F472108

General Info

Members Datasets Scaffolds Average Seq Length
645 201 1290 265

Family's Representative Sequence

Representative Sequence 3300005466|Ga0070685_10066735|Ga0070685_100667352
Length 287
Sequence LQHSSFDPKADAASEARAARIGPVFPTRAQTDEFGWTSRDARRRLVHGFDSRNASSRSFNLIRSKLVALNRERGWRMLGIVSATPSVGKSFVSANVAAAMSRDPRFQTYLIDLDLRRGTIRDIFGIETEVSLVDYLEQPEPRGILPGFMPQGQELIVIPSIPGPVHSAELLASDRASALFQAMNGSDPRNYFICDLPPVFANDDAAIIMESLDGYVIVAQDGKTTQREVTATVEMLGYERLAGVVLNKYRGGMVSEGYGIEDRYASEYYASQDTDEDRSAHFLADGP

Samples

Sample ID Description Type Environment
1 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
151 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
161 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
162 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
163 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
164 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
165 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
170 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
171 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
200 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 4.19
Rhizosphere 94.57
Stem 0
Stem Tuber 0
Unclassified 19.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070685_10066735 3300005466 Bacteria 2121
2 JGI24741J21665_1001705 3300001915 Bacteria 6077
3 JGI24746J21847_1002900 3300001977 Bacteria 2696
4 JGI24747J21853_1000278 3300001978 Bacteria 2843
5 JGI24740J21852_10002403 3300001979 Bacteria 8507
6 JGI24740J21852_10002753 3300001979 Bacteria 7862
7 JGI24740J21852_10004394 3300001979 Bacteria 6062
8 JGI24740J21852_10018053 3300001979 Bacteria 2512
9 JGI24739J22299_10011726 3300001989 Bacteria 3231
10 JGI24739J22299_10023339 3300001989 Bacteria 2188
11 JGI24737J22298_10004284 3300001990 Bacteria 4984
12 JGI24737J22298_10005369 3300001990 Bacteria 4429
13 JGI24737J22298_10009839 3300001990 Bacteria 3167
14 JGI24743J22301_10001141 3300001991 Bacteria 3567
15 JGI24735J21928_10002010 3300002067 Bacteria 7153
16 rootL2_10076522 3300003322 Unclassified 1248
17 rootL2_10255690 3300003322 Bacteria 1296
18 Ga0070658_10007081 3300005327 Bacteria 9051
19 Ga0070658_10017983 3300005327 Bacteria 5654
20 Ga0070658_10025215 3300005327 Unclassified 4766
21 Ga0070658_10027650 3300005327 Bacteria 4550
22 Ga0070658_10036091 3300005327 Bacteria 3983
23 Ga0070658_10065318 3300005327 Unclassified 2969
24 Ga0070658_10158273 3300005327 Unclassified 1899
25 Ga0070658_10318784 3300005327 Bacteria 1327
26 Ga0070676_10241537 3300005328 Bacteria 1201
27 Ga0070683_100002629 3300005329 Bacteria 14360
28 Ga0070683_100016104 3300005329 Bacteria 6581
29 Ga0070683_100020068 3300005329 Bacteria 5943
30 Ga0070683_100058817 3300005329 Bacteria 3570
31 Ga0070690_100005963 3300005330 Bacteria 6881
32 Ga0070670_100001961 3300005331 Bacteria 16853
33 Ga0070670_100013946 3300005331 Bacteria 6892
34 Ga0070670_100232277 3300005331 Unclassified 1605
35 Ga0070677_10002714 3300005333 Bacteria 5659
36 Ga0070677_10009099 3300005333 Bacteria 3362
37 Ga0070666_10001302 3300005335 Bacteria 15102
38 Ga0070680_100020196 3300005336 Bacteria 5286
39 Ga0070680_100035425 3300005336 Bacteria 4029
40 Ga0070682_100052764 3300005337 Bacteria 2545
41 Ga0068868_100003463 3300005338 Bacteria 10990
42 Ga0070660_100003869 3300005339 Bacteria 10336
43 Ga0070660_100006193 3300005339 Bacteria 8277
44 Ga0070660_100007812 3300005339 Bacteria 7459
45 Ga0070660_100011819 3300005339 Bacteria 6220
46 Ga0070660_100019162 3300005339 Bacteria 5009
47 Ga0070660_100029227 3300005339 Unclassified 4129
48 Ga0070660_100030635 3300005339 Unclassified 4036
49 Ga0070660_100040329 3300005339 Bacteria 3553
50 Ga0070660_100151039 3300005339 Bacteria 1867
51 Ga0070660_100234180 3300005339 Bacteria 1494
52 Ga0070660_100320096 3300005339 Bacteria 1274
53 Ga0070661_100002823 3300005344 Bacteria 11943
54 Ga0070661_100005291 3300005344 Bacteria 8893
55 Ga0070661_100121077 3300005344 Unclassified 1960
56 Ga0070661_100193788 3300005344 Unclassified 1550
57 Ga0070661_100248664 3300005344 Bacteria 1371
58 Ga0070661_100284555 3300005344 Bacteria 1283
59 Ga0070692_10190739 3300005345 Bacteria 1194
60 Ga0070668_100017861 3300005347 Bacteria 5321
61 Ga0070675_100002093 3300005354 Bacteria 14774
62 Ga0070671_100000585 3300005355 Bacteria 25984
63 Ga0070671_100001443 3300005355 Bacteria 17754
64 Ga0070671_100052023 3300005355 Bacteria 3406
65 Ga0070671_100073674 3300005355 Unclassified 2852
66 Ga0070671_100149751 3300005355 Bacteria 1970
67 Ga0070674_100074103 3300005356 Unclassified 2415
68 Ga0070673_100002199 3300005364 Bacteria 11788
69 Ga0070673_100036649 3300005364 Bacteria 3730
70 Ga0070659_100005596 3300005366 Bacteria 9030
71 Ga0070659_100012286 3300005366 Bacteria 6349
72 Ga0070659_100012487 3300005366 Bacteria 6298
73 Ga0070659_100021733 3300005366 Bacteria 4892
74 Ga0070659_100047513 3300005366 Bacteria 3367
75 Ga0070659_100047592 3300005366 Bacteria 3364
76 Ga0070659_100089334 3300005366 Unclassified 2468
77 Ga0070659_100179185 3300005366 Bacteria 1738
78 Ga0070659_100240048 3300005366 Bacteria 1499
79 Ga0070667_100011143 3300005367 Bacteria 7437
80 Ga0070667_100083851 3300005367 Bacteria 2731
81 Ga0070714_100002190 3300005435 Bacteria 14377
82 Ga0070714_100108604 3300005435 Bacteria 2453
83 Ga0070713_100034413 3300005436 Bacteria 4069
84 Ga0070663_100013674 3300005455 Bacteria 5185
85 Ga0070663_100030458 3300005455 Bacteria 3698
86 Ga0070663_100086575 3300005455 Bacteria 2314
87 Ga0070663_100126200 3300005455 Bacteria 1938
88 Ga0070678_100003931 3300005456 Bacteria 8357
89 Ga0070678_100011216 3300005456 Bacteria 5518
90 Ga0070678_100061154 3300005456 Unclassified 2775
91 Ga0070662_100012833 3300005457 Bacteria 5566
92 Ga0070662_100017163 3300005457 Unclassified 4873
93 Ga0070662_100017466 3300005457 Bacteria 4838
94 Ga0070662_100036289 3300005457 Bacteria 3486
95 Ga0070662_100046932 3300005457 Bacteria 3105
96 Ga0070662_100108917 3300005457 Unclassified 2107
97 Ga0070662_100146239 3300005457 Bacteria 1836
98 Ga0070681_10291746 3300005458 Bacteria 1541
99 Ga0068867_100024122 3300005459 Bacteria 4359
100 Ga0068867_100080759 3300005459 Unclassified 2450
101 Ga0070679_100041297 3300005530 Bacteria 4590
