3300005543 Bacteria 1638
118 Ga0070672_100399352 3300005543 Bacteria 1178
119 Ga0070686_100001284 3300005544 Bacteria 14204
120 Ga0070686_100031399 3300005544 Bacteria 3247
121 Ga0070686_100083442 3300005544 Bacteria 2121
122 Ga0070686_100171325 3300005544 Bacteria 1535
123 Ga0070686_100248760 3300005544 Bacteria 1297
124 Ga0070695_100012920 3300005545 Bacteria 5013
125 Ga0070695_100137519 3300005545 Bacteria 1690
126 Ga0070696_100132072 3300005546 Bacteria 1817
127 Ga0070696_100150879 3300005546 Bacteria 1706
128 Ga0070693_100009755 3300005547 Bacteria 4784
129 Ga0070665_100009603 3300005548 Bacteria 9786
130 Ga0070665_100070161 3300005548 Bacteria 3511
131 Ga0070704_100072576 3300005549 Bacteria 2504
132 Ga0070704_100096096 3300005549 Bacteria 2220
133 Ga0070704_100123646 3300005549 Bacteria 1992
134 Ga0070704_100538641 3300005549 Bacteria 1018
135 Ga0068854_100061814 3300005578 Bacteria 2713
136 Ga0068859_100012868 3300005617 Bacteria 8405
137 Ga0068859_100024063 3300005617 Bacteria 6111
138 Ga0068859_100051062 3300005617 Bacteria 4156
139 Ga0068859_100078660 3300005617 Bacteria 3338
140 Ga0068859_100133290 3300005617 Bacteria 2556
141 Ga0068859_100383982 3300005617 Bacteria 1500
142 Ga0068859_100517597 3300005617 Bacteria 1288
143 Ga0068859_100576188 3300005617 Bacteria 1219
144 Ga0068864_100005408 3300005618 Bacteria 10467
145 Ga0068864_100106531 3300005618 Bacteria 2493
146 Ga0068864_100129083 3300005618 Bacteria 2269
147 Ga0068864_101463228 3300005618 Bacteria 686
148 Ga0068866_10109465 3300005718 Bacteria 1539
149 Ga0068866_10282959 3300005718 Unclassified 1028
150 Ga0068861_100078249 3300005719 Bacteria 2582
151 Ga0068861_100080234 3300005719 Bacteria 2552
152 Ga0068861_100244820 3300005719 Bacteria 1527
153 Ga0068861_100694148 3300005719 Bacteria 945
154 Ga0068870_10021099 3300005840 Bacteria 3182
155 Ga0068870_10094432 3300005840 Bacteria 1679
156 Ga0068863_100012058 3300005841 Bacteria 8350
157 Ga0068863_100034457 3300005841 Bacteria 4822
158 Ga0068863_100422046 3300005841 Bacteria 1307
159 Ga0068858_100155748 3300005842 Bacteria 2150
160 Ga0068860_100081728 3300005843 Bacteria 3072
161 Ga0068862_100019590 3300005844 Bacteria 5649
162 Ga0068862_100174365 3300005844 Bacteria 1927
163 Ga0068862_100276023 3300005844 Bacteria 1539
164 Ga0068862_100279510 3300005844 Bacteria 1529
165 Ga0068862_100394196 3300005844 Bacteria 1294
166 Ga0081539_10000036 3300005985 Bacteria 296724
167 Ga0081539_10001709 3300005985 Bacteria 35282
168 Ga0075365_10105272 3300006038 Bacteria 1935
169 Ga0097621_100038735 3300006237 Bacteria 3825
170 Ga0097621_100339434 3300006237 Bacteria 1334
171 Ga0068871_100008150 3300006358 Bacteria 7526
172 Ga0068871_100024422 3300006358 Bacteria 4687
173 Ga0068871_100047330 3300006358 Bacteria 3468
174 Ga0068871_100355859 3300006358 Bacteria 1296
175 Ga0075428_100002598 3300006844 Bacteria 19633
176 Ga0075428_100015286 3300006844 Bacteria 8513
177 Ga0075428_100332025 3300006844 Bacteria 1633
178 Ga0075428_100347972 3300006844 Bacteria 1591
179 Ga0075428_100674738 3300006844 Bacteria 1101
180 Ga0075430_100000555 3300006846 Bacteria 28350
181 Ga0075430_100003348 3300006846 Bacteria 13425
182 Ga0075430_100048406 3300006846 Bacteria 3589
183 Ga0075430_100737607 3300006846 Bacteria 812
184 Ga0075431_100003947 3300006847 Bacteria 14445
185 Ga0075431_100004122 3300006847 Bacteria 14189
186 Ga0075431_100052357 3300006847 Bacteria 4210
187 Ga0075431_100196753 3300006847 Bacteria 2063
188 Ga0075431_100255945 3300006847 Bacteria 1778
189 Ga0075433_10242773 3300006852 Bacteria 1599
190 Ga0075434_100003240 3300006871 Bacteria 14532
191 Ga0075434_100307655 3300006871 Bacteria 1605
192 Ga0075429_100052335 3300006880 Bacteria 3552
193 Ga0075429_100089812 3300006880 Bacteria 2679
194 Ga0075429_100094658 3300006880 Bacteria 2605
195 Ga0068865_100314422 3300006881 Bacteria 1258
196 Ga0097620_100012868 3300006931 Bacteria 8405
197 Ga0097620_100024065 3300006931 Bacteria 6111
198 Ga0097620_100051063 3300006931 Bacteria 4156
199 Ga0097620_100078669 3300006931 Bacteria 3338
200 Ga0097620_100133293 3300006931 Bacteria 2556
201 Ga0097620_100383997 3300006931 Bacteria 1500
202 Ga0097620_100517662 3300006931 Bacteria 1288
203 Ga0097620_100576226 3300006931 Bacteria 1219
204 Ga0075435_100000860 3300007076 Bacteria 19005
205 Ga0075435_100232879 3300007076 Bacteria 1565
206 Ga0075435_100241391 3300007076 Bacteria 1537
207 Ga0099794_10008104 3300007265 Bacteria 4351
208 Ga0099794_10274454 3300007265 Bacteria 871
209 Ga0111539_10000080 3300009094 Bacteria 97114
210 Ga0111539_10004136 3300009094 Bacteria 19038
211 Ga0111539_10037680 3300009094 Bacteria 5838
212 Ga0111539_10124167 3300009094 Bacteria 3025
213 Ga0111539_10342699 3300009094 Bacteria 1740
214 Ga0111539_10677739 3300009094 Bacteria 1200
215 Ga0111539_10936317 3300009094 Bacteria 1007
216 Ga0105245_10151598 3300009098 Bacteria 2193
217 Ga0105245_10342194 3300009098 Bacteria 1480
218 Ga0114129_10006904 3300009147 Bacteria 16150
219 Ga0114129_10007819 3300009147 Bacteria 15211
220 Ga0114129_10041757 3300009147 Bacteria 6459
221 Ga0114129_10046114 3300009147 Bacteria 6126
222 Ga0114129_10118835 3300009147 Bacteria 3641
223 Ga0114129_10182255 3300009147 Bacteria 2857
224 Ga0114129_10310751 3300009147 Bacteria 2098
225 Ga0114129_10546891 3300009147 Bacteria 1506
226 Ga0105241_10272932 3300009174 Bacteria 1441
227 Ga0105242_10158160 3300009176 Bacteria 1981
228 Ga0105248_10020842 3300009177 Bacteria 7262
229 Ga0105248_10175229 3300009177 Bacteria 2418
230 Ga0105248_10197023 3300009177 Bacteria 2270
231 Ga0105248_10371105 3300009177 Bacteria 1611
232 Ga0105248_10702674 3300009177 Bacteria 1141
233 Ga0105238_10307295 3300009551 Bacteria 1570
234 Ga0105249_10048602 3300009553 Bacteria 3867
235 Ga0105249_10433028 3300009553 Bacteria 1351
236 Ga0105249_10842583 3300009553 Bacteria 982
