F472019

General Info

Members Datasets Scaffolds Average Seq Length
644 307 1288 93

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100001068|Ga0070665_1000010682
Length 109
Sequence MAVEVRIPTILRPYTGDQKSVEANGASLSALIDDLESNHPGLKDRLVEAKDGSIDLRRFVNVYVNDEDVRFLGGLEAPVADGDQVVVLPAVAGGARPTTFFASSAPLLR

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
97 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
147 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
148 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
149 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
150 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
151 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
152 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
153 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
175 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
176 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
177 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
178 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
179 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
180 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
181 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
184 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
185 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
192 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
200 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
228 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
255 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
256 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
261 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
262 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
263 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
264 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
265 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
275 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
276 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
277 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
278 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
279 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
280 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
281 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
282 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
285 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
288 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
289 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
290 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
291 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
292 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
293 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
296 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
302 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
303 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
304 2643221615 Nocardioides sp. Root224 Isolate Unclassified
305 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
306 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
307 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.25
Metatranscriptomes 5.12
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.58
Nodule 0.16
Rhizoplane 11.34
Rhizosphere 73.76
Stem 0
Stem Tuber 0
Unclassified 2.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100001068 3300005548 Bacteria 34157
2 LJQas_1003021 3300000549 Bacteria 2280
3 JGI24740J21852_10006331 3300001979 Bacteria 4913
4 JGI24737J22298_10083958 3300001990 Bacteria 947
5 JGI24735J21928_10009661 3300002067 Bacteria 3091
6 JGI24735J21928_10242590 3300002067 Bacteria 525
7 JGI24750J21931_1005025 3300002070 Bacteria 1617
8 Ga0058863_11839952 3300004799 Bacteria 547
9 Ga0058861_12061415 3300004800 Bacteria 765
10 Ga0070658_10070424 3300005327 Bacteria 2863
11 Ga0070658_10490499 3300005327 Bacteria 1060
12 Ga0070658_11715271 3300005327 Bacteria 544
13 Ga0070676_10618598 3300005328 Bacteria 783
14 Ga0070683_100002484 3300005329 Bacteria 14674
15 Ga0070683_100034230 3300005329 Bacteria 4639
16 Ga0070683_100150160 3300005329 Bacteria 2209
17 Ga0070683_101311189 3300005329 Bacteria 696
18 Ga0070677_10847193 3300005333 Bacteria 525
19 Ga0068869_100630588 3300005334 Bacteria 908
20 Ga0070680_101303416 3300005336 Bacteria 628
21 Ga0070682_100005518 3300005337 Bacteria 7041
22 Ga0070682_100064327 3300005337 Bacteria 2328
23 Ga0070682_100141406 3300005337 Bacteria 1641
24 Ga0070682_100326303 3300005337 Bacteria 1136
25 Ga0070660_100012028 3300005339 Bacteria 6176
26 Ga0070660_100091092 3300005339 Bacteria 2405
27 Ga0070660_100919714 3300005339 Bacteria 738
28 Ga0070660_100922623 3300005339 Bacteria 737
29 Ga0070691_10215625 3300005341 Bacteria 1015
30 Ga0070687_100040045 3300005343 Bacteria 2359
31 Ga0070661_100495699 3300005344 Bacteria 977
32 Ga0070692_10045181 3300005345 Bacteria 2271
33 Ga0070668_100517256 3300005347 Bacteria 1035
34 Ga0070668_100537483 3300005347 Bacteria 1016
35 Ga0070668_100551499 3300005347 Bacteria 1003
36 Ga0070675_101586325 3300005354 Bacteria 604
37 Ga0070671_101385660 3300005355 Bacteria 621
38 Ga0070659_100023607 3300005366 Bacteria 4709
39 Ga0070667_100434591 3300005367 Bacteria 1198
40 Ga0070701_11291570 3300005438 Unclassified 521
41 Ga0070705_100225658 3300005440 Bacteria 1300
42 Ga0070705_100826920 3300005440 Bacteria 739
43 Ga0070700_100802390 3300005441 Bacteria 758
44 Ga0070700_101044077 3300005441 Bacteria 674
45 Ga0070678_100924227 3300005456 Bacteria 799
46 Ga0070678_102186446 3300005456 Bacteria 525
47 Ga0070662_100793231 3300005457 Bacteria 805
48 Ga0070681_10063993 3300005458 Bacteria 3650
49 Ga0068867_100712080 3300005459 Bacteria 887
50 Ga0070685_10495768 3300005466 Unclassified 863
51 Ga0070706_100617370 3300005467 Bacteria 1007
52 Ga0070679_100002885 3300005530 Bacteria 15616
53 Ga0070679_100356158 3300005530 Bacteria 1411
54 Ga0070679_100682550 3300005530 Bacteria 970
55 Ga0070684_100005484 3300005535 Bacteria 9720
56 Ga0070684_100092238 3300005535 Bacteria 2695