102 Ga0070679_100042382 3300005530 Bacteria 4532
103 Ga0070679_100071472 3300005530 Unclassified 3461
104 Ga0070679_100150141 3300005530 Bacteria 2307
105 Ga0070679_100600455 3300005530 Bacteria 1044
106 Ga0070684_100004092 3300005535 Bacteria 11038
107 Ga0070684_100010106 3300005535 Bacteria 7464
108 Ga0068853_100027959 3300005539 Bacteria 4742
109 Ga0068853_100038172 3300005539 Bacteria 4090
110 Ga0068853_100046247 3300005539 Unclassified 3731
111 Ga0068853_100053206 3300005539 Bacteria 3487
112 Ga0068853_100109467 3300005539 Bacteria 2452
113 Ga0068853_100142984 3300005539 Bacteria 2148
114 Ga0068853_100336641 3300005539 Bacteria 1401
115 Ga0068853_100438785 3300005539 Unclassified 1227
116 Ga0070672_100025465 3300005543 Bacteria 4388
117 Ga0070672_100193695 3300005543 Bacteria 1698
118 Ga0070672_100348357 3300005543 Bacteria 1262
119 Ga0070672_100383460 3300005543 Bacteria 1202
120 Ga0070686_100028862 3300005544 Bacteria 3368
121 Ga0070665_100001865 3300005548 Bacteria 23913
122 Ga0070665_100270851 3300005548 Unclassified 1700
123 Ga0068855_100005824 3300005563 Bacteria 15041
124 Ga0068855_100006659 3300005563 Bacteria 14033
125 Ga0068855_100014977 3300005563 Bacteria 9340
126 Ga0068855_100017060 3300005563 Bacteria 8734
127 Ga0068855_100019199 3300005563 Bacteria 8215
128 Ga0068855_100270487 3300005563 Bacteria 1889
129 Ga0068855_100370127 3300005563 Bacteria 1575
130 Ga0068855_100469207 3300005563 Bacteria 1371
131 Ga0070664_100003503 3300005564 Bacteria 12676
132 Ga0070664_100011435 3300005564 Bacteria 7203
133 Ga0070664_100012603 3300005564 Bacteria 6880
134 Ga0070664_100020715 3300005564 Bacteria 5415
135 Ga0070664_100025357 3300005564 Bacteria 4913
136 Ga0070664_100040030 3300005564 Unclassified 3951
137 Ga0070664_100072273 3300005564 Bacteria 2958
138 Ga0070664_100097703 3300005564 Unclassified 2550
139 Ga0070664_100110280 3300005564 Unclassified 2401
140 Ga0070664_100114134 3300005564 Unclassified 2360
141 Ga0068857_100005367 3300005577 Bacteria 10928
142 Ga0068857_100099622 3300005577 Bacteria 2607
143 Ga0068857_100106965 3300005577 Bacteria 2512
144 Ga0068857_100429641 3300005577 Unclassified 1232
145 Ga0068857_100432399 3300005577 Bacteria 1228
146 Ga0068854_100005714 3300005578 Bacteria 7860
147 Ga0068854_100011868 3300005578 Bacteria 5690
148 Ga0068854_100012828 3300005578 Bacteria 5489
149 Ga0068854_100060143 3300005578 Bacteria 2747
150 Ga0068854_100105079 3300005578 Bacteria 2122
151 Ga0068856_100010684 3300005614 Bacteria 8919
152 Ga0068856_100023749 3300005614 Bacteria 5963
153 Ga0068856_100069827 3300005614 Bacteria 3474
154 Ga0068856_100159956 3300005614 Bacteria 2262
155 Ga0068856_100182437 3300005614 Bacteria 2112
156 Ga0068856_100260945 3300005614 Bacteria 1748
157 Ga0068852_100007810 3300005616 Bacteria 7833
158 Ga0068852_100008650 3300005616 Bacteria 7522
159 Ga0068852_100014915 3300005616 Bacteria 6005
160 Ga0068852_100055678 3300005616 Unclassified 3414
161 Ga0068852_100059663 3300005616 Bacteria 3309
162 Ga0068852_100684409 3300005616 Unclassified 1035
163 Ga0068859_100088396 3300005617 Bacteria 3148
164 Ga0068859_100092915 3300005617 Bacteria 3068
165 Ga0068864_100014870 3300005618 Bacteria 6466
166 Ga0068864_100048368 3300005618 Unclassified 3656
167 Ga0068864_100122717 3300005618 Bacteria 2325
168 Ga0068864_100237266 3300005618 Bacteria 1688
169 Ga0068861_100516412 3300005719 Unclassified 1083
170 Ga0068851_10008666 3300005834 Bacteria 4709
171 Ga0068863_100189002 3300005841 Bacteria 1979
172 Ga0081539_10025332 3300005985 Bacteria 3824
173 Ga0097621_100013198 3300006237 Bacteria 6146
174 Ga0097621_100039548 3300006237 Bacteria 3789
175 Ga0097621_100065607 3300006237 Bacteria 2988
176 Ga0068871_100268207 3300006358 Bacteria 1491
177 Ga0068865_100009762 3300006881 Bacteria 5956
178 Ga0068865_100010945 3300006881 Bacteria 5662
179 Ga0068865_100033275 3300006881 Bacteria 3451
180 Ga0097620_100088398 3300006931 Bacteria 3148
181 Ga0097620_100092912 3300006931 Bacteria 3068
182 Ga0105240_10045600 3300009093 Bacteria 5560
183 Ga0105245_10006582 3300009098 Bacteria 10199
184 Ga0105245_10020739 3300009098 Bacteria 5761
185 Ga0105245_10026618 3300009098 Bacteria 5092
186 Ga0105243_10069887 3300009148 Bacteria 2834
187 Ga0105241_10153708 3300009174 Bacteria 1885
188 Ga0105248_10000864 3300009177 Bacteria 34121
189 Ga0105248_10001731 3300009177 Bacteria 24252
190 Ga0105248_10021840 3300009177 Bacteria 7092
191 Ga0105248_10030620 3300009177 Bacteria 6009
192 Ga0105248_10082992 3300009177 Unclassified 3605
193 Ga0105248_10083073 3300009177 Bacteria 3603
194 Ga0105248_10194817 3300009177 Bacteria 2283
195 Ga0105248_10365461 3300009177 Bacteria 1624
196 Ga0105237_10042170 3300009545 Bacteria 4603
197 Ga0105238_10013299 3300009551 Bacteria 8304
198 Ga0105238_10257308 3300009551 Bacteria 1725
199 Ga0105246_10019720 3300011119 Bacteria 4315
200 Ga0105246_10086945 3300011119 Bacteria 2242
201 Ga0105246_10398662 3300011119 Unclassified 1142
202 Ga0157373_10004072 3300013100 Bacteria 11014
203 Ga0157373_10008312 3300013100 Bacteria 7711
204 Ga0157373_10032853 3300013100 Bacteria 3734
205 Ga0157373_10042421 3300013100 Bacteria 3251
206 Ga0157371_10008598 3300013102 Bacteria 8109
207 Ga0157371_10021331 3300013102 Bacteria 4756
208 Ga0157371_10023109 3300013102 Bacteria 4548
209 Ga0157371_10050388 3300013102 Bacteria 2959
210 Ga0157371_10122299 3300013102 Bacteria 1851
211 Ga0157371_10133419 3300013102 Unclassified 1767
212 Ga0157370_10016993 3300013104 Bacteria 7353
213 Ga0157370_10022730 3300013104 Bacteria 6240
214 Ga0157370_10029233 3300013104 Bacteria 5413
215 Ga0157370_10036309 3300013104 Bacteria 4784
216 Ga0157370_10046619 3300013104 Bacteria 4156
217 Ga0157370_10171308 3300013104 Bacteria 2018
218 Ga0157369_10039305 3300013105 Bacteria 5170
219 Ga0157369_10046305 3300013105 Bacteria 4727
220 Ga0157369_10153856 3300013105 Bacteria 2430
221 Ga0157369_10241746 3300013105 Unclassified 1886
222 Ga0157369_10331503 3300013105 Bacteria 1581
223 Ga0157369_10382188 3300013105 Bacteria 1461
224 Ga0157374_10004774 3300013296 Bacteria 11366
225 Ga0157374_10024050 3300013296 Bacteria 5457
226 Ga0157374_10057816 3300013296 Bacteria 3623
227 Ga0157374_10189056 3300013296 Unclassified 2014