237 Ga0099796_10005901 3300010159 Bacteria 3093
238 Ga0105239_10163867 3300010375 Bacteria 2485
239 Ga0105239_10184742 3300010375 Bacteria 2333
240 Ga0157374_10204336 3300013296 Bacteria 1935
241 Ga0157374_10349754 3300013296 Bacteria 1468
242 Ga0157378_10001644 3300013297 Bacteria 20211
243 Ga0157378_10008843 3300013297 Bacteria 8761
244 Ga0157378_10108500 3300013297 Bacteria 2542
245 Ga0157378_10342365 3300013297 Bacteria 1458
246 Ga0157378_10348390 3300013297 Bacteria 1446
247 Ga0163162_10042153 3300013306 Bacteria 4567
248 Ga0163162_10184812 3300013306 Bacteria 2211
249 Ga0163162_10676915 3300013306 Bacteria 1154
250 Ga0157372_10671573 3300013307 Bacteria 1206
251 Ga0157375_10003989 3300013308 Bacteria 12801
252 Ga0157375_10058912 3300013308 Bacteria 3802
253 Ga0157375_10376384 3300013308 Bacteria 1586
254 Ga0157375_10606174 3300013308 Bacteria 1254
255 Ga0163163_10101493 3300014325 Bacteria 2899
256 Ga0163163_10203101 3300014325 Bacteria 2030
257 Ga0163163_10227266 3300014325 Bacteria 1915
258 Ga0163163_10285368 3300014325 Bacteria 1703
259 Ga0157380_10012490 3300014326 Bacteria 6162
260 Ga0157380_10699683 3300014326 Bacteria 1018
261 Ga0157377_10059590 3300014745 Bacteria 2176
262 Ga0157377_10162394 3300014745 Bacteria 1390
263 Ga0157377_10188536 3300014745 Bacteria 1302
264 Ga0157379_10012034 3300014968 Bacteria 7558
265 Ga0157379_10089793 3300014968 Bacteria 2757
266 Ga0157376_10188046 3300014969 Bacteria 1892
267 Ga0157376_10189400 3300014969 Bacteria 1886
268 Ga0157376_10438620 3300014969 Bacteria 1271
269 Ga0163161_10677285 3300017792 Bacteria 857
270 Ga0213876_10072449 3300021384 Bacteria 1820
271 Ga0207697_10027334 3300025315 Bacteria 2333
272 Ga0207682_10003373 3300025893 Bacteria 6952
273 Ga0207688_10008079 3300025901 Bacteria 5723
274 Ga0207688_10032104 3300025901 Bacteria 2901
275 Ga0207680_10050811 3300025903 Bacteria 2476
276 Ga0207680_10243321 3300025903 Bacteria 1240
277 Ga0207645_10105107 3300025907 Bacteria 1824
278 Ga0207645_10123140 3300025907 Bacteria 1684
279 Ga0207643_10013740 3300025908 Bacteria 4392
280 Ga0207643_10140383 3300025908 Bacteria 1443
281 Ga0207707_10006579 3300025912 Bacteria 10140
282 Ga0207707_10275846 3300025912 Bacteria 1457
283 Ga0207707_10402503 3300025912 Bacteria 1175
284 Ga0207707_10686232 3300025912 Bacteria 861
285 Ga0207660_10334812 3300025917 Bacteria 1211
286 Ga0207662_10008161 3300025918 Bacteria 5725
287 Ga0207662_10052546 3300025918 Bacteria 2425
288 Ga0207649_10185577 3300025920 Bacteria 1459
289 Ga0207649_10257594 3300025920 Bacteria 1259
290 Ga0207652_10083730 3300025921 Bacteria 2793
291 Ga0207646_10000467 3300025922 Bacteria 53945
292 Ga0207646_10001529 3300025922 Bacteria 28312
293 Ga0207646_10147430 3300025922 Bacteria 2121
294 Ga0207646_10387767 3300025922 Bacteria 1262
295 Ga0207681_10006478 3300025923 Bacteria 7189
296 Ga0207681_10056150 3300025923 Bacteria 2685
297 Ga0207681_10159611 3300025923 Bacteria 1698
298 Ga0207681_10181843 3300025923 Bacteria 1602
299 Ga0207681_10370404 3300025923 Bacteria 1151
300 Ga0207681_10370665 3300025923 Bacteria 1150
301 Ga0207681_10460427 3300025923 Bacteria 1036
302 Ga0207650_10006807 3300025925 Bacteria 7796
303 Ga0207650_10015259 3300025925 Bacteria 5347
304 Ga0207650_10085474 3300025925 Bacteria 2400
305 Ga0207650_10251601 3300025925 Bacteria 1431
306 Ga0207659_10083350 3300025926 Bacteria 2370
307 Ga0207659_10092045 3300025926 Bacteria 2266
308 Ga0207659_10242331 3300025926 Bacteria 1459
309 Ga0207687_10386270 3300025927 Bacteria 1148
310 Ga0207664_10194206 3300025929 Bacteria 1749
311 Ga0207644_10033979 3300025931 Bacteria 3568
312 Ga0207644_10047341 3300025931 Bacteria 3068
313 Ga0207644_10222991 3300025931 Bacteria 1495
314 Ga0207644_10245296 3300025931 Bacteria 1427
315 Ga0207690_10077663 3300025932 Bacteria 2308
316 Ga0207690_10645111 3300025932 Bacteria 867
317 Ga0207706_10025718 3300025933 Bacteria 5273
318 Ga0207706_10029241 3300025933 Bacteria 4920
319 Ga0207706_10327483 3300025933 Bacteria 1333
320 Ga0207686_10146024 3300025934 Bacteria 1641
321 Ga0207709_10659836 3300025935 Bacteria 833
322 Ga0207670_10000451 3300025936 Bacteria 22993
323 Ga0207670_10072751 3300025936 Bacteria 2381
324 Ga0207670_10503138 3300025936 Bacteria 984
325 Ga0207669_10001451 3300025937 Bacteria 10094
326 Ga0207704_10016957 3300025938 Bacteria 3761
327 Ga0207704_10192396 3300025938 Bacteria 1485
328 Ga0207704_10455854 3300025938 Bacteria 1021
329 Ga0207691_10001551 3300025940 Bacteria 22802
330 Ga0207691_10003109 3300025940 Bacteria 16204
331 Ga0207691_10010808 3300025940 Bacteria 8762
332 Ga0207691_10011560 3300025940 Bacteria 8476
333 Ga0207691_10127964 3300025940 Bacteria 2246
334 Ga0207691_10410713 3300025940 Bacteria 1154
335 Ga0207711_10006333 3300025941 Bacteria 9981
336 Ga0207711_10017888 3300025941 Bacteria 5889
337 Ga0207711_10027501 3300025941 Bacteria 4777
338 Ga0207711_10441183 3300025941 Bacteria 1211
339 Ga0207711_10557419 3300025941 Bacteria 1069
340 Ga0207689_10003976 3300025942 Bacteria 13446
341 Ga0207689_10022461 3300025942 Bacteria 5305
342 Ga0207689_10025721 3300025942 Bacteria 4931
343 Ga0207689_10147243 3300025942 Bacteria 1940
344 Ga0207689_10370518 3300025942 Bacteria 1192
345 Ga0207661_10092878 3300025944 Bacteria 2517
346 Ga0207679_10057175 3300025945 Bacteria 2884
347 Ga0207651_10000075 3300025960 Bacteria 45705
348 Ga0207651_10004848 3300025960 Bacteria 6853
349 Ga0207651_10047318 3300025960 Bacteria 2899
350 Ga0207668_10413847 3300025972 Bacteria 1143
351 Ga0207658_10088214 3300025986 Bacteria 2397
352 Ga0207658_10105846 3300025986 Bacteria 2213
353 Ga0207677_10047268 3300026023 Bacteria 2888
354 Ga0207677_10913317 3300026023 Bacteria 792
355 Ga0207703_10467421 3300026035 Bacteria 1180
356 Ga0207703_10649824 3300026035 Bacteria 1000
357 Ga0207703_10867660 3300026035 Bacteria 863