57 Ga0070684_100241944 3300005535 Bacteria 1649
58 Ga0070684_100484495 3300005535 Bacteria 1145
59 Ga0070684_100577889 3300005535 Bacteria 1044
60 Ga0070684_101926843 3300005535 Bacteria 558
61 Ga0070672_100954562 3300005543 Bacteria 759
62 Ga0070695_100524569 3300005545 Bacteria 919
63 Ga0070696_100095335 3300005546 Bacteria 2125
64 Ga0070696_100845614 3300005546 Bacteria 756
65 Ga0070693_100820306 3300005547 Bacteria 691
66 Ga0070665_100226524 3300005548 Bacteria 1870
67 Ga0070665_100297650 3300005548 Bacteria 1616
68 Ga0070665_101311431 3300005548 Bacteria 734
69 Ga0070704_100474539 3300005549 Bacteria 1081
70 Ga0068855_100835619 3300005563 Bacteria 977
71 Ga0070664_101806859 3300005564 Bacteria 580
72 Ga0068857_100035509 3300005577 Bacteria 4415
73 Ga0068856_100131363 3300005614 Bacteria 2509
74 Ga0070702_101734541 3300005615 Bacteria 520
75 Ga0068852_101550545 3300005616 Bacteria 685
76 Ga0068866_10216015 3300005718 Bacteria 1154
77 Ga0068866_10519814 3300005718 Bacteria 791
78 Ga0068866_11446543 3300005718 Bacteria 504
79 Ga0068861_100182543 3300005719 Bacteria 1748
80 Ga0068861_100628832 3300005719 Bacteria 989
81 Ga0068851_10755279 3300005834 Bacteria 602
82 Ga0068860_100233962 3300005843 Bacteria 1786
83 Ga0068860_100803620 3300005843 Bacteria 954
84 Ga0068862_100106682 3300005844 Bacteria 2456
85 Ga0081539_10045239 3300005985 Bacteria 2534
86 Ga0075365_10008341 3300006038 Bacteria 5874
87 Ga0075365_10014464 3300006038 Bacteria 4749
88 Ga0075365_10050835 3300006038 Bacteria 2735
89 Ga0075365_10106001 3300006038 Bacteria 1928
90 Ga0075365_10164692 3300006038 Bacteria 1546
91 Ga0075365_10166890 3300006038 Bacteria 1536
92 Ga0075365_10297127 3300006038 Bacteria 1136
93 Ga0075365_10418976 3300006038 Bacteria 945
94 Ga0075365_10444627 3300006038 Bacteria 915
95 Ga0075365_10516377 3300006038 Bacteria 844
96 Ga0075365_10665963 3300006038 Bacteria 735
97 Ga0075365_10674328 3300006038 Bacteria 730
98 Ga0075368_10014057 3300006042 Bacteria 2950
99 Ga0075368_10343699 3300006042 Bacteria 649
100 Ga0075363_100002241 3300006048 Bacteria 7818
101 Ga0075363_100003228 3300006048 Bacteria 6889
102 Ga0075363_100214972 3300006048 Bacteria 1101
103 Ga0075363_100335558 3300006048 Bacteria 881
104 Ga0075363_100409993 3300006048 Bacteria 797
105 Ga0075364_10002837 3300006051 Bacteria 9761
106 Ga0075364_10007059 3300006051 Bacteria 6642
107 Ga0075364_10056188 3300006051 Bacteria 2577
108 Ga0075364_10132043 3300006051 Bacteria 1676
109 Ga0075364_10174679 3300006051 Bacteria 1453
110 Ga0075362_10009032 3300006177 Bacteria 3837
111 Ga0075367_10027213 3300006178 Bacteria 3251
112 Ga0075367_10179039 3300006178 Bacteria 1322
113 Ga0075367_10277249 3300006178 Bacteria 1054
114 Ga0075367_10933199 3300006178 Bacteria 554
115 Ga0075366_10488189 3300006195 Unclassified 761
116 Ga0097621_101210041 3300006237 Bacteria 712
117 Ga0075370_10015698 3300006353 Bacteria 4061
118 Ga0075370_10043014 3300006353 Bacteria 2553
119 Ga0075370_10043636 3300006353 Bacteria 2534
120 Ga0075370_10314362 3300006353 Bacteria 932
121 Ga0075370_10347838 3300006353 Bacteria 885
122 Ga0075370_10761352 3300006353 Bacteria 590
123 Ga0068871_100949413 3300006358 Bacteria 799
124 Ga0068871_102057084 3300006358 Bacteria 544
125 Ga0068865_101018770 3300006881 Bacteria 726
126 Ga0105240_12642059 3300009093 Bacteria 519
127 Ga0111539_12333886 3300009094 Bacteria 621
128 Ga0105245_10471899 3300009098 Bacteria 1267
129 Ga0105245_12623388 3300009098 Bacteria 557
130 Ga0105247_10604885 3300009101 Bacteria 813
131 Ga0105243_10046893 3300009148 Bacteria 3401
132 Ga0105243_10665148 3300009148 Bacteria 1011
133 Ga0105243_10898886 3300009148 Bacteria 881
134 Ga0105242_10333052 3300009176 Bacteria 1396
135 Ga0105242_10686228 3300009176 Bacteria 1000
136 Ga0105248_12008032 3300009177 Bacteria 657
137 Ga0105248_12159952 3300009177 Bacteria 633
138 Ga0105237_10048712 3300009545 Bacteria 4259
139 Ga0105238_12223564 3300009551 Bacteria 583
140 Ga0105249_10032335 3300009553 Bacteria 4732
141 Ga0105249_10268481 3300009553 Bacteria 1699
142 Ga0105249_11183025 3300009553 Bacteria 835
143 Ga0105239_10003376 3300010375 Bacteria 19591
144 Ga0105239_11386641 3300010375 Bacteria 811
145 Ga0105239_12339469 3300010375 Bacteria 622
146 Ga0105246_10002553 3300011119 Bacteria 11006
147 Ga0105246_10097466 3300011119 Bacteria 2134
148 Ga0157328_1013030 3300012478 Unclassified 612
149 Ga0157373_11341321 3300013100 Bacteria 542
150 Ga0157371_11135261 3300013102 Bacteria 600
151 Ga0157370_11697140 3300013104 Bacteria 567
152 Ga0157369_10038178 3300013105 Bacteria 5252
153 Ga0157369_11053547 3300013105 Bacteria 832
154 Ga0157369_11363812 3300013105 Bacteria 722
155 Ga0157369_11922340 3300013105 Bacteria 601
156 Ga0157374_10443642 3300013296 Bacteria 1299
157 Ga0157374_12488246 3300013296 Bacteria 545
158 Ga0157378_10892361 3300013297 Bacteria 919
159 Ga0163162_10562697 3300013306 Bacteria 1268
160 Ga0163162_10681013 3300013306 Bacteria 1151
161 Ga0157372_10003758 3300013307 Bacteria 16307
162 Ga0157372_10243943 3300013307 Bacteria 2085
163 Ga0157372_10698894 3300013307 Bacteria 1180
164 Ga0157372_11229110 3300013307 Bacteria 865
165 Ga0157375_10046073 3300013308 Bacteria 4249
166 Ga0157375_10538475 3300013308 Bacteria 1330
167 Ga0157375_11043312 3300013308 Bacteria 955
168 Ga0163163_10032106 3300014325 Bacteria 5072
169 Ga0163163_10628687 3300014325 Bacteria 1137
170 Ga0163163_11495619 3300014325 Bacteria 737
171 Ga0157380_11521444 3300014326 Bacteria 723
172 Ga0157377_11152292 3300014745 Bacteria 597
173 Ga0157379_10055658 3300014968 Bacteria 3534
174 Ga0157379_10658312 3300014968 Bacteria 981
175 Ga0157376_10366035 3300014969 Bacteria 1384
176 Ga0157376_10715364 3300014969 Bacteria 1008
177 Ga0157376_12138426 3300014969 Bacteria 598
178 Ga0163161_11184537 3300017792 Bacteria 660
179 Ga0197907_10683000 3300020069 Bacteria 609
180 Ga0197907_10726392 3300020069 Bacteria 588
181 Ga0206356_10515470 3300020070 Bacteria 603
182 Ga0206349_1729926 3300020075 Bacteria 844
183 Ga0206355_1364419 3300020076 Bacteria 568
184 Ga0206355_1712487 3300020076 Bacteria 742
185 Ga0206351_10656277 3300020077 Bacteria 534