228 Ga0157374_10190432 3300013296 Unclassified 2007
229 Ga0157378_10007867 3300013297 Bacteria 9302
230 Ga0157378_10087846 3300013297 Bacteria 2820
231 Ga0157378_10196955 3300013297 Bacteria 1903
232 Ga0163162_10019694 3300013306 Bacteria 6623
233 Ga0163162_10025893 3300013306 Bacteria 5797
234 Ga0157372_10001798 3300013307 Bacteria 23289
235 Ga0157372_10012759 3300013307 Bacteria 8952
236 Ga0157372_10099622 3300013307 Unclassified 3315
237 Ga0157372_10127037 3300013307 Bacteria 2932
238 Ga0157375_10079570 3300013308 Bacteria 3314
239 Ga0163163_10013953 3300014325 Bacteria 7373
240 Ga0157380_10270944 3300014326 Bacteria 1548
241 Ga0157377_10021857 3300014745 Bacteria 3370
242 Ga0157379_10041194 3300014968 Bacteria 4123
243 Ga0157376_10597595 3300014969 Bacteria 1098
244 Ga0207697_10002640 3300025315 Bacteria 9180
245 Ga0207697_10012516 3300025315 Unclassified 3556
246 Ga0207656_10022167 3300025321 Bacteria 2546
247 Ga0207682_10005198 3300025893 Bacteria 5327
248 Ga0207682_10055157 3300025893 Bacteria 1652
249 Ga0207642_10079044 3300025899 Bacteria 1591
250 Ga0207688_10002725 3300025901 Bacteria 9558
251 Ga0207680_10000843 3300025903 Bacteria 14479
252 Ga0207647_10000652 3300025904 Bacteria 27131
253 Ga0207647_10000953 3300025904 Bacteria 22378
254 Ga0207647_10003821 3300025904 Bacteria 11264
255 Ga0207647_10008914 3300025904 Bacteria 7154
256 Ga0207645_10049594 3300025907 Bacteria 2680
257 Ga0207645_10051291 3300025907 Unclassified 2636
258 Ga0207705_10002169 3300025909 Bacteria 15185
259 Ga0207705_10002376 3300025909 Bacteria 14545
260 Ga0207705_10004357 3300025909 Bacteria 10702
261 Ga0207705_10013606 3300025909 Bacteria 5873
262 Ga0207705_10016676 3300025909 Bacteria 5261
263 Ga0207705_10025714 3300025909 Unclassified 4200
264 Ga0207705_10056195 3300025909 Unclassified 2838
265 Ga0207705_10456429 3300025909 Unclassified 991
266 Ga0207654_10094706 3300025911 Bacteria 1828
267 Ga0207707_10114224 3300025912 Bacteria 2360
268 Ga0207707_10147685 3300025912 Bacteria 2055
269 Ga0207695_10084758 3300025913 Bacteria 3199
270 Ga0207671_10120071 3300025914 Bacteria 2009
271 Ga0207660_10018117 3300025917 Bacteria 4690
272 Ga0207660_10024656 3300025917 Bacteria 4074
273 Ga0207660_10049838 3300025917 Bacteria 2971
274 Ga0207662_10006219 3300025918 Bacteria 6429
275 Ga0207657_10004145 3300025919 Bacteria 15365
276 Ga0207657_10007353 3300025919 Bacteria 11299
277 Ga0207657_10007984 3300025919 Bacteria 10789
278 Ga0207657_10012093 3300025919 Bacteria 8529
279 Ga0207657_10017538 3300025919 Bacteria 6860
280 Ga0207657_10019117 3300025919 Bacteria 6516
281 Ga0207657_10022416 3300025919 Bacteria 5909
282 Ga0207657_10032686 3300025919 Unclassified 4697
283 Ga0207657_10041650 3300025919 Unclassified 4059
284 Ga0207657_10050002 3300025919 Bacteria 3640
285 Ga0207657_10068226 3300025919 Bacteria 3021
286 Ga0207657_10281897 3300025919 Bacteria 1319
287 Ga0207649_10012070 3300025920 Bacteria 4780
288 Ga0207649_10016180 3300025920 Unclassified 4201
289 Ga0207652_10010377 3300025921 Bacteria 7500
290 Ga0207652_10036935 3300025921 Bacteria 4132
291 Ga0207652_10041801 3300025921 Bacteria 3899
292 Ga0207694_10030974 3300025924 Bacteria 4085
293 Ga0207650_10005099 3300025925 Bacteria 8967
294 Ga0207650_10018530 3300025925 Unclassified 4885
295 Ga0207650_10029377 3300025925 Bacteria 3952
296 Ga0207650_10185990 3300025925 Bacteria 1657
297 Ga0207650_10188086 3300025925 Unclassified 1648
298 Ga0207659_10032465 3300025926 Unclassified 3584
299 Ga0207687_10036959 3300025927 Unclassified 3329
300 Ga0207687_10062642 3300025927 Bacteria 2631
301 Ga0207700_10218953 3300025928 Bacteria 1613
302 Ga0207644_10000110 3300025931 Bacteria 60867
303 Ga0207644_10002394 3300025931 Bacteria 12090
304 Ga0207644_10002765 3300025931 Bacteria 11299
305 Ga0207690_10002722 3300025932 Bacteria 10672
306 Ga0207690_10003887 3300025932 Bacteria 8831
307 Ga0207690_10004350 3300025932 Bacteria 8367
308 Ga0207690_10016417 3300025932 Bacteria 4503
309 Ga0207690_10031066 3300025932 Bacteria 3414
310 Ga0207690_10041536 3300025932 Unclassified 3014
311 Ga0207706_10005674 3300025933 Bacteria 11630
312 Ga0207706_10009871 3300025933 Bacteria 8758
313 Ga0207706_10011549 3300025933 Bacteria 8042
314 Ga0207706_10012365 3300025933 Bacteria 7777
315 Ga0207706_10016645 3300025933 Bacteria 6635
316 Ga0207706_10019367 3300025933 Bacteria 6121
317 Ga0207706_10024053 3300025933 Bacteria 5464
318 Ga0207706_10160027 3300025933 Bacteria 1979
319 Ga0207706_10430876 3300025933 Unclassified 1142
320 Ga0207709_10029567 3300025935 Bacteria 3179
321 Ga0207709_10079706 3300025935 Bacteria 2106
322 Ga0207670_10095048 3300025936 Bacteria 2116
323 Ga0207669_10038283 3300025937 Bacteria 2760
324 Ga0207669_10095992 3300025937 Bacteria 1945
325 Ga0207704_10024627 3300025938 Unclassified 3268
326 Ga0207704_10037485 3300025938 Bacteria 2801
327 Ga0207704_10098917 3300025938 Bacteria 1939
328 Ga0207691_10022416 3300025940 Bacteria 5956
329 Ga0207691_10046178 3300025940 Bacteria 4004
330 Ga0207711_10001548 3300025941 Bacteria 21289
331 Ga0207711_10001690 3300025941 Bacteria 20318
332 Ga0207711_10014822 3300025941 Bacteria 6477
333 Ga0207711_10042595 3300025941 Unclassified 3868
334 Ga0207711_10495616 3300025941 Bacteria 1138
335 Ga0207661_10001486 3300025944 Bacteria 15865
336 Ga0207661_10055571 3300025944 Bacteria 3176
337 Ga0207661_10147191 3300025944 Bacteria 2033
338 Ga0207679_10004156 3300025945 Bacteria 8994
339 Ga0207679_10018211 3300025945 Bacteria 4701
340 Ga0207679_10024893 3300025945 Bacteria 4109
341 Ga0207679_10038329 3300025945 Unclassified 3414
342 Ga0207679_10040138 3300025945 Bacteria 3348
343 Ga0207679_10065791 3300025945 Bacteria 2714
344 Ga0207679_10517418 3300025945 Bacteria 1067
345 Ga0207667_10004629 3300025949 Bacteria 16877
346 Ga0207667_10005521 3300025949 Bacteria 15429
347 Ga0207667_10012704 3300025949 Bacteria 9677
348 Ga0207667_10030071 3300025949 Bacteria 5880
349 Ga0207667_10034059 3300025949 Bacteria 5472
350 Ga0207667_10049572 3300025949 Unclassified 4434
351 Ga0207667_10355521 3300025949 Unclassified 1494
352 Ga0207667_10373706 3300025949 Unclassified 1453
353 Ga0207651_10002266 3300025960 Bacteria 9135