358 Ga0207639_10127674 3300026041 Bacteria 2100
359 Ga0207639_10470761 3300026041 Unclassified 1144
360 Ga0207678_10609189 3300026067 Bacteria 958
361 Ga0207678_10651586 3300026067 Bacteria 925
362 Ga0207708_10000302 3300026075 Bacteria 38834
363 Ga0207708_10667621 3300026075 Bacteria 886
364 Ga0207641_10003438 3300026088 Bacteria 14020
365 Ga0207641_10090870 3300026088 Bacteria 2671
366 Ga0207641_10419325 3300026088 Bacteria 1288
367 Ga0207641_10612821 3300026088 Bacteria 1067
368 Ga0207648_10002965 3300026089 Bacteria 17936
369 Ga0207648_10472442 3300026089 Bacteria 1144
370 Ga0207676_10004184 3300026095 Bacteria 10198
371 Ga0207676_10015097 3300026095 Bacteria 5570
372 Ga0207676_10126619 3300026095 Bacteria 2164
373 Ga0207676_10225866 3300026095 Bacteria 1671
374 Ga0207674_10048160 3300026116 Bacteria 4364
375 Ga0207674_10210333 3300026116 Bacteria 1894
376 Ga0207675_100015896 3300026118 Bacteria 7019
377 Ga0207675_100104933 3300026118 Bacteria 2664
378 Ga0207675_100289545 3300026118 Bacteria 1593
379 Ga0207675_100378641 3300026118 Bacteria 1391
380 Ga0207675_100491996 3300026118 Bacteria 1220
381 Ga0207683_10007061 3300026121 Bacteria 9632
382 Ga0207683_10080519 3300026121 Bacteria 2890
383 Ga0207683_10203906 3300026121 Bacteria 1798
384 Ga0207683_10305836 3300026121 Bacteria 1455
385 Ga0207683_10483010 3300026121 Bacteria 1143
386 Ga0209971_1000855 3300027682 Bacteria 7845
387 Ga0209971_1036399 3300027682 Bacteria 1184
388 Ga0209974_10087498 3300027876 Bacteria 1078
389 Ga0207428_10002587 3300027907 Bacteria 18063
390 Ga0207428_10022861 3300027907 Bacteria 5270
391 Ga0207428_10068365 3300027907 Bacteria 2794
392 Ga0265354_1001938 3300028016 Bacteria 2745
393 Ga0268266_10028691 3300028379 Bacteria 4730
394 Ga0268265_10085399 3300028380 Bacteria 2505
395 Ga0268265_10409905 3300028380 Bacteria 1255
396 Ga0268265_10630942 3300028380 Bacteria 1028
397 Ga0268264_10506007 3300028381 Bacteria 1179
398 Ga0268264_11191742 3300028381 Bacteria 771
399 Ga0265318_10014243 3300028577 Bacteria 3343
400 Ga0265338_10012496 3300028800 Bacteria 9676
401 Ga0265770_1000229 3300030878 Bacteria 7407
402 Ga0265765_1001105 3300030879 Bacteria 2407
403 Ga0265760_10000035 3300031090 Bacteria 46672
404 Ga0265760_10029985 3300031090 Bacteria 1600
405 Ga0265330_10099857 3300031235 Bacteria 1243
406 Ga0265328_10097613 3300031239 Bacteria 1087
407 Ga0265325_10060702 3300031241 Bacteria 1920
408 Ga0265339_10147222 3300031249 Bacteria 1194
409 Ga0265331_10034353 3300031250 Bacteria 2502
410 Ga0307408_100009611 3300031548 Bacteria 6380
411 Ga0265313_10017623 3300031595 Bacteria 4047
412 Ga0265342_10192300 3300031712 Bacteria 1113
413 Ga0316576_10009255 3300031727 Bacteria 6348
414 Ga0307405_10003959 3300031731 Bacteria 6931
415 Ga0307405_10005720 3300031731 Bacteria 6035
416 Ga0307405_10062116 3300031731 Bacteria 2364
417 Ga0316577_10033922 3300031733 Bacteria 2852
418 Ga0316577_10242819 3300031733 Bacteria 1019
419 Ga0307413_10089025 3300031824 Bacteria 2004
420 Ga0307410_10010016 3300031852 Bacteria 5348
421 Ga0307410_10017422 3300031852 Bacteria 4314
422 Ga0307410_10092779 3300031852 Bacteria 2147
423 Ga0307410_10213551 3300031852 Bacteria 1480
424 Ga0307406_10018478 3300031901 Bacteria 4074
425 Ga0307406_10088195 3300031901 Bacteria 2081
426 Ga0307406_10444071 3300031901 Bacteria 1039
427 Ga0307407_10001846 3300031903 Bacteria 7963
428 Ga0307407_10074348 3300031903 Bacteria 2033
429 Ga0307407_10388330 3300031903 Bacteria 998
430 Ga0307412_10013538 3300031911 Bacteria 4786
431 Ga0307412_10055314 3300031911 Bacteria 2639
432 Ga0307409_100006718 3300031995 Bacteria 6804
433 Ga0307409_100012319 3300031995 Bacteria 5445
434 Ga0307409_100018275 3300031995 Bacteria 4707
435 Ga0307416_100002667 3300032002 Bacteria 10333
436 Ga0307416_100182064 3300032002 Bacteria 1970
437 Ga0307416_100707149 3300032002 Bacteria 1097
438 Ga0307416_101223494 3300032002 Bacteria 857
439 Ga0307414_10087863 3300032004 Bacteria 2299
440 Ga0307414_10121747 3300032004 Bacteria 2007
441 Ga0307411_10005555 3300032005 Bacteria 6207
442 Ga0307411_10038485 3300032005 Bacteria 3017
443 Ga0307411_10340295 3300032005 Bacteria 1219
444 Ga0307415_100001325 3300032126 Bacteria 11725
445 Ga0373934_0002735 3300035086 Bacteria 6474
446 Ga0373936_0242229 3300035113 Bacteria 804
447 Ga0373941_0032794 3300035115 Bacteria 1557
448 Ga0373941_0200025 3300035115 Bacteria 759
449 Ga0373945_0056567 3300035116 Bacteria 1455
450 Ga0373956_0107589 3300035119 Bacteria 1297
451 Ga0373955_0001586 3300035172 Bacteria 9724
452 Ga0373955_0060909 3300035172 Bacteria 2083
453 Ga0373942_0185781 3300035207 Bacteria 683
454 Ga0373962_0054679 3300035242 Bacteria 1158
455 Ga0316574_0131271 3300035398 Bacteria 1612
456 Ga0373933_0449497 3300035724 Bacteria 843
457 Ga0373937_0085236 3300036401 Bacteria 2924
458 Ga0373937_1035824 3300036401 Bacteria 769
459 Ga0316582_0114215 3300036647 Bacteria 1801
460 Ga0316582_0148218 3300036647 Bacteria 1585
461 Ga0316584_0108805 3300036712 Bacteria 2074
462 Ga0373925_0013048 3300037068 Bacteria 6016
463 Ga0373925_0182437 3300037068 Bacteria 1662
464 Ga0373925_0580425 3300037068 Bacteria 923
465 Ga0436365_0407055 3300039437 Bacteria 1335
466 Ga0436362_0329212 3300039453 Bacteria 1449
467 Ga0451853_2476465 3300041512 Bacteria 904
468 Ga0439442_049801 3300042002 Bacteria 883
469 Ga0450923_025131 3300042125 Bacteria 1186
470 Ga0450896_007862 3300042133 Bacteria 1473
471 Ga0439446_0139559 3300042156 Bacteria 791
472 Ga0439435_0030119 3300042436 Bacteria 1469
473 Ga0439464_0129684 3300042439 Bacteria 780
474 Ga0451577_0074364 3300042876 Bacteria 3030
475 Ga0451577_0998371 3300042876 Bacteria 752
476 Ga0453683_0014106 3300044673 Bacteria 5195
477 Ga0453683_0167670 3300044673 Bacteria 1391
478 Ga0453683_0562169 3300044673 Unclassified 742
479 Ga0453684_0006151 3300044712 Bacteria 23093