186 Ga0206353_11152983 3300020082 Bacteria 534
187 Ga0207697_10097713 3300025315 Bacteria 1249
188 Ga0207656_10509194 3300025321 Bacteria 611
189 Ga0207682_10118092 3300025893 Bacteria 1174
190 Ga0207642_10160752 3300025899 Bacteria 1206
191 Ga0207642_10468689 3300025899 Bacteria 766
192 Ga0207710_10098002 3300025900 Bacteria 1380
193 Ga0207688_10070016 3300025901 Bacteria 1989
194 Ga0207647_10006157 3300025904 Bacteria 8738
195 Ga0207647_10031194 3300025904 Bacteria 3431
196 Ga0207685_10361775 3300025905 Bacteria 734
197 Ga0207643_10659252 3300025908 Bacteria 675
198 Ga0207705_10016424 3300025909 Bacteria 5307
199 Ga0207707_10589432 3300025912 Bacteria 942
200 Ga0207695_11533502 3300025913 Bacteria 547
201 Ga0207671_10542930 3300025914 Bacteria 927
202 Ga0207660_10633933 3300025917 Bacteria 871
203 Ga0207662_10065100 3300025918 Bacteria 2195
204 Ga0207657_10021083 3300025919 Bacteria 6141
205 Ga0207652_10249508 3300025921 Bacteria 1601
206 Ga0207652_10905479 3300025921 Bacteria 779
207 Ga0207694_10104071 3300025924 Bacteria 2252
208 Ga0207694_11203115 3300025924 Bacteria 641
209 Ga0207659_11260535 3300025926 Bacteria 635
210 Ga0207687_11471569 3300025927 Bacteria 585
211 Ga0207700_10287955 3300025928 Bacteria 1415
212 Ga0207664_10018076 3300025929 Bacteria 5180
213 Ga0207644_10907216 3300025931 Bacteria 739
214 Ga0207690_10015272 3300025932 Bacteria 4650
215 Ga0207690_11771652 3300025932 Bacteria 516
216 Ga0207686_10687248 3300025934 Bacteria 812
217 Ga0207709_10045556 3300025935 Bacteria 2657
218 Ga0207709_10230362 3300025935 Bacteria 1342
219 Ga0207704_11413633 3300025938 Bacteria 596
220 Ga0207704_11829825 3300025938 Bacteria 522
221 Ga0207711_10311165 3300025941 Bacteria 1454
222 Ga0207711_10869240 3300025941 Bacteria 839
223 Ga0207661_10051024 3300025944 Bacteria 3299
224 Ga0207661_10114772 3300025944 Bacteria 2284
225 Ga0207661_11357867 3300025944 Bacteria 652
226 Ga0207667_11864565 3300025949 Bacteria 564
227 Ga0207712_11453733 3300025961 Bacteria 614
228 Ga0207712_11476547 3300025961 Bacteria 609
229 Ga0207668_10161379 3300025972 Bacteria 1747
230 Ga0207668_10575696 3300025972 Bacteria 978
231 Ga0207640_10175856 3300025981 Bacteria 1600
232 Ga0207658_10474360 3300025986 Bacteria 1111
233 Ga0207658_10735889 3300025986 Bacteria 893
234 Ga0207677_10895320 3300026023 Bacteria 800
235 Ga0207678_10795377 3300026067 Bacteria 835
236 Ga0207678_11562364 3300026067 Bacteria 582
237 Ga0207678_11765785 3300026067 Bacteria 542
238 Ga0207708_11178559 3300026075 Unclassified 669
239 Ga0207708_11329759 3300026075 Bacteria 630
240 Ga0207702_10135466 3300026078 Bacteria 2222
241 Ga0207648_10810152 3300026089 Bacteria 872
242 Ga0207674_10012818 3300026116 Bacteria 9356
243 Ga0207674_10940311 3300026116 Bacteria 833
244 Ga0207675_100521148 3300026118 Bacteria 1185
245 Ga0207675_101044448 3300026118 Bacteria 836
246 Ga0207683_11099784 3300026121 Bacteria 737
247 Ga0207683_11145140 3300026121 Bacteria 721
248 Ga0207698_10333057 3300026142 Bacteria 1427
249 Ga0207698_11649760 3300026142 Bacteria 656
250 Ga0207698_12519099 3300026142 Bacteria 524
251 Ga0209813_10117440 3300027866 Bacteria 922
252 Ga0209813_10255909 3300027866 Bacteria 667
253 Ga0268266_10003912 3300028379 Bacteria 14476
254 Ga0268266_10530736 3300028379 Bacteria 1126
255 Ga0268266_11108084 3300028379 Bacteria 766
256 Ga0268265_12246432 3300028380 Bacteria 552
257 Ga0268264_11726751 3300028381 Bacteria 636
258 Ga0268264_12484565 3300028381 Bacteria 523
259 Ga0316176_1031041 3300030732 Bacteria 523
260 Ga0316180_1087808 3300030736 Bacteria 580
261 Ga0316181_1039077 3300030744 Bacteria 534
262 Ga0316181_1200668 3300030744 Bacteria 962
263 Ga0316182_1244095 3300030745 Bacteria 886
264 Ga0265327_10046179 3300031251 Bacteria 2308
265 Ga0316579_10463259 3300031691 Bacteria 613
266 Ga0316576_10027796 3300031727 Bacteria 3978
267 Ga0316578_10371877 3300031728 Bacteria 849
268 Ga0307405_10093088 3300031731 Bacteria 2001
269 Ga0307405_10097432 3300031731 Bacteria 1964
270 Ga0307405_10257341 3300031731 Bacteria 1302
271 Ga0307405_10260887 3300031731 Bacteria 1294
272 Ga0307405_10756673 3300031731 Bacteria 810
273 Ga0307405_11687559 3300031731 Bacteria 561
274 Ga0307413_10887594 3300031824 Bacteria 756
275 Ga0307413_11043928 3300031824 Bacteria 703
276 Ga0307413_11229731 3300031824 Bacteria 652
277 Ga0307410_10174649 3300031852 Bacteria 1622
278 Ga0307410_10417267 3300031852 Bacteria 1088
279 Ga0307410_10767041 3300031852 Bacteria 818
280 Ga0307410_11025645 3300031852 Bacteria 712
281 Ga0307406_10669431 3300031901 Bacteria 863
282 Ga0307406_11472228 3300031901 Bacteria 599
283 Ga0307407_10359391 3300031903 Bacteria 1034
284 Ga0307412_10198652 3300031911 Bacteria 1521
285 Ga0307412_10223018 3300031911 Bacteria 1446
286 Ga0307412_10981040 3300031911 Bacteria 745
287 Ga0307409_100007665 3300031995 Bacteria 6479
288 Ga0307409_100123190 3300031995 Bacteria 2200
289 Ga0307409_100176114 3300031995 Bacteria 1888
290 Ga0307409_100503011 3300031995 Bacteria 1180
291 Ga0307416_100000326 3300032002 Bacteria 24620
292 Ga0307416_100317181 3300032002 Bacteria 1559
293 Ga0307416_101016106 3300032002 Bacteria 932
294 Ga0307416_101718254 3300032002 Bacteria 732
295 Ga0307416_102122209 3300032002 Bacteria 664
296 Ga0307416_102316037 3300032002 Bacteria 637
297 Ga0307414_10263769 3300032004 Bacteria 1439
298 Ga0307414_12286584 3300032004 Bacteria 505
299 Ga0307411_10430605 3300032005 Bacteria 1098
300 Ga0307411_10499561 3300032005 Bacteria 1028
301 Ga0307415_100000660 3300032126 Bacteria 15214
302 Ga0307415_100103456 3300032126 Bacteria 2095
303 Ga0307415_100956222 3300032126 Bacteria 793
304 Ga0316574_0037078 3300035398 Bacteria 2988
305 Ga0373931_0802244 3300035691 Bacteria 628
306 Ga0373931_0812897 3300035691 Bacteria 624
307 Ga0373947_0702966 3300035725 Bacteria 690
308 Ga0373925_1211417 3300037068 Bacteria 620
309 Ga0395900_0649966 3300037418 Bacteria 991
310 Ga0395898_0726887 3300037466 Bacteria 934
311 Ga0395905_0580664 3300037471 Bacteria 1022
312 Ga0395901_2071189 3300038443 Bacteria 514
313 Ga0436365_0113012 3300039437 Bacteria 623