354 Ga0207651_10035123 3300025960 Unclassified 3255
355 Ga0207651_10052024 3300025960 Bacteria 2790
356 Ga0207651_10089386 3300025960 Bacteria 2248
357 Ga0207651_10529089 3300025960 Unclassified 1022
358 Ga0207668_10291584 3300025972 Unclassified 1343
359 Ga0207640_10015813 3300025981 Bacteria 4376
360 Ga0207640_10018770 3300025981 Bacteria 4070
361 Ga0207640_10051287 3300025981 Bacteria 2681
362 Ga0207640_10091898 3300025981 Bacteria 2104
363 Ga0207640_10113589 3300025981 Bacteria 1925
364 Ga0207658_10002182 3300025986 Bacteria 14559
365 Ga0207658_10181659 3300025986 Bacteria 1741
366 Ga0207677_10022272 3300026023 Bacteria 3891
367 Ga0207677_10099784 3300026023 Bacteria 2133
368 Ga0207677_10189748 3300026023 Bacteria 1624
369 Ga0207703_10003041 3300026035 Bacteria 14194
370 Ga0207703_10007067 3300026035 Bacteria 8933
371 Ga0207703_10033366 3300026035 Bacteria 4080
372 Ga0207703_10106774 3300026035 Bacteria 2382
373 Ga0207703_10126345 3300026035 Bacteria 2202
374 Ga0207639_10015848 3300026041 Bacteria 5322
375 Ga0207639_10031210 3300026041 Bacteria 3914
376 Ga0207639_10161153 3300026041 Bacteria 1890
377 Ga0207639_10227651 3300026041 Bacteria 1614
378 Ga0207639_10244285 3300026041 Bacteria 1563
379 Ga0207639_10364750 3300026041 Unclassified 1293
380 Ga0207678_10003264 3300026067 Bacteria 14641
381 Ga0207678_10007049 3300026067 Bacteria 9982
382 Ga0207678_10007874 3300026067 Bacteria 9399
383 Ga0207678_10013246 3300026067 Bacteria 7237
384 Ga0207678_10043699 3300026067 Bacteria 3876
385 Ga0207678_10043857 3300026067 Bacteria 3869
386 Ga0207678_10117245 3300026067 Bacteria 2272
387 Ga0207678_10121484 3300026067 Unclassified 2229
388 Ga0207678_10403359 3300026067 Bacteria 1184
389 Ga0207702_10005931 3300026078 Bacteria 10614
390 Ga0207702_10018054 3300026078 Bacteria 5837
391 Ga0207702_10019425 3300026078 Bacteria 5622
392 Ga0207702_10028283 3300026078 Unclassified 4659
393 Ga0207702_10144695 3300026078 Bacteria 2156
394 Ga0207702_10308781 3300026078 Bacteria 1503
395 Ga0207641_10237086 3300026088 Bacteria 1698
396 Ga0207641_10353793 3300026088 Bacteria 1400
397 Ga0207648_10009677 3300026089 Bacteria 9220
398 Ga0207648_10057555 3300026089 Unclassified 3391
399 Ga0207648_10226246 3300026089 Unclassified 1663
400 Ga0207676_10007954 3300026095 Bacteria 7539
401 Ga0207676_10029636 3300026095 Unclassified 4100
402 Ga0207676_10040165 3300026095 Unclassified 3584
403 Ga0207676_10152241 3300026095 Bacteria 1993
404 Ga0207676_10176577 3300026095 Bacteria 1866
405 Ga0207674_10002992 3300026116 Bacteria 20959
406 Ga0207674_10007460 3300026116 Bacteria 12748
407 Ga0207674_10064830 3300026116 Bacteria 3684
408 Ga0207674_10372350 3300026116 Unclassified 1380
409 Ga0207675_100285967 3300026118 Bacteria 1603
410 Ga0207683_10001954 3300026121 Bacteria 18251
411 Ga0207683_10002536 3300026121 Bacteria 15941
412 Ga0207683_10007409 3300026121 Bacteria 9410
413 Ga0207683_10014754 3300026121 Bacteria 6651
414 Ga0207683_10021162 3300026121 Bacteria 5567
415 Ga0207683_10046428 3300026121 Unclassified 3801
416 Ga0207683_10366424 3300026121 Bacteria 1323
417 Ga0207698_10004870 3300026142 Bacteria 8229
418 Ga0207698_10007906 3300026142 Bacteria 6697
419 Ga0207698_10007964 3300026142 Bacteria 6676
420 Ga0207698_10009963 3300026142 Bacteria 6080
421 Ga0207698_10041418 3300026142 Unclassified 3432
422 Ga0207698_10041562 3300026142 Bacteria 3427
423 Ga0209974_10006955 3300027876 Bacteria 3917
424 Ga0268266_10151613 3300028379 Unclassified 2090
425 Ga0268264_10033900 3300028381 Bacteria 4197
426 Ga0307408_100005547 3300031548 Bacteria 8429
427 Ga0307408_100327706 3300031548 Bacteria 1292
428 Ga0307408_100338930 3300031548 Bacteria 1272
429 Ga0307405_10009275 3300031731 Bacteria 5036
430 Ga0307405_10025806 3300031731 Bacteria 3379
431 Ga0307405_10194192 3300031731 Bacteria 1468
432 Ga0307413_10016776 3300031824 Bacteria 3795
433 Ga0307413_10022126 3300031824 Unclassified 3419
434 Ga0307413_10134100 3300031824 Bacteria 1700
435 Ga0307410_10001568 3300031852 Bacteria 10450
436 Ga0307410_10011884 3300031852 Bacteria 5004
437 Ga0307410_10025365 3300031852 Bacteria 3719
438 Ga0307410_10044385 3300031852 Bacteria 2952
439 Ga0307410_10107389 3300031852 Unclassified 2013
440 Ga0307410_10135057 3300031852 Bacteria 1817
441 Ga0307410_10221400 3300031852 Bacteria 1456
442 Ga0307406_10021903 3300031901 Bacteria 3786
443 Ga0307406_10253080 3300031901 Unclassified 1328
444 Ga0307407_10002341 3300031903 Bacteria 7377
445 Ga0307407_10003187 3300031903 Bacteria 6651
446 Ga0307407_10039684 3300031903 Bacteria 2620
447 Ga0307407_10044156 3300031903 Unclassified 2510
448 Ga0307412_10008883 3300031911 Bacteria 5756
449 Ga0307412_10078927 3300031911 Bacteria 2269
450 Ga0307412_10503145 3300031911 Bacteria 1009
451 Ga0307409_100004859 3300031995 Bacteria 7636
452 Ga0307409_100016188 3300031995 Bacteria 4925
453 Ga0307409_100090730 3300031995 Bacteria 2502
454 Ga0307409_100094876 3300031995 Unclassified 2456
455 Ga0307409_100340279 3300031995 Unclassified 1411
456 Ga0307416_100005056 3300032002 Bacteria 8040
457 Ga0307416_100008626 3300032002 Bacteria 6597
458 Ga0307416_100009112 3300032002 Bacteria 6468
459 Ga0307416_100045698 3300032002 Bacteria 3450
460 Ga0307416_100120419 3300032002 Bacteria 2337
461 Ga0307416_100156477 3300032002 Unclassified 2099
462 Ga0307416_100333793 3300032002 Bacteria 1525
463 Ga0307416_100376452 3300032002 Bacteria 1448
464 Ga0307414_10067216 3300032004 Bacteria 2566
465 Ga0307414_10256969 3300032004 Bacteria 1455
466 Ga0307411_10005225 3300032005 Bacteria 6356
467 Ga0307411_10089422 3300032005 Bacteria 2145
468 Ga0307411_10212933 3300032005 Bacteria 1493
469 Ga0307415_100006068 3300032126 Bacteria 6479
470 Ga0307415_100008308 3300032126 Bacteria 5746
471 Ga0307415_100009449 3300032126 Bacteria 5467
472 Ga0307415_100012346 3300032126 Bacteria 4936
473 Ga0307415_100093343 3300032126 Bacteria 2185
474 Ga0307415_100220462 3300032126 Unclassified 1520
475 Ga0307415_100392879 3300032126 Bacteria 1181
476 Ga0373944_0053782 3300035089 Bacteria 1275
477 Ga0373936_0101903 3300035113 Unclassified 1212
478 Ga0373946_0034029 3300035171 Bacteria 2055
479 Ga0373942_0099473 3300035207 Unclassified 887
480 Ga0373935_0032159 3300035692 Bacteria 3259