480 Ga0451576_0510111 3300045051 Bacteria 1263
481 Ga0495629_0000010 3300046459 Bacteria 340114
482 Ga0495653_0057593 3300046463 Bacteria 2957
483 Ga0495580_0117304 3300046472 Bacteria 1848
484 Ga0495580_0233640 3300046472 Bacteria 1262
485 Ga0495639_0010397 3300046475 Bacteria 4008
486 Ga0495639_0123406 3300046475 Bacteria 1236
487 Ga0495639_0198321 3300046475 Bacteria 982
488 Ga0495664_0380128 3300046477 Bacteria 849
489 Ga0495594_0162497 3300046499 Bacteria 1269
490 Ga0495630_0364870 3300046517 Bacteria 1106
491 Ga0495663_0044813 3300046525 Bacteria 1355
492 Ga0495666_0003357 3300046526 Bacteria 8078
493 Ga0495666_0165486 3300046526 Bacteria 1024
494 Ga0495586_0003270 3300046535 Bacteria 8704
495 Ga0495586_0402494 3300046535 Bacteria 788
496 Ga0495587_0011252 3300046536 Bacteria 5673
497 Ga0495598_0028469 3300046537 Bacteria 1550
498 Ga0495609_0116196 3300046538 Bacteria 1152
499 Ga0495621_0087588 3300046539 Bacteria 1169
500 Ga0495622_0022829 3300046557 Bacteria 2916
501 Ga0495633_0012990 3300046558 Bacteria 4405
502 Ga0495635_0037355 3300046663 Bacteria 3362
503 Ga0495635_0105538 3300046663 Bacteria 1925
504 Ga0495635_0124306 3300046663 Bacteria 1759
505 Ga0495635_0520642 3300046663 Bacteria 782
506 Ga0495659_0002111 3300046664 Bacteria 6485
507 Ga0495657_0138153 3300046675 Bacteria 1521
508 Ga0495657_0181572 3300046675 Bacteria 1291
509 Ga0495623_0062630 3300046679 Bacteria 2331
510 Ga0495658_0078342 3300046683 Bacteria 1934
511 Ga0495658_0144322 3300046683 Bacteria 1458
512 Ga0495669_0035323 3300046684 Bacteria 2206
513 Ga0495670_0065945 3300046691 Bacteria 1826
514 Ga0495581_0036649 3300047315 Bacteria 2838
515 Ga0495604_0001510 3300047317 Bacteria 19142
516 Ga0495674_0285921 3300047319 Bacteria 1350
517 Ga0495680_0041872 3300047322 Bacteria 3637
518 Ga0495684_0089768 3300047471 Bacteria 2328
519 Ga0495684_0221814 3300047471 Bacteria 1386
520 Ga0496100_0905757 3300048903 Bacteria 693
521 Ga0496101_0263586 3300048904 Bacteria 1344
522 Ga0496102_0379284 3300048905 Bacteria 1331
523 Ga0496102_0386477 3300048905 Bacteria 1317
524 Ga0496103_0367195 3300048906 Bacteria 925
525 Ga0496104_0026169 3300048907 Bacteria 5383
526 Ga0496104_0069981 3300048907 Bacteria 3335
527 Ga0496104_0181834 3300048907 Bacteria 2013
528 Ga0496106_0055346 3300048909 Bacteria 2998
529 Ga0496106_0100654 3300048909 Bacteria 2241
530 Ga0496106_0200723 3300048909 Bacteria 1587
531 Ga0496106_0373718 3300048909 Bacteria 1145
532 Ga0496108_0000877 3300048911 Bacteria 23467
533 Ga0496108_0081120 3300048911 Bacteria 2749
534 Ga0496108_0463740 3300048911 Bacteria 1107
535 Ga0496109_0001669 3300048912 Bacteria 18492
536 Ga0496109_0080944 3300048912 Bacteria 2993
537 Ga0496109_0136625 3300048912 Bacteria 2291
538 Ga0496110_0019418 3300048913 Bacteria 5718
539 Ga0496110_0173096 3300048913 Bacteria 1959
540 Ga0496110_0247381 3300048913 Bacteria 1623
541 Ga0496111_0063386 3300048914 Bacteria 2681
542 Ga0496111_0171971 3300048914 Bacteria 1610
543 Ga0496112_0145233 3300048915 Bacteria 2341
544 Ga0496112_0499266 3300048915 Bacteria 1152
545 Ga0496112_0621346 3300048915 Bacteria 1012
546 Ga0496113_0019167 3300048916 Bacteria 4781
547 Ga0496113_0109546 3300048916 Bacteria 2148
548 Ga0496114_0013475 3300048917 Bacteria 6555
549 Ga0496114_0067166 3300048917 Bacteria 3007
550 Ga0501033_0721044 3300049570 Bacteria 677
551 Ga0501036_0085702 3300049572 Bacteria 2663
552 Ga0501040_0011486 3300049576 Bacteria 5797
553 Ga0501040_0083448 3300049576 Bacteria 2216
554 Ga0501040_0113695 3300049576 Bacteria 1894
555 Ga0501041_0141370 3300049577 Bacteria 1501
556 Ga0501041_0191430 3300049577 Bacteria 1281
557 Ga0501042_0018098 3300049578 Bacteria 4873
558 Ga0501043_0352621 3300049579 Bacteria 1118
559 Ga0501046_0359617 3300049580 Bacteria 1056
560 Ga0501048_0234432 3300049582 Bacteria 1302
561 Ga0501048_0540457 3300049582 Bacteria 836
562 Ga0501048_0543810 3300049582 Bacteria 833
563 Ga0501067_0097544 3300049583 Bacteria 1632
564 Ga0501070_0613860 3300049586 Bacteria 866
565 Ga0501071_0003845 3300049587 Bacteria 9450
566 Ga0501071_0121477 3300049587 Bacteria 1936
567 Ga0501071_0323280 3300049587 Bacteria 1172
568 Ga0501072_0043908 3300049588 Bacteria 3514
569 Ga0501073_0269412 3300049589 Bacteria 1175
570 Ga0501074_0218246 3300049590 Bacteria 1358
571 Ga0501075_0014433 3300049591 Bacteria 5661
572 Ga0501075_0029867 3300049591 Bacteria 4033
573 Ga0501076_0008007 3300049592 Bacteria 7718
574 Ga0501076_0052602 3300049592 Bacteria 3226
575 Ga0501076_0054946 3300049592 Bacteria 3157
576 Ga0501076_0919810 3300049592 Bacteria 721
577 Ga0501077_0049811 3300049593 Bacteria 2662
578 Ga0501077_0189394 3300049593 Bacteria 1307
579 Ga0501245_022226 3300049708 Bacteria 1000
580 Ga0501079_0017706 3300049741 Bacteria 5443
581 Ga0501079_0660771 3300049741 Bacteria 823
582 Ga0501080_0093687 3300049742 Bacteria 2789
583 Ga0501081_0007802 3300049743 Bacteria 6938
584 Ga0501081_0162773 3300049743 Bacteria 1608
585 Ga0501035_0597398 3300049822 Bacteria 900
586 Ga0501045_0014876 3300049824 Bacteria 5519
587 Ga0501045_0042426 3300049824 Bacteria 3311
588 Ga0501045_0187501 3300049824 Bacteria 1541
589 nmdc:mga03683_4810_c1 3300050489 Bacteria 4509
590 nmdc:mga00v17_18603_c1 3300050491 Bacteria 3950
591 nmdc:mga00v17_6655_c1 3300050491 Bacteria 6137
592 nmdc:mga05p37_11440_c1 3300050507 Bacteria 10567
593 nmdc:mga05p37_125813_c1 3300050507 Bacteria 3148
594 nmdc:mga05p37_198375_c1 3300050507 Bacteria 2432
595 nmdc:mga05p37_33032_c1 3300050507 Bacteria 6336
596 nmdc:mga05p37_348250_c1 3300050507 Bacteria 1745
597 nmdc:mga05p37_519748_c2 3300050507 Bacteria 1067
598 nmdc:mga05p37_54869_c1 3300050507 Bacteria 4901
599 nmdc:mga05p37_6800_c1 3300050507 Bacteria 13477
600 nmdc:mga05p37_89369_c1 3300050507 Bacteria 3796
601 nmdc:mga09592_68670_c1 3300050508 Bacteria 3006