314 Ga0451793_1605370 3300041452 Bacteria 630
315 Ga0451797_1457047 3300041453 Bacteria 680
316 Ga0451804_1140280 3300041463 Bacteria 715
317 Ga0451837_0570580 3300041494 Unclassified 562
318 Ga0451839_0934810 3300041496 Bacteria 513
319 Ga0451841_0815517 3300041498 Bacteria 736
320 Ga0451851_0722956 3300041507 Bacteria 518
321 Ga0451851_1262490 3300041507 Bacteria 688
322 Ga0451843_0289731 3300041509 Bacteria 513
323 Ga0451843_0740739 3300041509 Bacteria 619
324 Ga0451853_2608855 3300041512 Bacteria 1309
325 Ga0451853_2737232 3300041512 Bacteria 839
326 Ga0439431_0077905 3300041997 Bacteria 891
327 Ga0439433_0036122 3300041999 Bacteria 1141
328 Ga0439442_121828 3300042002 Bacteria 571
329 Ga0466965_0005943 3300044683 Bacteria 5517
330 Ga0466965_0047246 3300044683 Bacteria 2131
331 Ga0466965_0178594 3300044683 Bacteria 1119
332 Ga0466965_0252437 3300044683 Bacteria 946
333 Ga0466961_0452231 3300044693 Bacteria 777
334 Ga0466963_0176012 3300044694 Bacteria 1493
335 Ga0466963_0261183 3300044694 Bacteria 1216
336 Ga0466963_0347328 3300044694 Bacteria 1045
337 Ga0466963_0626830 3300044694 Bacteria 759
338 Ga0466964_0004179 3300044706 Bacteria 5313
339 Ga0466964_0318196 3300044706 Bacteria 790
340 Ga0466971_0083670 3300044719 Bacteria 1457
341 Ga0466968_0266880 3300044735 Bacteria 816
342 Ga0466968_0464659 3300044735 Bacteria 627
343 Ga0466970_0010529 3300044765 Bacteria 4697
344 Ga0466970_0072089 3300044765 Bacteria 1858
345 Ga0466970_0610761 3300044765 Bacteria 633
346 Ga0466957_0029122 3300044842 Bacteria 3292
347 Ga0466960_0011511 3300044901 Bacteria 3704
348 Ga0451576_0328718 3300045051 Bacteria 1600
349 Ga0466958_0522016 3300045836 Bacteria 771
350 Ga0466967_0024704 3300045976 Bacteria 4944
351 Ga0466967_0039445 3300045976 Bacteria 4060
352 Ga0466967_0062707 3300045976 Bacteria 3301
353 Ga0466967_0465070 3300045976 Bacteria 1237
354 Ga0466967_0485202 3300045976 Bacteria 1211
355 Ga0466967_0829166 3300045976 Bacteria 919
356 Ga0466967_0918105 3300045976 Bacteria 871
357 Ga0466967_0929014 3300045976 Bacteria 865
358 Ga0466967_0993591 3300045976 Bacteria 835
359 Ga0466967_1096066 3300045976 Bacteria 793
360 Ga0466967_1364476 3300045976 Bacteria 706
361 Ga0466967_1419509 3300045976 Bacteria 691
362 Ga0466967_1806979 3300045976 Bacteria 608
363 Ga0466967_2375079 3300045976 Bacteria 525
364 Ga0495603_0561385 3300046455 Bacteria 654
365 Ga0495590_0410727 3300046457 Bacteria 520
366 Ga0495641_0034143 3300046461 Bacteria 2407
367 Ga0495641_0112870 3300046461 Bacteria 1212
368 Ga0495651_0835322 3300046462 Bacteria 567
369 Ga0495653_0805057 3300046463 Bacteria 565
370 Ga0495582_0060916 3300046473 Bacteria 2083
371 Ga0495608_0245387 3300046511 Bacteria 1118
372 Ga0495608_0717209 3300046511 Bacteria 594
373 Ga0495611_0403646 3300046648 Bacteria 625
374 Ga0495588_0396225 3300046674 Bacteria 725
375 Ga0495657_0316754 3300046675 Bacteria 928
376 Ga0495647_0203096 3300046681 Bacteria 870
377 Ga0495600_0501307 3300046809 Bacteria 746
378 Ga0495674_0626936 3300047319 Bacteria 850
379 Ga0496100_0252806 3300048903 Bacteria 1304
380 Ga0496100_0449918 3300048903 Bacteria 987
381 Ga0496100_1076621 3300048903 Bacteria 633
382 Ga0496100_1137085 3300048903 Bacteria 616
383 Ga0496100_1148568 3300048903 Bacteria 612
384 Ga0496100_1567491 3300048903 Bacteria 520
385 Ga0496100_1575981 3300048903 Bacteria 519
386 Ga0496101_0143729 3300048904 Bacteria 1820
387 Ga0496101_0560671 3300048904 Bacteria 903
388 Ga0496101_1074614 3300048904 Bacteria 632
389 Ga0496102_0029628 3300048905 Bacteria 4899
390 Ga0496102_0357312 3300048905 Bacteria 1375
391 Ga0496102_0443111 3300048905 Bacteria 1219
392 Ga0496102_0539774 3300048905 Bacteria 1089
393 Ga0496102_1282012 3300048905 Bacteria 652
394 Ga0496103_0063173 3300048906 Bacteria 2306
395 Ga0496103_0091372 3300048906 Bacteria 1921
396 Ga0496104_0131141 3300048907 Bacteria 2407
397 Ga0496104_0146331 3300048907 Bacteria 2269
398 Ga0496105_0011827 3300048908 Bacteria 6912
399 Ga0496105_0111917 3300048908 Bacteria 2253
400 Ga0496105_0476395 3300048908 Bacteria 983
401 Ga0496106_0027444 3300048909 Bacteria 4240
402 Ga0496106_0151908 3300048909 Bacteria 1827
403 Ga0496106_0157199 3300048909 Bacteria 1796
404 Ga0496107_0051694 3300048910 Bacteria 2964
405 Ga0496107_0106795 3300048910 Bacteria 2056
406 Ga0496107_0674957 3300048910 Bacteria 761
407 Ga0496107_1292157 3300048910 Bacteria 522
408 Ga0496108_0056358 3300048911 Bacteria 3302
409 Ga0496108_0236429 3300048911 Bacteria 1589
410 Ga0496108_0371507 3300048911 Bacteria 1248
411 Ga0496108_1124528 3300048911 Bacteria 667
412 Ga0496109_0017639 3300048912 Bacteria 6260
413 Ga0496109_0035530 3300048912 Bacteria 4497
414 Ga0496109_0045312 3300048912 Bacteria 3990
415 Ga0496109_0157520 3300048912 Bacteria 2127
416 Ga0496109_0196442 3300048912 Bacteria 1896
417 Ga0496109_0731865 3300048912 Bacteria 927
418 Ga0496109_0787348 3300048912 Bacteria 889
419 Ga0496109_0890662 3300048912 Bacteria 828
420 Ga0496109_1113017 3300048912 Bacteria 727
421 Ga0496110_0002615 3300048913 Bacteria 13555
422 Ga0496110_0259187 3300048913 Bacteria 1583
423 Ga0496110_0385429 3300048913 Bacteria 1277
424 Ga0496110_0491352 3300048913 Bacteria 1118
425 Ga0496110_0699631 3300048913 Bacteria 915
426 Ga0496111_0000863 3300048914 Bacteria 16436
427 Ga0496111_0149894 3300048914 Bacteria 1730
428 Ga0496111_0184921 3300048914 Bacteria 1549
429 Ga0496111_0255270 3300048914 Bacteria 1301
430 Ga0496111_0464866 3300048914 Bacteria 933
431 Ga0496112_0370716 3300048915 Bacteria 1373
432 Ga0496112_0455608 3300048915 Bacteria 1217
433 Ga0496112_1040608 3300048915 Bacteria 738
434 Ga0496113_0088815 3300048916 Bacteria 2378
435 Ga0496113_0152467 3300048916 Bacteria 1824
436 Ga0496113_0449862 3300048916 Bacteria 1035
437 Ga0496113_0648325 3300048916 Bacteria 844
438 Ga0496113_0877840 3300048916 Bacteria 710
439 Ga0496114_0005765 3300048917 Bacteria 9725
440 Ga0496114_0313786 3300048917 Bacteria 1385
441 Ga0496114_0645709 3300048917 Bacteria 931
442 Ga0496114_0742770 3300048917 Bacteria 858
443 Ga0496114_1181512 3300048917 Bacteria 651
444 Ga0496114_1696238 3300048917 Bacteria 520