481 Ga0373935_0489169 3300035692 Unclassified 892
482 Ga0373927_0055888 3300035695 Unclassified 2552
483 Ga0373947_0028006 3300035725 Unclassified 3300
484 Ga0395899_0000274 3300037312 Bacteria 67210
485 Ga0395899_0002261 3300037312 Bacteria 15752
486 Ga0395899_0002381 3300037312 Bacteria 15277
487 Ga0395899_0014700 3300037312 Bacteria 5973
488 Ga0395899_0018865 3300037312 Bacteria 5242
489 Ga0395899_0022844 3300037312 Unclassified 4739
490 Ga0395899_0054314 3300037312 Bacteria 2964
491 Ga0395899_0063719 3300037312 Plasmid 2711
492 Ga0395899_0076441 3300037312 Bacteria 2444
493 Ga0395899_0079007 3300037312 Unclassified 2397
494 Ga0395899_0121974 3300037312 Unclassified 1866
495 Ga0395899_0178710 3300037312 Bacteria 1491
496 Ga0395900_0000595 3300037418 Bacteria 49632
497 Ga0395900_0004150 3300037418 Bacteria 15419
498 Ga0395900_0009492 3300037418 Bacteria 9975
499 Ga0395900_0012141 3300037418 Bacteria 8801
500 Ga0395900_0012170 3300037418 Bacteria 8795
501 Ga0395900_0019526 3300037418 Bacteria 6909
502 Ga0395900_0021697 3300037418 Bacteria 6566
503 Ga0395900_0032009 3300037418 Bacteria 5406
504 Ga0395900_0046219 3300037418 Unclassified 4483
505 Ga0395900_0051312 3300037418 Bacteria 4249
506 Ga0395900_0061474 3300037418 Unclassified 3861
507 Ga0395900_0069021 3300037418 Unclassified 3632
508 Ga0395900_0069099 3300037418 Bacteria 3630
509 Ga0395900_0071637 3300037418 Bacteria 3563
510 Ga0395900_0071825 3300037418 Unclassified 3558
511 Ga0395900_0077681 3300037418 Bacteria 3411
512 Ga0395900_0104664 3300037418 Bacteria 2907
513 Ga0395900_0118437 3300037418 Bacteria 2717
514 Ga0395900_0134935 3300037418 Bacteria 2528
515 Ga0395900_0218484 3300037418 Bacteria 1922
516 Ga0395900_0398302 3300037418 Bacteria 1341
517 Ga0395900_0644059 3300037418 Bacteria 997
518 Ga0395898_0000087 3300037466 Bacteria 239211
519 Ga0395898_0005114 3300037466 Bacteria 14209
520 Ga0395898_0006829 3300037466 Bacteria 12138
521 Ga0395898_0017203 3300037466 Bacteria 7384
522 Ga0395898_0017744 3300037466 Bacteria 7263
523 Ga0395898_0020380 3300037466 Bacteria 6733
524 Ga0395898_0026720 3300037466 Bacteria 5802
525 Ga0395898_0028182 3300037466 Bacteria 5632
526 Ga0395898_0034810 3300037466 Bacteria 5013
527 Ga0395898_0062738 3300037466 Bacteria 3608
528 Ga0395898_0075296 3300037466 Bacteria 3260
529 Ga0395898_0075325 3300037466 Bacteria 3260
530 Ga0395898_0083421 3300037466 Bacteria 3080
531 Ga0395898_0183832 3300037466 Unclassified 1997
532 Ga0395898_0188432 3300037466 Bacteria 1971
533 Ga0395898_0194480 3300037466 Bacteria 1938
534 Ga0395898_0276216 3300037466 Bacteria 1602
535 Ga0395898_0302589 3300037466 Unclassified 1525
536 Ga0395898_0693811 3300037466 Bacteria 960
537 Ga0395905_0000005 3300037471 Bacteria 557808
538 Ga0395905_0000575 3300037471 Bacteria 49664
539 Ga0395905_0002328 3300037471 Bacteria 21216
540 Ga0395905_0003746 3300037471 Bacteria 16115
541 Ga0395905_0010720 3300037471 Bacteria 8889
542 Ga0395905_0010952 3300037471 Bacteria 8777
543 Ga0395905_0011179 3300037471 Bacteria 8679
544 Ga0395905_0031595 3300037471 Unclassified 4984
545 Ga0395905_0034430 3300037471 Unclassified 4756
546 Ga0395905_0036398 3300037471 Bacteria 4622
547 Ga0395905_0055083 3300037471 Bacteria 3722
548 Ga0395905_0055245 3300037471 Unclassified 3716
549 Ga0395905_0064924 3300037471 Bacteria 3417
550 Ga0395905_0129395 3300037471 Bacteria 2374
551 Ga0395905_0384037 3300037471 Bacteria 1298
552 Ga0395905_0449448 3300037471 Unclassified 1186
553 Ga0395901_0001391 3300038443 Bacteria 25281
554 Ga0395901_0003881 3300038443 Bacteria 15029
555 Ga0395901_0005012 3300038443 Bacteria 13368
556 Ga0395901_0005682 3300038443 Bacteria 12622
557 Ga0395901_0008570 3300038443 Bacteria 10334
558 Ga0395901_0012026 3300038443 Bacteria 8780
559 Ga0395901_0012920 3300038443 Bacteria 8471
560 Ga0395901_0014443 3300038443 Bacteria 8036
561 Ga0395901_0025281 3300038443 Bacteria 6096
562 Ga0395901_0031335 3300038443 Bacteria 5483
563 Ga0395901_0034344 3300038443 Bacteria 5237
564 Ga0395901_0034381 3300038443 Bacteria 5234
565 Ga0395901_0037861 3300038443 Unclassified 4987
566 Ga0395901_0054510 3300038443 Bacteria 4155
567 Ga0395901_0062179 3300038443 Bacteria 3886
568 Ga0395901_0116974 3300038443 Unclassified 2801
569 Ga0395901_0234193 3300038443 Bacteria 1917
570 Ga0395901_0263807 3300038443 Bacteria 1792
571 Ga0395901_0533840 3300038443 Unclassified 1190
572 Ga0395901_0661226 3300038443 Unclassified 1047
573 Ga0395901_0681624 3300038443 Bacteria 1027
574 Ga0395901_0727510 3300038443 Unclassified 987
575 Ga0395901_0775431 3300038443 Unclassified 950
576 Ga0439465_0067437 3300041413 Unclassified 1194
577 Ga0439448_0003296 3300042005 Bacteria 4464
578 Ga0439432_049016 3300042006 Unclassified 1321
579 Ga0439449_0028212 3300042007 Bacteria 2092
580 Ga0439449_0079138 3300042007 Unclassified 1212
581 Ga0439458_0000082 3300042157 Bacteria 17715
582 Ga0439458_0001374 3300042157 Bacteria 6143
583 Ga0439458_0062620 3300042157 Unclassified 930
584 Ga0466972_0006850 3300044658 Bacteria 5718
585 Ga0466966_0020728 3300044684 Unclassified 4320
586 Ga0466961_0017556 3300044693 Bacteria 4598
587 Ga0466961_0099838 3300044693 Bacteria 1829
588 Ga0466963_0030074 3300044694 Unclassified 3501
589 Ga0466963_0182209 3300044694 Bacteria 1466
590 Ga0466963_0194069 3300044694 Unclassified 1419
591 Ga0466963_0213265 3300044694 Unclassified 1351
592 Ga0466971_0012442 3300044719 Bacteria 3730
593 Ga0466968_0016409 3300044735 Bacteria 2949
594 Ga0466970_0005298 3300044765 Bacteria 6393
595 Ga0466970_0009215 3300044765 Unclassified 4981
596 Ga0466957_0019065 3300044842 Unclassified 4034
597 Ga0466957_0147359 3300044842 Bacteria 1520
598 Ga0466959_0022708 3300045049 Bacteria 4639
599 Ga0466959_0039781 3300045049 Bacteria 3475
600 Ga0466959_0124206 3300045049 Bacteria 1833
601 Ga0466959_0222757 3300045049 Bacteria 1308
602 Ga0466958_0014628 3300045836 Bacteria 4480
603 Ga0466958_0051943 3300045836 Bacteria 2483
604 Ga0466967_0064179 3300045976 Unclassified 3265
605 Ga0466967_0132311 3300045976 Bacteria 2317
606 Ga0466967_0740138 3300045976 Unclassified 975
607 Ga0495621_0040659 3300046539 Bacteria 1630
608 Ga0495669_0000706 3300046684 Bacteria 14559