602 nmdc:mga0qj67_1124_c1 3300050509 Bacteria 18545
603 nmdc:mga0qj67_12312_c2 3300050509 Bacteria 3979
604 nmdc:mga0qj67_222289_c1 3300050509 Bacteria 1533
605 nmdc:mga0qj67_375251_c1 3300050509 Bacteria 1149
606 nmdc:mga0qj67_441921_c1 3300050509 Bacteria 1048
607 nmdc:mga0qj67_47937_c1 3300050509 Bacteria 3376
608 nmdc:mga06r32_1195356_c1 3300050510 Bacteria 707
609 nmdc:mga06r32_21291_c1 3300050510 Bacteria 5985
610 nmdc:mga06r32_39282_c1 3300050510 Bacteria 4490
611 nmdc:mga06r32_69071_c1 3300050510 Bacteria 3414
612 nmdc:mga08y16_11096_c1 3300050511 Bacteria 9460
613 nmdc:mga08y16_168905_c1 3300050511 Bacteria 2272
614 nmdc:mga08y16_26918_c1 3300050511 Bacteria 6060
615 nmdc:mga08y16_2813_c1 3300050511 Bacteria 17866
616 nmdc:mga08y16_658973_c1 3300050511 Bacteria 1050
617 nmdc:mga0n895_781990_c1 3300050512 Bacteria 946
618 nmdc:mga0rr50_119937_c1 3300050513 Bacteria 2092
619 nmdc:mga0rr50_45643_c1 3300050513 Bacteria 3222
620 nmdc:mga0rr50_492212_c1 3300050513 Bacteria 1042
621 nmdc:mga0rr50_510195_c1 3300050513 Bacteria 1023
622 nmdc:mga0a205_193071_c1 3300050515 Bacteria 1928
623 Ga0495595_0053233 3300053084 Bacteria 1880
624 Ga0495595_0093592 3300053084 Bacteria 1444
625 Ga0495619_0023761 3300053085 Bacteria 3930
626 Ga0500628_012873 3300053129 Bacteria 1550
627 Ga0501084_0065583 3300054114 Bacteria 3038
628 Ga0501084_0195538 3300054114 Bacteria 1706
629 Ga0501084_0363076 3300054114 Bacteria 1224
630 Ga0590071_000402 3300059421 Bacteria 12700
631 Ga0590071_002618 3300059421 Bacteria 4523
632 Ga0590074_002750 3300059423 Bacteria 2898
633 Ga0590075_001635 3300059424 Bacteria 5522
634 Ga0590075_010560 3300059424 Bacteria 2224
635 Ga0590077_000398 3300059426 Bacteria 12266
636 Ga0501082_0094187 3300060353 Bacteria 2588
637 Ga0501082_0128244 3300060353 Bacteria 2201
638 Ga0501082_0524583 3300060353 Bacteria 1035
639 2881645019 2881644220 Bacteria 5302661
640 2891051495 2891048133 Bacteria 4447501
641 2896390709 2896384573 Bacteria 7700774
642 3001271209 3001267043 Bacteria 4823521
643 3001272107 3001272096 Bacteria 4729684
644 3006972753 3006969106 Bacteria 4739423
645 3006988106 3006984091 Bacteria 4207523
646 3006992728 3006988479 Bacteria 4767936
647 Ga0068869_100027479
648 JGI24751J29686_10015939
649 JGI25406J46586_10001471
650 JGI25406J46586_10002007
651 Ga0065714_10097106
652 Ga0065712_10002461
653 Ga0065712_10002990
654 Ga0065712_10005524
655 Ga0065715_10000434
656 Ga0065715_10123611
657 Ga0065715_10449267
658 Ga0065707_10017486
659 Ga0065707_10109542
660 Ga0065707_10179925
661 Ga0070676_10070800
662 Ga0070683_100558004
663 Ga0070683_100839264
664 Ga0070690_100148796
665 Ga0070690_100208990
666 Ga0070690_100244118
667 Ga0070690_100271621
668 Ga0070670_100001473
669 Ga0070670_100003924
670 Ga0070670_100006859
671 Ga0070670_100008006
672 Ga0070670_100043598
673 Ga0070670_100364626
674 Ga0070677_10207166
675 Ga0070677_10344439
676 Ga0070666_10098281
677 Ga0070666_10210370
678 Ga0070682_100136774
679 Ga0068868_100069764
680 Ga0068868_100354302
681 Ga0070660_100341137
682 Ga0070689_100000437
683 Ga0070689_100054247
684 Ga0070689_100179620
685 Ga0070689_100465465
686 Ga0070687_100120151
687 Ga0070687_100173089
688 Ga0070661_100201476
689 Ga0070669_100010029
690 Ga0070669_100075626
691 Ga0070669_100442111
692 Ga0070675_100005737
693 Ga0070675_100187998
694 Ga0070675_100213816
695 Ga0070671_100018425
696 Ga0070671_100059240
697 Ga0070671_100116914
698 Ga0070671_100157052
699 Ga0070671_100323508
700 Ga0070671_100439063
701 Ga0070674_100071410
702 Ga0070674_100185254
703 Ga0070674_100635192
704 Ga0070673_100000574
705 Ga0070673_100033605
706 Ga0070673_100108483
707 Ga0070688_100002629
708 Ga0070688_100012057
709 Ga0070688_100074911
710 Ga0070659_100096069
711 Ga0070667_100023919
712 Ga0070667_100256522
713 Ga0070667_100299922
714 Ga0070714_100003779
715 Ga0070701_10002431
716 Ga0070701_10025693
717 Ga0070701_10205423
718 Ga0070705_100041716
719 Ga0070700_100000177
720 Ga0070694_100000140
721 Ga0070694_100023892
722 Ga0070694_100612919
723 Ga0070663_100445092
724 Ga0070663_100661283
725 Ga0070678_100130968
726 Ga0070678_100216891
727 Ga0070662_100079475
728 Ga0070662_100081160
729 Ga0070662_100227476
730 Ga0070662_100278251
731 Ga0070681_10009781
732 Ga0070681_10200838
733 Ga0070681_10544659
734 Ga0068867_100011071
735 Ga0068867_100660065
736 Ga0070685_10000196
737 Ga0070685_10016066
738 Ga0070685_10047821
739 Ga0070685_10220193
740 Ga0070706_100119217
741 Ga0070706_100535922
742 Ga0070707_100000248
743 Ga0070707_100000974
744 Ga0070707_100296915
745 Ga0070707_100681088
746 Ga0070698_100148109
747 Ga0070698_100208233
748 Ga0070698_100989498
749 Ga0070699_100083371
750 Ga0070699_100145365
751 Ga0070699_100238787
752 Ga0070679_100128287
753 Ga0070679_100199295
754 Ga0070679_100591390
755 Ga0070697_100000685
756 Ga0070697_100048851
757 Ga0070697_100061543
758 Ga0068853_100339756
759 Ga0070672_100003190
760 Ga0070672_100005451
761 Ga0070672_100011165
762 Ga0070672_100047492
763 Ga0070672_100208061
764 Ga0070672_100399352
765 Ga0070686_100001284
766 Ga0070686_100031399
767 Ga0070686_100083442
768 Ga0070686_100171325
769 Ga0070686_100248760
770 Ga0070695_100012920
771 Ga0070695_100137519
772 Ga0070696_100132072
773 Ga0070696_100150879
774 Ga0070693_100009755
775 Ga0070665_100009603
776 Ga0070665_100070161
777 Ga0070704_100072576
778 Ga0070704_100096096
779 Ga0070704_100123646
780 Ga0070704_100538641
781 Ga0068854_100061814
782 Ga0068859_100012868
783 Ga0068859_100024063
784 Ga0068859_100051062
785 Ga0068859_100078660
786 Ga0068859_100133290
787 Ga0068859_100383982
788 Ga0068859_100517597
789 Ga0068859_100576188
790 Ga0068864_100005408
791 Ga0068864_100106531
792 Ga0068864_100129083
793 Ga0068864_101463228
794 Ga0068866_10109465
795 Ga0068866_10282959
796 Ga0068861_100078249
797 Ga0068861_100080234
798 Ga0068861_100244820