445 Ga0496114_1698741 3300048917 Bacteria 519
446 Ga0496115_0007901 3300048918 Bacteria 7847
447 Ga0496115_0153151 3300048918 Bacteria 1904
448 Ga0496115_0702965 3300048918 Bacteria 794
449 Ga0496124_0107982 3300048927 Bacteria 2245
450 Ga0501306_074205 3300049127 Bacteria 578
451 Ga0501308_046218 3300049128 Bacteria 626
452 Ga0501308_069575 3300049128 Bacteria 545
453 Ga0501309_036448 3300049129 Bacteria 741
454 Ga0501307_017068 3300049162 Bacteria 911
455 Ga0501311_027138 3300049527 Bacteria 811
456 Ga0501311_028402 3300049527 Bacteria 798
457 Ga0501311_075508 3300049527 Bacteria 566
458 Ga0501315_092669 3300049531 Bacteria 525
459 Ga0501316_020569 3300049532 Bacteria 829
460 Ga0501317_094438 3300049533 Bacteria 533
461 Ga0501318_026168 3300049534 Bacteria 768
462 Ga0501318_077863 3300049534 Bacteria 533
463 Ga0501320_050130 3300049536 Bacteria 567
464 Ga0501321_015731 3300049537 Bacteria 894
465 Ga0501321_020242 3300049537 Bacteria 821
466 Ga0501323_025649 3300049539 Bacteria 803
467 Ga0501323_058133 3300049539 Bacteria 599
468 Ga0501031_0124579 3300049568 Bacteria 1683
469 Ga0501031_0336166 3300049568 Bacteria 978
470 Ga0501031_0429818 3300049568 Bacteria 853
471 Ga0501031_0482783 3300049568 Bacteria 800
472 Ga0501031_0827486 3300049568 Bacteria 593
473 Ga0501032_0055017 3300049569 Bacteria 2678
474 Ga0501032_0746308 3300049569 Bacteria 619
475 Ga0501033_0567768 3300049570 Bacteria 780
476 Ga0501033_1045045 3300049570 Bacteria 545
477 Ga0501034_0116558 3300049571 Bacteria 2659
478 Ga0501036_0234974 3300049572 Bacteria 1538
479 Ga0501036_0573760 3300049572 Bacteria 937
480 Ga0501036_1322405 3300049572 Bacteria 585
481 Ga0501037_0617148 3300049573 Bacteria 727
482 Ga0501037_0873304 3300049573 Bacteria 591
483 Ga0501037_0881228 3300049573 Bacteria 587
484 Ga0501037_0909568 3300049573 Bacteria 576
485 Ga0501038_0240445 3300049574 Bacteria 1438
486 Ga0501039_0322847 3300049575 Bacteria 1213
487 Ga0501039_0617670 3300049575 Bacteria 849
488 Ga0501039_0650703 3300049575 Bacteria 825
489 Ga0501039_0970490 3300049575 Bacteria 661
490 Ga0501040_0015156 3300049576 Bacteria 5094
491 Ga0501040_0418437 3300049576 Bacteria 963
492 Ga0501041_0221065 3300049577 Bacteria 1188
493 Ga0501042_0203765 3300049578 Bacteria 1427
494 Ga0501042_0387710 3300049578 Bacteria 1012
495 Ga0501042_0927665 3300049578 Bacteria 634
496 Ga0501043_0926466 3300049579 Bacteria 624
497 Ga0501047_0035797 3300049581 Bacteria 4797
498 Ga0501048_0274750 3300049582 Bacteria 1198
499 Ga0501048_0396365 3300049582 Bacteria 986
500 Ga0501048_1004716 3300049582 Bacteria 600
501 Ga0501067_0018858 3300049583 Bacteria 3817
502 Ga0501067_0142566 3300049583 Bacteria 1334
503 Ga0501068_0007063 3300049584 Bacteria 6218
504 Ga0501068_0137679 3300049584 Bacteria 1529
505 Ga0501068_0339086 3300049584 Bacteria 965
506 Ga0501068_1074450 3300049584 Bacteria 532
507 Ga0501068_1213543 3300049584 Bacteria 500
508 Ga0501069_0010269 3300049585 Bacteria 4956
509 Ga0501069_0081159 3300049585 Bacteria 1827
510 Ga0501069_0097902 3300049585 Bacteria 1663
511 Ga0501069_0134846 3300049585 Bacteria 1415
512 Ga0501069_0412840 3300049585 Bacteria 800
513 Ga0501070_0003855 3300049586 Bacteria 12939
514 Ga0501070_0007921 3300049586 Bacteria 8998
515 Ga0501070_0069617 3300049586 Bacteria 2913
516 Ga0501070_0115188 3300049586 Bacteria 2220
517 Ga0501070_0180620 3300049586 Bacteria 1736
518 Ga0501070_0239879 3300049586 Bacteria 1484
519 Ga0501070_0391469 3300049586 Bacteria 1125
520 Ga0501070_0954941 3300049586 Bacteria 666
521 Ga0501070_1529414 3300049586 Bacteria 504
522 Ga0501071_0027705 3300049587 Bacteria 3989
523 Ga0501071_0048866 3300049587 Bacteria 3043
524 Ga0501071_0239034 3300049587 Bacteria 1369
525 Ga0501072_0040219 3300049588 Bacteria 3671
526 Ga0501072_0065092 3300049588 Bacteria 2874
527 Ga0501072_1449893 3300049588 Bacteria 530
528 Ga0501073_0004693 3300049589 Bacteria 10261
529 Ga0501073_0058379 3300049589 Bacteria 2696
530 Ga0501073_0099798 3300049589 Bacteria 2016
531 Ga0501073_0116112 3300049589 Bacteria 1855
532 Ga0501073_0225830 3300049589 Unclassified 1293
533 Ga0501074_0006884 3300049590 Bacteria 8209
534 Ga0501074_0010793 3300049590 Bacteria 6632
535 Ga0501074_0067873 3300049590 Bacteria 2564
536 Ga0501074_0131857 3300049590 Bacteria 1787
537 Ga0501074_0183030 3300049590 Bacteria 1494
538 Ga0501074_0463900 3300049590 Bacteria 898
539 Ga0501074_0998766 3300049590 Bacteria 588
540 Ga0501075_0052405 3300049591 Bacteria 3068
541 Ga0501075_0113338 3300049591 Bacteria 2062
542 Ga0501076_0218569 3300049592 Bacteria 1558
543 Ga0501076_0677154 3300049592 Bacteria 851
544 Ga0501076_0926409 3300049592 Bacteria 718
545 Ga0501076_1092067 3300049592 Bacteria 657
546 Ga0501077_0039014 3300049593 Bacteria 3024
547 Ga0501077_0048817 3300049593 Bacteria 2690
548 Ga0501245_055371 3300049708 Bacteria 713
549 Ga0501079_0063376 3300049741 Bacteria 2852
550 Ga0501079_0745868 3300049741 Bacteria 771
551 Ga0501079_1105900 3300049741 Bacteria 624
552 Ga0501079_1218898 3300049741 Bacteria 593
553 Ga0501080_0000857 3300049742 Bacteria 24883
554 Ga0501080_0026606 3300049742 Bacteria 5375
555 Ga0501080_0036904 3300049742 Bacteria 4562
556 Ga0501080_0102823 3300049742 Bacteria 2650
557 Ga0501080_0145160 3300049742 Bacteria 2194
558 Ga0501080_0437872 3300049742 Bacteria 1173
559 Ga0501080_1371283 3300049742 Bacteria 604
560 Ga0501080_1560987 3300049742 Bacteria 560
561 Ga0501081_0288638 3300049743 Bacteria 1202
562 Ga0501081_0443268 3300049743 Bacteria 964
563 Ga0501081_0917711 3300049743 Bacteria 661
564 Ga0501083_0006215 3300049744 Bacteria 8470
565 Ga0501083_0038678 3300049744 Bacteria 3242
566 Ga0501083_0074679 3300049744 Bacteria 2252
567 Ga0501083_0108873 3300049744 Bacteria 1822
568 Ga0501083_0589962 3300049744 Bacteria 723
569 Ga0501267_064736 3300049764 Bacteria 500
570 Ga0501035_1518876 3300049822 Bacteria 510
571 Ga0501044_0875949 3300049823 Bacteria 774
572 Ga0501045_0057583 3300049824 Bacteria 2844
573 Ga0501045_0191940 3300049824 Bacteria 1522
574 Ga0501045_0374865 3300049824 Bacteria 1059
575 Ga0501045_0825025 3300049824 Bacteria 682