609 Ga0495677_0024815 3300047445 Bacteria 2175
610 Ga0496100_0001297 3300048903 Bacteria 12196
611 Ga0496100_0197425 3300048903 Bacteria 1464
612 Ga0496101_0010923 3300048904 Bacteria 6010
613 Ga0496101_0023068 3300048904 Bacteria 4294
614 Ga0496102_0000034 3300048905 Bacteria 213826
615 Ga0496102_0013872 3300048905 Bacteria 6992
616 Ga0496103_0000026 3300048906 Bacteria 213826
617 Ga0496106_0020047 3300048909 Bacteria 4959
618 Ga0496107_0007959 3300048910 Bacteria 7315
619 Ga0496108_0028497 3300048911 Unclassified 4621
620 Ga0496108_0058796 3300048911 Unclassified 3232
621 Ga0496108_0385257 3300048911 Unclassified 1224
622 Ga0496109_0037881 3300048912 Bacteria 4358
623 Ga0496110_0001671 3300048913 Bacteria 16272
624 Ga0496110_0038741 3300048913 Unclassified 4149
625 Ga0496111_0051863 3300048914 Bacteria 2962
626 Ga0496111_0127902 3300048914 Bacteria 1879
627 Ga0496111_0149125 3300048914 Bacteria 1734
628 Ga0496112_0021369 3300048915 Bacteria 6154
629 Ga0496112_0065076 3300048915 Unclassified 3598
630 Ga0496112_0068258 3300048915 Bacteria 3510
631 Ga0496112_0076194 3300048915 Unclassified 3317
632 Ga0496112_0823160 3300048915 Unclassified 853
633 Ga0496113_0216223 3300048916 Bacteria 1527
634 Ga0496114_0000006 3300048917 Bacteria 472921
635 Ga0496114_0417988 3300048917 Bacteria 1187
636 Ga0496115_0040388 3300048918 Unclassified 3709
637 Ga0496116_0002824 3300048919 Bacteria 17816
638 Ga0496117_0000072 3300048920 Bacteria 238366
639 Ga0496118_0000030 3300048921 Bacteria 339946
640 Ga0496119_0019112 3300048922 Bacteria 5063
641 Ga0496124_0000061 3300048927 Bacteria 238225
642 Ga0501067_0047710 3300049583 Unclassified 2376
643 Ga0501223_032002 3300049663 Bacteria 1023
644 Ga0500596_006076 3300053735 Bacteria 2072
645 Ga0466962_0327769 3300061719 Bacteria 760
646 Ga0070685_10066735
647 JGI24741J21665_1001705
648 JGI24746J21847_1002900
649 JGI24747J21853_1000278
650 JGI24740J21852_10002403
651 JGI24740J21852_10002753
652 JGI24740J21852_10004394
653 JGI24740J21852_10018053
654 JGI24739J22299_10011726
655 JGI24739J22299_10023339
656 JGI24737J22298_10004284
657 JGI24737J22298_10005369
658 JGI24737J22298_10009839
659 JGI24743J22301_10001141
660 JGI24735J21928_10002010
661 rootL2_10076522
662 rootL2_10255690
663 Ga0070658_10007081
664 Ga0070658_10017983
665 Ga0070658_10025215
666 Ga0070658_10027650
667 Ga0070658_10036091
668 Ga0070658_10065318
669 Ga0070658_10158273
670 Ga0070658_10318784
671 Ga0070676_10241537
672 Ga0070683_100002629
673 Ga0070683_100016104
674 Ga0070683_100020068
675 Ga0070683_100058817
676 Ga0070690_100005963
677 Ga0070670_100001961
678 Ga0070670_100013946
679 Ga0070670_100232277
680 Ga0070677_10002714
681 Ga0070677_10009099
682 Ga0070666_10001302
683 Ga0070680_100020196
684 Ga0070680_100035425
685 Ga0070682_100052764
686 Ga0068868_100003463
687 Ga0070660_100003869
688 Ga0070660_100006193
689 Ga0070660_100007812
690 Ga0070660_100011819
691 Ga0070660_100019162
692 Ga0070660_100029227
693 Ga0070660_100030635
694 Ga0070660_100040329
695 Ga0070660_100151039
696 Ga0070660_100234180
697 Ga0070660_100320096
698 Ga0070661_100002823
699 Ga0070661_100005291
700 Ga0070661_100121077
701 Ga0070661_100193788
702 Ga0070661_100248664
703 Ga0070661_100284555
704 Ga0070692_10190739
705 Ga0070668_100017861
706 Ga0070675_100002093
707 Ga0070671_100000585
708 Ga0070671_100001443
709 Ga0070671_100052023
710 Ga0070671_100073674
711 Ga0070671_100149751
712 Ga0070674_100074103
713 Ga0070673_100002199
714 Ga0070673_100036649
715 Ga0070659_100005596
716 Ga0070659_100012286
717 Ga0070659_100012487
718 Ga0070659_100021733
719 Ga0070659_100047513
720 Ga0070659_100047592
721 Ga0070659_100089334
722 Ga0070659_100179185
723 Ga0070659_100240048
724 Ga0070667_100011143
725 Ga0070667_100083851
726 Ga0070714_100002190
727 Ga0070714_100108604
728 Ga0070713_100034413
729 Ga0070663_100013674
730 Ga0070663_100030458
731 Ga0070663_100086575
732 Ga0070663_100126200
733 Ga0070678_100003931
734 Ga0070678_100011216
735 Ga0070678_100061154
736 Ga0070662_100012833
737 Ga0070662_100017163
738 Ga0070662_100017466
739 Ga0070662_100036289
740 Ga0070662_100046932
741 Ga0070662_100108917
742 Ga0070662_100146239
743 Ga0070681_10291746
744 Ga0068867_100024122
745 Ga0068867_100080759
746 Ga0070679_100041297
747 Ga0070679_100042382
748 Ga0070679_100071472
749 Ga0070679_100150141
750 Ga0070679_100600455
751 Ga0070684_100004092
752 Ga0070684_100010106
753 Ga0068853_100027959
754 Ga0068853_100038172
755 Ga0068853_100046247
756 Ga0068853_100053206
757 Ga0068853_100109467
758 Ga0068853_100142984
759 Ga0068853_100336641
760 Ga0068853_100438785
761 Ga0070672_100025465
762 Ga0070672_100193695
763 Ga0070672_100348357
764 Ga0070672_100383460
765 Ga0070686_100028862
766 Ga0070665_100001865
767 Ga0070665_100270851
768 Ga0068855_100005824
769 Ga0068855_100006659
770 Ga0068855_100014977
771 Ga0068855_100017060
772 Ga0068855_100019199
773 Ga0068855_100270487
774 Ga0068855_100370127
775 Ga0068855_100469207
776 Ga0070664_100003503
777 Ga0070664_100011435
778 Ga0070664_100012603
779 Ga0070664_100020715
780 Ga0070664_100025357
781 Ga0070664_100040030
782 Ga0070664_100072273
783 Ga0070664_100097703
784 Ga0070664_100110280
785 Ga0070664_100114134
786 Ga0068857_100005367
787 Ga0068857_100099622
788 Ga0068857_100106965
789 Ga0068857_100429641
790 Ga0068857_100432399
791 Ga0068854_100005714
792 Ga0068854_100011868
793 Ga0068854_100012828
794 Ga0068854_100060143
795 Ga0068854_100105079
796 Ga0068856_100010684
797 Ga0068856_100023749
798 Ga0068856_100069827
799 Ga0068856_100159956
800 Ga0068856_100182437
801 Ga0068856_100260945
802 Ga0068852_100007810
803 Ga0068852_100008650
804 Ga0068852_100014915
805 Ga0068852_100055678
806 Ga0068852_100059663
807 Ga0068852_100684409
808 Ga0068859_100088396
809 Ga0068859_100092915
810 Ga0068864_100014870
811 Ga0068864_100048368
812 Ga0068864_100122717
813 Ga0068864_100237266
814 Ga0068861_100516412
815 Ga0068851_10008666
816 Ga0068863_100189002
817 Ga0081539_10025332
818 Ga0097621_100013198
819 Ga0097621_100039548
820 Ga0097621_100065607
821 Ga0068871_100268207
822 Ga0068865_100009762
823 Ga0068865_100010945
824 Ga0068865_100033275
825 Ga0097620_100088398
826 Ga0097620_100092912
827 Ga0105240_10045600