799 Ga0068861_100694148
800 Ga0068870_10021099
801 Ga0068870_10094432
802 Ga0068863_100012058
803 Ga0068863_100034457
804 Ga0068863_100422046
805 Ga0068858_100155748
806 Ga0068860_100081728
807 Ga0068862_100019590
808 Ga0068862_100174365
809 Ga0068862_100276023
810 Ga0068862_100279510
811 Ga0068862_100394196
812 Ga0081539_10000036
813 Ga0081539_10001709
814 Ga0075365_10105272
815 Ga0097621_100038735
816 Ga0097621_100339434
817 Ga0068871_100008150
818 Ga0068871_100024422
819 Ga0068871_100047330
820 Ga0068871_100355859
821 Ga0075428_100002598
822 Ga0075428_100015286
823 Ga0075428_100332025
824 Ga0075428_100347972
825 Ga0075428_100674738
826 Ga0075430_100000555
827 Ga0075430_100003348
828 Ga0075430_100048406
829 Ga0075430_100737607
830 Ga0075431_100003947
831 Ga0075431_100004122
832 Ga0075431_100052357
833 Ga0075431_100196753
834 Ga0075431_100255945
835 Ga0075433_10242773
836 Ga0075434_100003240
837 Ga0075434_100307655
838 Ga0075429_100052335
839 Ga0075429_100089812
840 Ga0075429_100094658
841 Ga0068865_100314422
842 Ga0097620_100012868
843 Ga0097620_100024065
844 Ga0097620_100051063
845 Ga0097620_100078669
846 Ga0097620_100133293
847 Ga0097620_100383997
848 Ga0097620_100517662
849 Ga0097620_100576226
850 Ga0075435_100000860
851 Ga0075435_100232879
852 Ga0075435_100241391
853 Ga0099794_10008104
854 Ga0099794_10274454
855 Ga0111539_10000080
856 Ga0111539_10004136
857 Ga0111539_10037680
858 Ga0111539_10124167
859 Ga0111539_10342699
860 Ga0111539_10677739
861 Ga0111539_10936317
862 Ga0105245_10151598
863 Ga0105245_10342194
864 Ga0114129_10006904
865 Ga0114129_10007819
866 Ga0114129_10041757
867 Ga0114129_10046114
868 Ga0114129_10118835
869 Ga0114129_10182255
870 Ga0114129_10310751
871 Ga0114129_10546891
872 Ga0105241_10272932
873 Ga0105242_10158160
874 Ga0105248_10020842
875 Ga0105248_10175229
876 Ga0105248_10197023
877 Ga0105248_10371105
878 Ga0105248_10702674
879 Ga0105238_10307295
880 Ga0105249_10048602
881 Ga0105249_10433028
882 Ga0105249_10842583
883 Ga0099796_10005901
884 Ga0105239_10163867
885 Ga0105239_10184742
886 Ga0157374_10204336
887 Ga0157374_10349754
888 Ga0157378_10001644
889 Ga0157378_10008843
890 Ga0157378_10108500
891 Ga0157378_10342365
892 Ga0157378_10348390
893 Ga0163162_10042153
894 Ga0163162_10184812
895 Ga0163162_10676915
896 Ga0157372_10671573
897 Ga0157375_10003989
898 Ga0157375_10058912
899 Ga0157375_10376384
900 Ga0157375_10606174
901 Ga0163163_10101493
902 Ga0163163_10203101
903 Ga0163163_10227266
904 Ga0163163_10285368
905 Ga0157380_10012490
906 Ga0157380_10699683
907 Ga0157377_10059590
908 Ga0157377_10162394
909 Ga0157377_10188536
910 Ga0157379_10012034
911 Ga0157379_10089793
912 Ga0157376_10188046
913 Ga0157376_10189400
914 Ga0157376_10438620
915 Ga0163161_10677285
916 Ga0213876_10072449
917 Ga0207697_10027334
918 Ga0207682_10003373
919 Ga0207688_10008079
920 Ga0207688_10032104
921 Ga0207680_10050811
922 Ga0207680_10243321
923 Ga0207645_10105107
924 Ga0207645_10123140
925 Ga0207643_10013740
926 Ga0207643_10140383
927 Ga0207707_10006579
928 Ga0207707_10275846
929 Ga0207707_10402503
930 Ga0207707_10686232
931 Ga0207660_10334812
932 Ga0207662_10008161
933 Ga0207662_10052546
934 Ga0207649_10185577
935 Ga0207649_10257594
936 Ga0207652_10083730
937 Ga0207646_10000467
938 Ga0207646_10001529
939 Ga0207646_10147430
940 Ga0207646_10387767
941 Ga0207681_10006478
942 Ga0207681_10056150
943 Ga0207681_10159611
944 Ga0207681_10181843
945 Ga0207681_10370404
946 Ga0207681_10370665
947 Ga0207681_10460427
948 Ga0207650_10006807
949 Ga0207650_10015259
950 Ga0207650_10085474
951 Ga0207650_10251601
952 Ga0207659_10083350
953 Ga0207659_10092045
954 Ga0207659_10242331
955 Ga0207687_10386270
956 Ga0207664_10194206
957 Ga0207644_10033979
958 Ga0207644_10047341
959 Ga0207644_10222991
960 Ga0207644_10245296
961 Ga0207690_10077663
962 Ga0207690_10645111
963 Ga0207706_10025718
964 Ga0207706_10029241
965 Ga0207706_10327483
966 Ga0207686_10146024
967 Ga0207709_10659836
968 Ga0207670_10000451
969 Ga0207670_10072751
970 Ga0207670_10503138
971 Ga0207669_10001451
972 Ga0207704_10016957
973 Ga0207704_10192396
974 Ga0207704_10455854
975 Ga0207691_10001551
976 Ga0207691_10003109
977 Ga0207691_10010808
978 Ga0207691_10011560
979 Ga0207691_10127964
980 Ga0207691_10410713
981 Ga0207711_10006333
982 Ga0207711_10017888
983 Ga0207711_10027501
984 Ga0207711_10441183
985 Ga0207711_10557419
986 Ga0207689_10003976
987 Ga0207689_10022461
988 Ga0207689_10025721
989 Ga0207689_10147243
990 Ga0207689_10370518
991 Ga0207661_10092878
992 Ga0207679_10057175
993 Ga0207651_10000075
994 Ga0207651_10004848
995 Ga0207651_10047318
996 Ga0207668_10413847
997 Ga0207658_10088214
998 Ga0207658_10105846
999 Ga0207677_10047268
1000 Ga0207677_10913317
1001 Ga0207703_10467421
1002 Ga0207703_10649824
1003 Ga0207703_10867660
1004 Ga0207639_10127674
1005 Ga0207639_10470761
1006 Ga0207678_10609189
1007 Ga0207678_10651586
1008 Ga0207708_10000302
1009 Ga0207708_10667621
1010 Ga0207641_10003438
1011 Ga0207641_10090870
1012 Ga0207641_10419325
1013 Ga0207641_10612821
1014 Ga0207648_10002965
1015 Ga0207648_10472442
1016 Ga0207676_10004184
1017 Ga0207676_10015097
1018 Ga0207676_10126619
1019 Ga0207676_10225866
1020 Ga0207674_10048160
1021 Ga0207674_10210333
1022 Ga0207675_100015896
1023 Ga0207675_100104933
1024 Ga0207675_100289545
1025 Ga0207675_100378641
1026 Ga0207675_100491996
1027 Ga0207683_10007061
1028 Ga0207683_10080519
1029 Ga0207683_10203906
1030 Ga0207683_10305836
1031 Ga0207683_10483010
1032 Ga0209971_1000855
1033 Ga0209971_1036399
1034 Ga0209974_10087498
1035 Ga0207428_10002587
1036 Ga0207428_10022861
1037 Ga0207428_10068365
1038 Ga0265354_1001938
1039 Ga0268266_10028691
1040 Ga0268265_10085399
1041 Ga0268265_10409905
1042 Ga0268265_10630942
1043 Ga0268264_10506007
1044 Ga0268264_11191742
1045 Ga0265318_10014243
1046 Ga0265338_10012496