576 Ga0501212_021518 3300049851 Bacteria 1001
577 nmdc:mga03683_418992_c1 3300050489 Bacteria 641
578 nmdc:mga03683_52007_c1 3300050489 Bacteria 1712
579 nmdc:mga03n38_15123_c1 3300050490 Bacteria 2974
580 nmdc:mga03n38_159835_c1 3300050490 Bacteria 1140
581 nmdc:mga03n38_601668_c1 3300050490 Bacteria 626
582 nmdc:mga03n38_982020_c1 3300050490 Bacteria 500
583 nmdc:mga00v17_1055327_c1 3300050491 Bacteria 510
584 nmdc:mga00v17_393334_c1 3300050491 Bacteria 901
585 nmdc:mga00v17_484262_c1 3300050491 Bacteria 802
586 nmdc:mga00v17_8713_c1 3300050491 Bacteria 5463
587 nmdc:mga00v17_96198_c1 3300050491 Bacteria 1865
588 nmdc:mga0yw44_1090064_c1 3300050492 Bacteria 540
589 nmdc:mga0yw44_118861_c1 3300050492 Bacteria 1701
590 nmdc:mga0yw44_1236910_c1 3300050492 Bacteria 504
591 nmdc:mga0yw44_168866_c1 3300050492 Bacteria 1436
592 nmdc:mga0yw44_175484_c1 3300050492 Bacteria 1409
593 nmdc:mga0yw44_1857_c1 3300050492 Bacteria 8675
594 nmdc:mga0yw44_377527_c1 3300050492 Bacteria 957
595 nmdc:mga0yw44_63686_c1 3300050492 Bacteria 2268
596 nmdc:mga0yw44_684765_c1 3300050492 Bacteria 697
597 nmdc:mga0yw44_696752_c1 3300050492 Bacteria 690
598 nmdc:mga0yw44_933835_c1 3300050492 Bacteria 588
599 nmdc:mga0k408_248852_c1 3300050493 Unclassified 1061
600 nmdc:mga06z11_16750_c1 3300050494 Bacteria 3308
601 nmdc:mga06z11_177474_c1 3300050494 Bacteria 1226
602 nmdc:mga06z11_298856_c1 3300050494 Bacteria 957
603 nmdc:mga06z11_56966_c1 3300050494 Bacteria 2023
604 nmdc:mga06z11_62487_c1 3300050494 Bacteria 1946
605 nmdc:mga04h51_288442_c1 3300050495 Bacteria 666
606 nmdc:mga07m45_117042_c1 3300050496 Bacteria 1538
607 nmdc:mga07m45_2647_c1 3300050496 Bacteria 8434
608 nmdc:mga07m45_665653_c1 3300050496 Bacteria 600
609 nmdc:mga07m45_8472_c1 3300050496 Bacteria 5289
610 nmdc:mga07m45_872995_c1 3300050496 Bacteria 515
611 nmdc:mga08y16_149961_c1 3300050511 Bacteria 2424
612 nmdc:mga0sz30_392465_c1 3300050516 Bacteria 621
613 Ga0495601_0136707 3300053077 Bacteria 1598
614 Ga0495619_0011178 3300053085 Bacteria 5648
615 Ga0495619_0109907 3300053085 Bacteria 1883
616 Ga0495619_0860128 3300053085 Unclassified 611
617 Ga0500644_0000050 3300053088 Bacteria 71907
618 Ga0500644_0454671 3300053088 Unclassified 561
619 Ga0500650_0008087 3300053098 Bacteria 4137
620 Ga0500555_137508 3300053103 Unclassified 603
621 Ga0500556_0000726 3300053104 Bacteria 19847
622 Ga0500593_000179 3300053117 Bacteria 25713
623 Ga0500568_0233537 3300053139 Unclassified 671
624 Ga0500588_0227619 3300053146 Unclassified 696
625 Ga0501084_0002587 3300054114 Bacteria 14586
626 Ga0501084_0082534 3300054114 Bacteria 2697
627 Ga0501084_0112614 3300054114 Bacteria 2286
628 Ga0501084_0142698 3300054114 Bacteria 2017
629 Ga0501084_0470543 3300054114 Bacteria 1062
630 Ga0590077_012799 3300059426 Bacteria 1742
631 Ga0587088_055944 3300059508 Bacteria 786
632 Ga0587094_094763 3300059513 Bacteria 569
633 Ga0587099_005641 3300059622 Bacteria 1133
634 Ga0587128_143443 3300059630 Bacteria 538
635 Ga0587075_072882 3300059644 Bacteria 641
636 Ga0501082_0054094 3300060353 Bacteria 3460
637 Ga0501082_0189082 3300060353 Bacteria 1791
638 Ga0501082_0253716 3300060353 Bacteria 1530
639 Ga0466962_0144284 3300061719 Bacteria 1154
640 Ga0530510_1546875 3300061734 Bacteria 509
641 2644091760 2643221615 Bacteria 5487866
642 2644321563 2643221657 Bacteria 5490246
643 2855388911 2855386786 Bacteria 4752232
644 8054610548 8054609563 Bacteria 5170090
645 Ga0070665_100001068
646 LJQas_1003021
647 JGI24740J21852_10006331
648 JGI24737J22298_10083958
649 JGI24735J21928_10009661
650 JGI24735J21928_10242590
651 JGI24750J21931_1005025
652 Ga0058863_11839952
653 Ga0058861_12061415
654 Ga0070658_10070424
655 Ga0070658_10490499
656 Ga0070658_11715271
657 Ga0070676_10618598
658 Ga0070683_100002484
659 Ga0070683_100034230
660 Ga0070683_100150160
661 Ga0070683_101311189
662 Ga0070677_10847193
663 Ga0068869_100630588
664 Ga0070680_101303416
665 Ga0070682_100005518
666 Ga0070682_100064327
667 Ga0070682_100141406
668 Ga0070682_100326303
669 Ga0070660_100012028
670 Ga0070660_100091092
671 Ga0070660_100919714
672 Ga0070660_100922623
673 Ga0070691_10215625
674 Ga0070687_100040045
675 Ga0070661_100495699
676 Ga0070692_10045181
677 Ga0070668_100517256
678 Ga0070668_100537483
679 Ga0070668_100551499
680 Ga0070675_101586325
681 Ga0070671_101385660
682 Ga0070659_100023607
683 Ga0070667_100434591
684 Ga0070701_11291570
685 Ga0070705_100225658
686 Ga0070705_100826920
687 Ga0070700_100802390
688 Ga0070700_101044077
689 Ga0070678_100924227
690 Ga0070678_102186446
691 Ga0070662_100793231
692 Ga0070681_10063993
693 Ga0068867_100712080
694 Ga0070685_10495768
695 Ga0070706_100617370
696 Ga0070679_100002885
697 Ga0070679_100356158
698 Ga0070679_100682550
699 Ga0070684_100005484
700 Ga0070684_100092238
701 Ga0070684_100241944
702 Ga0070684_100484495
703 Ga0070684_100577889
704 Ga0070684_101926843
705 Ga0070672_100954562
706 Ga0070695_100524569
707 Ga0070696_100095335
708 Ga0070696_100845614
709 Ga0070693_100820306
710 Ga0070665_100226524
711 Ga0070665_100297650
712 Ga0070665_101311431
713 Ga0070704_100474539
714 Ga0068855_100835619
715 Ga0070664_101806859
716 Ga0068857_100035509
717 Ga0068856_100131363
718 Ga0070702_101734541
719 Ga0068852_101550545
720 Ga0068866_10216015
721 Ga0068866_10519814
722 Ga0068866_11446543
723 Ga0068861_100182543
724 Ga0068861_100628832
725 Ga0068851_10755279
726 Ga0068860_100233962
727 Ga0068860_100803620
728 Ga0068862_100106682
729 Ga0081539_10045239
730 Ga0075365_10008341
731 Ga0075365_10014464
732 Ga0075365_10050835
733 Ga0075365_10106001
734 Ga0075365_10164692
735 Ga0075365_10166890
736 Ga0075365_10297127
737 Ga0075365_10418976
738 Ga0075365_10444627
739 Ga0075365_10516377
740 Ga0075365_10665963
741 Ga0075365_10674328
742 Ga0075368_10014057
743 Ga0075368_10343699
744 Ga0075363_100002241
745 Ga0075363_100003228
746 Ga0075363_100214972
747 Ga0075363_100335558
748 Ga0075363_100409993
749 Ga0075364_10002837
750 Ga0075364_10007059
751 Ga0075364_10056188
752 Ga0075364_10132043
753 Ga0075364_10174679
754 Ga0075362_10009032
755 Ga0075367_10027213
756 Ga0075367_10179039