828 Ga0105245_10006582
829 Ga0105245_10020739
830 Ga0105245_10026618
831 Ga0105243_10069887
832 Ga0105241_10153708
833 Ga0105248_10000864
834 Ga0105248_10001731
835 Ga0105248_10021840
836 Ga0105248_10030620
837 Ga0105248_10082992
838 Ga0105248_10083073
839 Ga0105248_10194817
840 Ga0105248_10365461
841 Ga0105237_10042170
842 Ga0105238_10013299
843 Ga0105238_10257308
844 Ga0105246_10019720
845 Ga0105246_10086945
846 Ga0105246_10398662
847 Ga0157373_10004072
848 Ga0157373_10008312
849 Ga0157373_10032853
850 Ga0157373_10042421
851 Ga0157371_10008598
852 Ga0157371_10021331
853 Ga0157371_10023109
854 Ga0157371_10050388
855 Ga0157371_10122299
856 Ga0157371_10133419
857 Ga0157370_10016993
858 Ga0157370_10022730
859 Ga0157370_10029233
860 Ga0157370_10036309
861 Ga0157370_10046619
862 Ga0157370_10171308
863 Ga0157369_10039305
864 Ga0157369_10046305
865 Ga0157369_10153856
866 Ga0157369_10241746
867 Ga0157369_10331503
868 Ga0157369_10382188
869 Ga0157374_10004774
870 Ga0157374_10024050
871 Ga0157374_10057816
872 Ga0157374_10189056
873 Ga0157374_10190432
874 Ga0157378_10007867
875 Ga0157378_10087846
876 Ga0157378_10196955
877 Ga0163162_10019694
878 Ga0163162_10025893
879 Ga0157372_10001798
880 Ga0157372_10012759
881 Ga0157372_10099622
882 Ga0157372_10127037
883 Ga0157375_10079570
884 Ga0163163_10013953
885 Ga0157380_10270944
886 Ga0157377_10021857
887 Ga0157379_10041194
888 Ga0157376_10597595
889 Ga0207697_10002640
890 Ga0207697_10012516
891 Ga0207656_10022167
892 Ga0207682_10005198
893 Ga0207682_10055157
894 Ga0207642_10079044
895 Ga0207688_10002725
896 Ga0207680_10000843
897 Ga0207647_10000652
898 Ga0207647_10000953
899 Ga0207647_10003821
900 Ga0207647_10008914
901 Ga0207645_10049594
902 Ga0207645_10051291
903 Ga0207705_10002169
904 Ga0207705_10002376
905 Ga0207705_10004357
906 Ga0207705_10013606
907 Ga0207705_10016676
908 Ga0207705_10025714
909 Ga0207705_10056195
910 Ga0207705_10456429
911 Ga0207654_10094706
912 Ga0207707_10114224
913 Ga0207707_10147685
914 Ga0207695_10084758
915 Ga0207671_10120071
916 Ga0207660_10018117
917 Ga0207660_10024656
918 Ga0207660_10049838
919 Ga0207662_10006219
920 Ga0207657_10004145
921 Ga0207657_10007353
922 Ga0207657_10007984
923 Ga0207657_10012093
924 Ga0207657_10017538
925 Ga0207657_10019117
926 Ga0207657_10022416
927 Ga0207657_10032686
928 Ga0207657_10041650
929 Ga0207657_10050002
930 Ga0207657_10068226
931 Ga0207657_10281897
932 Ga0207649_10012070
933 Ga0207649_10016180
934 Ga0207652_10010377
935 Ga0207652_10036935
936 Ga0207652_10041801
937 Ga0207694_10030974
938 Ga0207650_10005099
939 Ga0207650_10018530
940 Ga0207650_10029377
941 Ga0207650_10185990
942 Ga0207650_10188086
943 Ga0207659_10032465
944 Ga0207687_10036959
945 Ga0207687_10062642
946 Ga0207700_10218953
947 Ga0207644_10000110
948 Ga0207644_10002394
949 Ga0207644_10002765
950 Ga0207690_10002722
951 Ga0207690_10003887
952 Ga0207690_10004350
953 Ga0207690_10016417
954 Ga0207690_10031066
955 Ga0207690_10041536
956 Ga0207706_10005674
957 Ga0207706_10009871
958 Ga0207706_10011549
959 Ga0207706_10012365
960 Ga0207706_10016645
961 Ga0207706_10019367
962 Ga0207706_10024053
963 Ga0207706_10160027
964 Ga0207706_10430876
965 Ga0207709_10029567
966 Ga0207709_10079706
967 Ga0207670_10095048
968 Ga0207669_10038283
969 Ga0207669_10095992
970 Ga0207704_10024627
971 Ga0207704_10037485
972 Ga0207704_10098917
973 Ga0207691_10022416
974 Ga0207691_10046178
975 Ga0207711_10001548
976 Ga0207711_10001690
977 Ga0207711_10014822
978 Ga0207711_10042595
979 Ga0207711_10495616
980 Ga0207661_10001486
981 Ga0207661_10055571
982 Ga0207661_10147191
983 Ga0207679_10004156
984 Ga0207679_10018211
985 Ga0207679_10024893
986 Ga0207679_10038329
987 Ga0207679_10040138
988 Ga0207679_10065791
989 Ga0207679_10517418
990 Ga0207667_10004629
991 Ga0207667_10005521
992 Ga0207667_10012704
993 Ga0207667_10030071
994 Ga0207667_10034059
995 Ga0207667_10049572
996 Ga0207667_10355521
997 Ga0207667_10373706
998 Ga0207651_10002266
999 Ga0207651_10035123
1000 Ga0207651_10052024
1001 Ga0207651_10089386
1002 Ga0207651_10529089
1003 Ga0207668_10291584
1004 Ga0207640_10015813
1005 Ga0207640_10018770
1006 Ga0207640_10051287
1007 Ga0207640_10091898
1008 Ga0207640_10113589
1009 Ga0207658_10002182
1010 Ga0207658_10181659
1011 Ga0207677_10022272
1012 Ga0207677_10099784
1013 Ga0207677_10189748
1014 Ga0207703_10003041
1015 Ga0207703_10007067
1016 Ga0207703_10033366
1017 Ga0207703_10106774
1018 Ga0207703_10126345
1019 Ga0207639_10015848
1020 Ga0207639_10031210
1021 Ga0207639_10161153
1022 Ga0207639_10227651
1023 Ga0207639_10244285
1024 Ga0207639_10364750
1025 Ga0207678_10003264
1026 Ga0207678_10007049
1027 Ga0207678_10007874
1028 Ga0207678_10013246
1029 Ga0207678_10043699
1030 Ga0207678_10043857
1031 Ga0207678_10117245
1032 Ga0207678_10121484
1033 Ga0207678_10403359
1034 Ga0207702_10005931
1035 Ga0207702_10018054
1036 Ga0207702_10019425
1037 Ga0207702_10028283
1038 Ga0207702_10144695
1039 Ga0207702_10308781
1040 Ga0207641_10237086
1041 Ga0207641_10353793
1042 Ga0207648_10009677
1043 Ga0207648_10057555
1044 Ga0207648_10226246
1045 Ga0207676_10007954
1046 Ga0207676_10029636
1047 Ga0207676_10040165
1048 Ga0207676_10152241
1049 Ga0207676_10176577
1050 Ga0207674_10002992
1051 Ga0207674_10007460
1052 Ga0207674_10064830
1053 Ga0207674_10372350
1054 Ga0207675_100285967
1055 Ga0207683_10001954
1056 Ga0207683_10002536
1057 Ga0207683_10007409
1058 Ga0207683_10014754
1059 Ga0207683_10021162
1060 Ga0207683_10046428
1061 Ga0207683_10366424
1062 Ga0207698_10004870
1063 Ga0207698_10007906
1064 Ga0207698_10007964
1065 Ga0207698_10009963
1066 Ga0207698_10041418
1067 Ga0207698_10041562
1068 Ga0209974_10006955
1069 Ga0268266_10151613
1070 Ga0268264_10033900
1071 Ga0307408_100005547
1072 Ga0307408_100327706
1073 Ga0307408_100338930
1074 Ga0307405_10009275
1075 Ga0307405_10025806
1076 Ga0307405_10194192
1077 Ga0307413_10016776
1078 Ga0307413_10022126
1079 Ga0307413_10134100
1080 Ga0307410_10001568
1081 Ga0307410_10011884
1082 Ga0307410_10025365
1083 Ga0307410_10044385
1084 Ga0307410_10107389
1085 Ga0307410_10135057
1086 Ga0307410_10221400
1087 Ga0307406_10021903
1088 Ga0307406_10253080
1089 Ga0307407_10002341
1090 Ga0307407_10003187
1091 Ga0307407_10039684
1092 Ga0307407_10044156