1047 Ga0265770_1000229
1048 Ga0265765_1001105
1049 Ga0265760_10000035
1050 Ga0265760_10029985
1051 Ga0265330_10099857
1052 Ga0265328_10097613
1053 Ga0265325_10060702
1054 Ga0265339_10147222
1055 Ga0265331_10034353
1056 Ga0307408_100009611
1057 Ga0265313_10017623
1058 Ga0265342_10192300
1059 Ga0316576_10009255
1060 Ga0307405_10003959
1061 Ga0307405_10005720
1062 Ga0307405_10062116
1063 Ga0316577_10033922
1064 Ga0316577_10242819
1065 Ga0307413_10089025
1066 Ga0307410_10010016
1067 Ga0307410_10017422
1068 Ga0307410_10092779
1069 Ga0307410_10213551
1070 Ga0307406_10018478
1071 Ga0307406_10088195
1072 Ga0307406_10444071
1073 Ga0307407_10001846
1074 Ga0307407_10074348
1075 Ga0307407_10388330
1076 Ga0307412_10013538
1077 Ga0307412_10055314
1078 Ga0307409_100006718
1079 Ga0307409_100012319
1080 Ga0307409_100018275
1081 Ga0307416_100002667
1082 Ga0307416_100182064
1083 Ga0307416_100707149
1084 Ga0307416_101223494
1085 Ga0307414_10087863
1086 Ga0307414_10121747
1087 Ga0307411_10005555
1088 Ga0307411_10038485
1089 Ga0307411_10340295
1090 Ga0307415_100001325
1091 Ga0373934_0002735
1092 Ga0373936_0242229
1093 Ga0373941_0032794
1094 Ga0373941_0200025
1095 Ga0373945_0056567
1096 Ga0373956_0107589
1097 Ga0373955_0001586
1098 Ga0373955_0060909
1099 Ga0373942_0185781
1100 Ga0373962_0054679
1101 Ga0316574_0131271
1102 Ga0373933_0449497
1103 Ga0373937_0085236
1104 Ga0373937_1035824
1105 Ga0316582_0114215
1106 Ga0316582_0148218
1107 Ga0316584_0108805
1108 Ga0373925_0013048
1109 Ga0373925_0182437
1110 Ga0373925_0580425
1111 Ga0436365_0407055
1112 Ga0436362_0329212
1113 Ga0451853_2476465
1114 Ga0439442_049801
1115 Ga0450923_025131
1116 Ga0450896_007862
1117 Ga0439446_0139559
1118 Ga0439435_0030119
1119 Ga0439464_0129684
1120 Ga0451577_0074364
1121 Ga0451577_0998371
1122 Ga0453683_0014106
1123 Ga0453683_0167670
1124 Ga0453683_0562169
1125 Ga0453684_0006151
1126 Ga0451576_0510111
1127 Ga0495629_0000010
1128 Ga0495653_0057593
1129 Ga0495580_0117304
1130 Ga0495580_0233640
1131 Ga0495639_0010397
1132 Ga0495639_0123406
1133 Ga0495639_0198321
1134 Ga0495664_0380128
1135 Ga0495594_0162497
1136 Ga0495630_0364870
1137 Ga0495663_0044813
1138 Ga0495666_0003357
1139 Ga0495666_0165486
1140 Ga0495586_0003270
1141 Ga0495586_0402494
1142 Ga0495587_0011252
1143 Ga0495598_0028469
1144 Ga0495609_0116196
1145 Ga0495621_0087588
1146 Ga0495622_0022829
1147 Ga0495633_0012990
1148 Ga0495635_0037355
1149 Ga0495635_0105538
1150 Ga0495635_0124306
1151 Ga0495635_0520642
1152 Ga0495659_0002111
1153 Ga0495657_0138153
1154 Ga0495657_0181572
1155 Ga0495623_0062630
1156 Ga0495658_0078342
1157 Ga0495658_0144322
1158 Ga0495669_0035323
1159 Ga0495670_0065945
1160 Ga0495581_0036649
1161 Ga0495604_0001510
1162 Ga0495674_0285921
1163 Ga0495680_0041872
1164 Ga0495684_0089768
1165 Ga0495684_0221814
1166 Ga0496100_0905757
1167 Ga0496101_0263586
1168 Ga0496102_0379284
1169 Ga0496102_0386477
1170 Ga0496103_0367195
1171 Ga0496104_0026169
1172 Ga0496104_0069981
1173 Ga0496104_0181834
1174 Ga0496106_0055346
1175 Ga0496106_0100654
1176 Ga0496106_0200723
1177 Ga0496106_0373718
1178 Ga0496108_0000877
1179 Ga0496108_0081120
1180 Ga0496108_0463740
1181 Ga0496109_0001669
1182 Ga0496109_0080944
1183 Ga0496109_0136625
1184 Ga0496110_0019418
1185 Ga0496110_0173096
1186 Ga0496110_0247381
1187 Ga0496111_0063386
1188 Ga0496111_0171971
1189 Ga0496112_0145233
1190 Ga0496112_0499266
1191 Ga0496112_0621346
1192 Ga0496113_0019167
1193 Ga0496113_0109546
1194 Ga0496114_0013475
1195 Ga0496114_0067166
1196 Ga0501033_0721044
1197 Ga0501036_0085702
1198 Ga0501040_0011486
1199 Ga0501040_0083448
1200 Ga0501040_0113695
1201 Ga0501041_0141370
1202 Ga0501041_0191430
1203 Ga0501042_0018098
1204 Ga0501043_0352621
1205 Ga0501046_0359617
1206 Ga0501048_0234432
1207 Ga0501048_0540457
1208 Ga0501048_0543810
1209 Ga0501067_0097544
1210 Ga0501070_0613860
1211 Ga0501071_0003845
1212 Ga0501071_0121477
1213 Ga0501071_0323280
1214 Ga0501072_0043908
1215 Ga0501073_0269412
1216 Ga0501074_0218246
1217 Ga0501075_0014433
1218 Ga0501075_0029867
1219 Ga0501076_0008007
1220 Ga0501076_0052602
1221 Ga0501076_0054946
1222 Ga0501076_0919810
1223 Ga0501077_0049811
1224 Ga0501077_0189394
1225 Ga0501245_022226
1226 Ga0501079_0017706
1227 Ga0501079_0660771
1228 Ga0501080_0093687
1229 Ga0501081_0007802
1230 Ga0501081_0162773
1231 Ga0501035_0597398
1232 Ga0501045_0014876
1233 Ga0501045_0042426
1234 Ga0501045_0187501
1235 nmdc:mga03683_4810_c1
1236 nmdc:mga00v17_18603_c1
1237 nmdc:mga00v17_6655_c1
1238 nmdc:mga05p37_11440_c1
1239 nmdc:mga05p37_125813_c1
1240 nmdc:mga05p37_198375_c1
1241 nmdc:mga05p37_33032_c1
1242 nmdc:mga05p37_348250_c1
1243 nmdc:mga05p37_519748_c2
1244 nmdc:mga05p37_54869_c1
1245 nmdc:mga05p37_6800_c1
1246 nmdc:mga05p37_89369_c1
1247 nmdc:mga09592_68670_c1
1248 nmdc:mga0qj67_1124_c1
1249 nmdc:mga0qj67_12312_c2
1250 nmdc:mga0qj67_222289_c1
1251 nmdc:mga0qj67_375251_c1
1252 nmdc:mga0qj67_441921_c1
1253 nmdc:mga0qj67_47937_c1
1254 nmdc:mga06r32_1195356_c1
1255 nmdc:mga06r32_21291_c1
1256 nmdc:mga06r32_39282_c1
1257 nmdc:mga06r32_69071_c1
1258 nmdc:mga08y16_11096_c1
1259 nmdc:mga08y16_168905_c1
1260 nmdc:mga08y16_26918_c1
1261 nmdc:mga08y16_2813_c1
1262 nmdc:mga08y16_658973_c1
1263 nmdc:mga0n895_781990_c1
1264 nmdc:mga0rr50_119937_c1
1265 nmdc:mga0rr50_45643_c1
1266 nmdc:mga0rr50_492212_c1
1267 nmdc:mga0rr50_510195_c1
1268 nmdc:mga0a205_193071_c1
1269 Ga0495595_0053233
1270 Ga0495595_0093592
1271 Ga0495619_0023761
1272 Ga0500628_012873
1273 Ga0501084_0065583
1274 Ga0501084_0195538
1275 Ga0501084_0363076
1276 Ga0590071_000402
1277 Ga0590071_002618
1278 Ga0590074_002750
1279 Ga0590075_001635
1280 Ga0590075_010560
1281 Ga0590077_000398
1282 Ga0501082_0094187
1283 Ga0501082_0128244
1284 Ga0501082_0524583
1285 2881645019
1286 2891051495
1287 2896390709
1288 3001271209
1289 3001272107
1290 3006972753
1291 3006988106
1292 3006992728