757 Ga0075367_10277249
758 Ga0075367_10933199
759 Ga0075366_10488189
760 Ga0097621_101210041
761 Ga0075370_10015698
762 Ga0075370_10043014
763 Ga0075370_10043636
764 Ga0075370_10314362
765 Ga0075370_10347838
766 Ga0075370_10761352
767 Ga0068871_100949413
768 Ga0068871_102057084
769 Ga0068865_101018770
770 Ga0105240_12642059
771 Ga0111539_12333886
772 Ga0105245_10471899
773 Ga0105245_12623388
774 Ga0105247_10604885
775 Ga0105243_10046893
776 Ga0105243_10665148
777 Ga0105243_10898886
778 Ga0105242_10333052
779 Ga0105242_10686228
780 Ga0105248_12008032
781 Ga0105248_12159952
782 Ga0105237_10048712
783 Ga0105238_12223564
784 Ga0105249_10032335
785 Ga0105249_10268481
786 Ga0105249_11183025
787 Ga0105239_10003376
788 Ga0105239_11386641
789 Ga0105239_12339469
790 Ga0105246_10002553
791 Ga0105246_10097466
792 Ga0157328_1013030
793 Ga0157373_11341321
794 Ga0157371_11135261
795 Ga0157370_11697140
796 Ga0157369_10038178
797 Ga0157369_11053547
798 Ga0157369_11363812
799 Ga0157369_11922340
800 Ga0157374_10443642
801 Ga0157374_12488246
802 Ga0157378_10892361
803 Ga0163162_10562697
804 Ga0163162_10681013
805 Ga0157372_10003758
806 Ga0157372_10243943
807 Ga0157372_10698894
808 Ga0157372_11229110
809 Ga0157375_10046073
810 Ga0157375_10538475
811 Ga0157375_11043312
812 Ga0163163_10032106
813 Ga0163163_10628687
814 Ga0163163_11495619
815 Ga0157380_11521444
816 Ga0157377_11152292
817 Ga0157379_10055658
818 Ga0157379_10658312
819 Ga0157376_10366035
820 Ga0157376_10715364
821 Ga0157376_12138426
822 Ga0163161_11184537
823 Ga0197907_10683000
824 Ga0197907_10726392
825 Ga0206356_10515470
826 Ga0206349_1729926
827 Ga0206355_1364419
828 Ga0206355_1712487
829 Ga0206351_10656277
830 Ga0206353_11152983
831 Ga0207697_10097713
832 Ga0207656_10509194
833 Ga0207682_10118092
834 Ga0207642_10160752
835 Ga0207642_10468689
836 Ga0207710_10098002
837 Ga0207688_10070016
838 Ga0207647_10006157
839 Ga0207647_10031194
840 Ga0207685_10361775
841 Ga0207643_10659252
842 Ga0207705_10016424
843 Ga0207707_10589432
844 Ga0207695_11533502
845 Ga0207671_10542930
846 Ga0207660_10633933
847 Ga0207662_10065100
848 Ga0207657_10021083
849 Ga0207652_10249508
850 Ga0207652_10905479
851 Ga0207694_10104071
852 Ga0207694_11203115
853 Ga0207659_11260535
854 Ga0207687_11471569
855 Ga0207700_10287955
856 Ga0207664_10018076
857 Ga0207644_10907216
858 Ga0207690_10015272
859 Ga0207690_11771652
860 Ga0207686_10687248
861 Ga0207709_10045556
862 Ga0207709_10230362
863 Ga0207704_11413633
864 Ga0207704_11829825
865 Ga0207711_10311165
866 Ga0207711_10869240
867 Ga0207661_10051024
868 Ga0207661_10114772
869 Ga0207661_11357867
870 Ga0207667_11864565
871 Ga0207712_11453733
872 Ga0207712_11476547
873 Ga0207668_10161379
874 Ga0207668_10575696
875 Ga0207640_10175856
876 Ga0207658_10474360
877 Ga0207658_10735889
878 Ga0207677_10895320
879 Ga0207678_10795377
880 Ga0207678_11562364
881 Ga0207678_11765785
882 Ga0207708_11178559
883 Ga0207708_11329759
884 Ga0207702_10135466
885 Ga0207648_10810152
886 Ga0207674_10012818
887 Ga0207674_10940311
888 Ga0207675_100521148
889 Ga0207675_101044448
890 Ga0207683_11099784
891 Ga0207683_11145140
892 Ga0207698_10333057
893 Ga0207698_11649760
894 Ga0207698_12519099
895 Ga0209813_10117440
896 Ga0209813_10255909
897 Ga0268266_10003912
898 Ga0268266_10530736
899 Ga0268266_11108084
900 Ga0268265_12246432
901 Ga0268264_11726751
902 Ga0268264_12484565
903 Ga0316176_1031041
904 Ga0316180_1087808
905 Ga0316181_1039077
906 Ga0316181_1200668
907 Ga0316182_1244095
908 Ga0265327_10046179
909 Ga0316579_10463259
910 Ga0316576_10027796
911 Ga0316578_10371877
912 Ga0307405_10093088
913 Ga0307405_10097432
914 Ga0307405_10257341
915 Ga0307405_10260887
916 Ga0307405_10756673
917 Ga0307405_11687559
918 Ga0307413_10887594
919 Ga0307413_11043928
920 Ga0307413_11229731
921 Ga0307410_10174649
922 Ga0307410_10417267
923 Ga0307410_10767041
924 Ga0307410_11025645
925 Ga0307406_10669431
926 Ga0307406_11472228
927 Ga0307407_10359391
928 Ga0307412_10198652
929 Ga0307412_10223018
930 Ga0307412_10981040
931 Ga0307409_100007665
932 Ga0307409_100123190
933 Ga0307409_100176114
934 Ga0307409_100503011
935 Ga0307416_100000326
936 Ga0307416_100317181
937 Ga0307416_101016106
938 Ga0307416_101718254
939 Ga0307416_102122209
940 Ga0307416_102316037
941 Ga0307414_10263769
942 Ga0307414_12286584
943 Ga0307411_10430605
944 Ga0307411_10499561
945 Ga0307415_100000660
946 Ga0307415_100103456
947 Ga0307415_100956222
948 Ga0316574_0037078
949 Ga0373931_0802244
950 Ga0373931_0812897
951 Ga0373947_0702966
952 Ga0373925_1211417
953 Ga0395900_0649966
954 Ga0395898_0726887
955 Ga0395905_0580664
956 Ga0395901_2071189
957 Ga0436365_0113012
958 Ga0451793_1605370
959 Ga0451797_1457047
960 Ga0451804_1140280
961 Ga0451837_0570580
962 Ga0451839_0934810
963 Ga0451841_0815517
964 Ga0451851_0722956
965 Ga0451851_1262490
966 Ga0451843_0289731
967 Ga0451843_0740739
968 Ga0451853_2608855
969 Ga0451853_2737232
970 Ga0439431_0077905
971 Ga0439433_0036122
972 Ga0439442_121828
973 Ga0466965_0005943
974 Ga0466965_0047246
975 Ga0466965_0178594
976 Ga0466965_0252437
977 Ga0466961_0452231
978 Ga0466963_0176012
979 Ga0466963_0261183
980 Ga0466963_0347328
981 Ga0466963_0626830
982 Ga0466964_0004179
983 Ga0466964_0318196
984 Ga0466971_0083670
985 Ga0466968_0266880
986 Ga0466968_0464659
987 Ga0466970_0010529
988 Ga0466970_0072089
989 Ga0466970_0610761
990 Ga0466957_0029122
991 Ga0466960_0011511
992 Ga0451576_0328718
993 Ga0466958_0522016
994 Ga0466967_0024704
995 Ga0466967_0039445
996 Ga0466967_0062707
997 Ga0466967_0465070
998 Ga0466967_0485202
999 Ga0466967_0829166
1000 Ga0466967_0918105
1001 Ga0466967_0929014
1002 Ga0466967_0993591
1003 Ga0466967_1096066
1004 Ga0466967_1364476
1005 Ga0466967_1419509
1006 Ga0466967_1806979
1007 Ga0466967_2375079
1008 Ga0495603_0561385
1009 Ga0495590_0410727
1010 Ga0495641_0034143
1011 Ga0495641_0112870
1012 Ga0495651_0835322
1013 Ga0495653_0805057
1014 Ga0495582_0060916
1015 Ga0495608_0245387
1016 Ga0495608_0717209
1017 Ga0495611_0403646
1018 Ga0495588_0396225
1019 Ga0495657_0316754
1020 Ga0495647_0203096
1021 Ga0495600_0501307
1022 Ga0495674_0626936