1093 Ga0307412_10008883
1094 Ga0307412_10078927
1095 Ga0307412_10503145
1096 Ga0307409_100004859
1097 Ga0307409_100016188
1098 Ga0307409_100090730
1099 Ga0307409_100094876
1100 Ga0307409_100340279
1101 Ga0307416_100005056
1102 Ga0307416_100008626
1103 Ga0307416_100009112
1104 Ga0307416_100045698
1105 Ga0307416_100120419
1106 Ga0307416_100156477
1107 Ga0307416_100333793
1108 Ga0307416_100376452
1109 Ga0307414_10067216
1110 Ga0307414_10256969
1111 Ga0307411_10005225
1112 Ga0307411_10089422
1113 Ga0307411_10212933
1114 Ga0307415_100006068
1115 Ga0307415_100008308
1116 Ga0307415_100009449
1117 Ga0307415_100012346
1118 Ga0307415_100093343
1119 Ga0307415_100220462
1120 Ga0307415_100392879
1121 Ga0373944_0053782
1122 Ga0373936_0101903
1123 Ga0373946_0034029
1124 Ga0373942_0099473
1125 Ga0373935_0032159
1126 Ga0373935_0489169
1127 Ga0373927_0055888
1128 Ga0373947_0028006
1129 Ga0395899_0000274
1130 Ga0395899_0002261
1131 Ga0395899_0002381
1132 Ga0395899_0014700
1133 Ga0395899_0018865
1134 Ga0395899_0022844
1135 Ga0395899_0054314
1136 Ga0395899_0063719
1137 Ga0395899_0076441
1138 Ga0395899_0079007
1139 Ga0395899_0121974
1140 Ga0395899_0178710
1141 Ga0395900_0000595
1142 Ga0395900_0004150
1143 Ga0395900_0009492
1144 Ga0395900_0012141
1145 Ga0395900_0012170
1146 Ga0395900_0019526
1147 Ga0395900_0021697
1148 Ga0395900_0032009
1149 Ga0395900_0046219
1150 Ga0395900_0051312
1151 Ga0395900_0061474
1152 Ga0395900_0069021
1153 Ga0395900_0069099
1154 Ga0395900_0071637
1155 Ga0395900_0071825
1156 Ga0395900_0077681
1157 Ga0395900_0104664
1158 Ga0395900_0118437
1159 Ga0395900_0134935
1160 Ga0395900_0218484
1161 Ga0395900_0398302
1162 Ga0395900_0644059
1163 Ga0395898_0000087
1164 Ga0395898_0005114
1165 Ga0395898_0006829
1166 Ga0395898_0017203
1167 Ga0395898_0017744
1168 Ga0395898_0020380
1169 Ga0395898_0026720
1170 Ga0395898_0028182
1171 Ga0395898_0034810
1172 Ga0395898_0062738
1173 Ga0395898_0075296
1174 Ga0395898_0075325
1175 Ga0395898_0083421
1176 Ga0395898_0183832
1177 Ga0395898_0188432
1178 Ga0395898_0194480
1179 Ga0395898_0276216
1180 Ga0395898_0302589
1181 Ga0395898_0693811
1182 Ga0395905_0000005
1183 Ga0395905_0000575
1184 Ga0395905_0002328
1185 Ga0395905_0003746
1186 Ga0395905_0010720
1187 Ga0395905_0010952
1188 Ga0395905_0011179
1189 Ga0395905_0031595
1190 Ga0395905_0034430
1191 Ga0395905_0036398
1192 Ga0395905_0055083
1193 Ga0395905_0055245
1194 Ga0395905_0064924
1195 Ga0395905_0129395
1196 Ga0395905_0384037
1197 Ga0395905_0449448
1198 Ga0395901_0001391
1199 Ga0395901_0003881
1200 Ga0395901_0005012
1201 Ga0395901_0005682
1202 Ga0395901_0008570
1203 Ga0395901_0012026
1204 Ga0395901_0012920
1205 Ga0395901_0014443
1206 Ga0395901_0025281
1207 Ga0395901_0031335
1208 Ga0395901_0034344
1209 Ga0395901_0034381
1210 Ga0395901_0037861
1211 Ga0395901_0054510
1212 Ga0395901_0062179
1213 Ga0395901_0116974
1214 Ga0395901_0234193
1215 Ga0395901_0263807
1216 Ga0395901_0533840
1217 Ga0395901_0661226
1218 Ga0395901_0681624
1219 Ga0395901_0727510
1220 Ga0395901_0775431
1221 Ga0439465_0067437
1222 Ga0439448_0003296
1223 Ga0439432_049016
1224 Ga0439449_0028212
1225 Ga0439449_0079138
1226 Ga0439458_0000082
1227 Ga0439458_0001374
1228 Ga0439458_0062620
1229 Ga0466972_0006850
1230 Ga0466966_0020728
1231 Ga0466961_0017556
1232 Ga0466961_0099838
1233 Ga0466963_0030074
1234 Ga0466963_0182209
1235 Ga0466963_0194069
1236 Ga0466963_0213265
1237 Ga0466971_0012442
1238 Ga0466968_0016409
1239 Ga0466970_0005298
1240 Ga0466970_0009215
1241 Ga0466957_0019065
1242 Ga0466957_0147359
1243 Ga0466959_0022708
1244 Ga0466959_0039781
1245 Ga0466959_0124206
1246 Ga0466959_0222757
1247 Ga0466958_0014628
1248 Ga0466958_0051943
1249 Ga0466967_0064179
1250 Ga0466967_0132311
1251 Ga0466967_0740138
1252 Ga0495621_0040659
1253 Ga0495669_0000706
1254 Ga0495677_0024815
1255 Ga0496100_0001297
1256 Ga0496100_0197425
1257 Ga0496101_0010923
1258 Ga0496101_0023068
1259 Ga0496102_0000034
1260 Ga0496102_0013872
1261 Ga0496103_0000026
1262 Ga0496106_0020047
1263 Ga0496107_0007959
1264 Ga0496108_0028497
1265 Ga0496108_0058796
1266 Ga0496108_0385257
1267 Ga0496109_0037881
1268 Ga0496110_0001671
1269 Ga0496110_0038741
1270 Ga0496111_0051863
1271 Ga0496111_0127902
1272 Ga0496111_0149125
1273 Ga0496112_0021369
1274 Ga0496112_0065076
1275 Ga0496112_0068258
1276 Ga0496112_0076194
1277 Ga0496112_0823160
1278 Ga0496113_0216223
1279 Ga0496114_0000006
1280 Ga0496114_0417988
1281 Ga0496115_0040388
1282 Ga0496116_0002824
1283 Ga0496117_0000072
1284 Ga0496118_0000030
1285 Ga0496119_0019112
1286 Ga0496124_0000061
1287 Ga0501067_0047710
1288 Ga0501223_032002
1289 Ga0500596_006076
1290 Ga0466962_0327769

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

78

264

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jmp-assembly1.cif.gz_A crystal structure of the chimerical protein capa2b2 0.8546 8 225
3bfv-assembly2.cif.gz_B crystal structure of the chimerical protein capab 0.8462 9 225
4jlv-assembly1.cif.gz_A crystal structure of the chimerical protein capa1b1 in complex with adp-mg 0.8406 2 225
7nhr-assembly1.cif.gz_G putative transmembrane protein wzc k540m c1 0.8297 9 226
3r9j-assembly1.cif.gz_B-1 4.3a resolution structure of a mind-mine(i24n) protein complex 0.8224 53 227
ID Description Score Start End Superfamily
3bfvB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8462 9 225 3.40.50.300
4rz3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8094 53 225 3.40.50.300
2bekD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7809 52 228 3.40.50.300
af_P9WJC5_418_656_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7788 55 229 3.40.50.300
1hyqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7761 53 227 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A5M6IG04-F1-model_v4 CpsD/CapB family tyrosine-protein kinase 0.9451 7 225 GO:0016301
AF-A0A7C1TF44-F1-model_v4 Exopolysaccharide biosynthesis protein 0.9447 4 225 GO:0004713
GO:0005886
AF-A0A3N2E1Z7-F1-model_v4 Capsular exopolysaccharide synthesis family protein 0.9425 3 225
AF-A0A2D8R8F8-F1-model_v4 non-specific protein-tyrosine kinase (EC 2.7.10.2) 0.9412 7 225 GO:0004713
GO:0005524
GO:0005886
GO:0045226
AF-A0A349S542-F1-model_v4 Exopolysaccharide biosynthesis protein 0.9396 5 225

Map