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13507

GATase_5

CobB/CobQ-like glutamine amidotransferase domain

1

217

0.88

PF01965

DJ-1_PfpI

DJ-1/PfpI family

21

103

0.86

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

16

99

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.9413 1 230
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.9327 1 230
1t3t-assembly1.cif.gz_A structure of formylglycinamide synthetase 0.8588 1 226
6lyl-assembly1.cif.gz_A crystal structure of s1052d mutant of formylglycinamidine synthetase 0.8585 1 226
7dw7-assembly1.cif.gz_A crystal structure of n1051a mutant of formylglycinamidine synthetase 0.8573 2 225
ID Description Score Start End Superfamily
af_Q59042_1_229_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9698 3 227 3.40.50.880
af_P9WHL5_1_222_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9673 1 229 3.40.50.880
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9629 3 229 3.40.50.880
af_P9WHL5_1_222_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9545 1 229 3.40.50.880
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9507 3 229 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2V8PQP7-F1-model_v4 Phosphoribosylformylglycinamidine synthase I 0.9939 111 233 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-X1CA12-F1-model_v4 Uncharacterized protein 0.9931 82 222 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A424Z206-F1-model_v4 Phosphoribosylformylglycinamidine synthase I (EC 6.3.5.3) 0.9928 81 232 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541
GO:0016787
AF-A0A2V8RZ66-F1-model_v4 Phosphoribosylformylglycinamidine synthase I 0.9927 83 205 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A537FVQ6-F1-model_v4 Phosphoribosylformylglycinamidine synthase I (EC 6.3.5.3) 0.9915 72 206 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787

Map