1023 Ga0496100_0252806
1024 Ga0496100_0449918
1025 Ga0496100_1076621
1026 Ga0496100_1137085
1027 Ga0496100_1148568
1028 Ga0496100_1567491
1029 Ga0496100_1575981
1030 Ga0496101_0143729
1031 Ga0496101_0560671
1032 Ga0496101_1074614
1033 Ga0496102_0029628
1034 Ga0496102_0357312
1035 Ga0496102_0443111
1036 Ga0496102_0539774
1037 Ga0496102_1282012
1038 Ga0496103_0063173
1039 Ga0496103_0091372
1040 Ga0496104_0131141
1041 Ga0496104_0146331
1042 Ga0496105_0011827
1043 Ga0496105_0111917
1044 Ga0496105_0476395
1045 Ga0496106_0027444
1046 Ga0496106_0151908
1047 Ga0496106_0157199
1048 Ga0496107_0051694
1049 Ga0496107_0106795
1050 Ga0496107_0674957
1051 Ga0496107_1292157
1052 Ga0496108_0056358
1053 Ga0496108_0236429
1054 Ga0496108_0371507
1055 Ga0496108_1124528
1056 Ga0496109_0017639
1057 Ga0496109_0035530
1058 Ga0496109_0045312
1059 Ga0496109_0157520
1060 Ga0496109_0196442
1061 Ga0496109_0731865
1062 Ga0496109_0787348
1063 Ga0496109_0890662
1064 Ga0496109_1113017
1065 Ga0496110_0002615
1066 Ga0496110_0259187
1067 Ga0496110_0385429
1068 Ga0496110_0491352
1069 Ga0496110_0699631
1070 Ga0496111_0000863
1071 Ga0496111_0149894
1072 Ga0496111_0184921
1073 Ga0496111_0255270
1074 Ga0496111_0464866
1075 Ga0496112_0370716
1076 Ga0496112_0455608
1077 Ga0496112_1040608
1078 Ga0496113_0088815
1079 Ga0496113_0152467
1080 Ga0496113_0449862
1081 Ga0496113_0648325
1082 Ga0496113_0877840
1083 Ga0496114_0005765
1084 Ga0496114_0313786
1085 Ga0496114_0645709
1086 Ga0496114_0742770
1087 Ga0496114_1181512
1088 Ga0496114_1696238
1089 Ga0496114_1698741
1090 Ga0496115_0007901
1091 Ga0496115_0153151
1092 Ga0496115_0702965
1093 Ga0496124_0107982
1094 Ga0501306_074205
1095 Ga0501308_046218
1096 Ga0501308_069575
1097 Ga0501309_036448
1098 Ga0501307_017068
1099 Ga0501311_027138
1100 Ga0501311_028402
1101 Ga0501311_075508
1102 Ga0501315_092669
1103 Ga0501316_020569
1104 Ga0501317_094438
1105 Ga0501318_026168
1106 Ga0501318_077863
1107 Ga0501320_050130
1108 Ga0501321_015731
1109 Ga0501321_020242
1110 Ga0501323_025649
1111 Ga0501323_058133
1112 Ga0501031_0124579
1113 Ga0501031_0336166
1114 Ga0501031_0429818
1115 Ga0501031_0482783
1116 Ga0501031_0827486
1117 Ga0501032_0055017
1118 Ga0501032_0746308
1119 Ga0501033_0567768
1120 Ga0501033_1045045
1121 Ga0501034_0116558
1122 Ga0501036_0234974
1123 Ga0501036_0573760
1124 Ga0501036_1322405
1125 Ga0501037_0617148
1126 Ga0501037_0873304
1127 Ga0501037_0881228
1128 Ga0501037_0909568
1129 Ga0501038_0240445
1130 Ga0501039_0322847
1131 Ga0501039_0617670
1132 Ga0501039_0650703
1133 Ga0501039_0970490
1134 Ga0501040_0015156
1135 Ga0501040_0418437
1136 Ga0501041_0221065
1137 Ga0501042_0203765
1138 Ga0501042_0387710
1139 Ga0501042_0927665
1140 Ga0501043_0926466
1141 Ga0501047_0035797
1142 Ga0501048_0274750
1143 Ga0501048_0396365
1144 Ga0501048_1004716
1145 Ga0501067_0018858
1146 Ga0501067_0142566
1147 Ga0501068_0007063
1148 Ga0501068_0137679
1149 Ga0501068_0339086
1150 Ga0501068_1074450
1151 Ga0501068_1213543
1152 Ga0501069_0010269
1153 Ga0501069_0081159
1154 Ga0501069_0097902
1155 Ga0501069_0134846
1156 Ga0501069_0412840
1157 Ga0501070_0003855
1158 Ga0501070_0007921
1159 Ga0501070_0069617
1160 Ga0501070_0115188
1161 Ga0501070_0180620
1162 Ga0501070_0239879
1163 Ga0501070_0391469
1164 Ga0501070_0954941
1165 Ga0501070_1529414
1166 Ga0501071_0027705
1167 Ga0501071_0048866
1168 Ga0501071_0239034
1169 Ga0501072_0040219
1170 Ga0501072_0065092
1171 Ga0501072_1449893
1172 Ga0501073_0004693
1173 Ga0501073_0058379
1174 Ga0501073_0099798
1175 Ga0501073_0116112
1176 Ga0501073_0225830
1177 Ga0501074_0006884
1178 Ga0501074_0010793
1179 Ga0501074_0067873
1180 Ga0501074_0131857
1181 Ga0501074_0183030
1182 Ga0501074_0463900
1183 Ga0501074_0998766
1184 Ga0501075_0052405
1185 Ga0501075_0113338
1186 Ga0501076_0218569
1187 Ga0501076_0677154
1188 Ga0501076_0926409
1189 Ga0501076_1092067
1190 Ga0501077_0039014
1191 Ga0501077_0048817
1192 Ga0501245_055371
1193 Ga0501079_0063376
1194 Ga0501079_0745868
1195 Ga0501079_1105900
1196 Ga0501079_1218898
1197 Ga0501080_0000857
1198 Ga0501080_0026606
1199 Ga0501080_0036904
1200 Ga0501080_0102823
1201 Ga0501080_0145160
1202 Ga0501080_0437872
1203 Ga0501080_1371283
1204 Ga0501080_1560987
1205 Ga0501081_0288638
1206 Ga0501081_0443268
1207 Ga0501081_0917711
1208 Ga0501083_0006215
1209 Ga0501083_0038678
1210 Ga0501083_0074679
1211 Ga0501083_0108873
1212 Ga0501083_0589962
1213 Ga0501267_064736
1214 Ga0501035_1518876
1215 Ga0501044_0875949
1216 Ga0501045_0057583
1217 Ga0501045_0191940
1218 Ga0501045_0374865
1219 Ga0501045_0825025
1220 Ga0501212_021518
1221 nmdc:mga03683_418992_c1
1222 nmdc:mga03683_52007_c1
1223 nmdc:mga03n38_15123_c1
1224 nmdc:mga03n38_159835_c1
1225 nmdc:mga03n38_601668_c1
1226 nmdc:mga03n38_982020_c1
1227 nmdc:mga00v17_1055327_c1
1228 nmdc:mga00v17_393334_c1
1229 nmdc:mga00v17_484262_c1
1230 nmdc:mga00v17_8713_c1
1231 nmdc:mga00v17_96198_c1
1232 nmdc:mga0yw44_1090064_c1
1233 nmdc:mga0yw44_118861_c1
1234 nmdc:mga0yw44_1236910_c1
1235 nmdc:mga0yw44_168866_c1
1236 nmdc:mga0yw44_175484_c1
1237 nmdc:mga0yw44_1857_c1
1238 nmdc:mga0yw44_377527_c1
1239 nmdc:mga0yw44_63686_c1
1240 nmdc:mga0yw44_684765_c1
1241 nmdc:mga0yw44_696752_c1
1242 nmdc:mga0yw44_933835_c1
1243 nmdc:mga0k408_248852_c1
1244 nmdc:mga06z11_16750_c1
1245 nmdc:mga06z11_177474_c1
1246 nmdc:mga06z11_298856_c1
1247 nmdc:mga06z11_56966_c1
1248 nmdc:mga06z11_62487_c1
1249 nmdc:mga04h51_288442_c1
1250 nmdc:mga07m45_117042_c1
1251 nmdc:mga07m45_2647_c1
1252 nmdc:mga07m45_665653_c1
1253 nmdc:mga07m45_8472_c1
1254 nmdc:mga07m45_872995_c1
1255 nmdc:mga08y16_149961_c1
1256 nmdc:mga0sz30_392465_c1
1257 Ga0495601_0136707
1258 Ga0495619_0011178
1259 Ga0495619_0109907
1260 Ga0495619_0860128
1261 Ga0500644_0000050
1262 Ga0500644_0454671
1263 Ga0500650_0008087
1264 Ga0500555_137508
1265 Ga0500556_0000726
1266 Ga0500593_000179
1267 Ga0500568_0233537
1268 Ga0500588_0227619
1269 Ga0501084_0002587
1270 Ga0501084_0082534
1271 Ga0501084_0112614
1272 Ga0501084_0142698
1273 Ga0501084_0470543
1274 Ga0590077_012799
1275 Ga0587088_055944
1276 Ga0587094_094763
1277 Ga0587099_005641
1278 Ga0587128_143443
1279 Ga0587075_072882
1280 Ga0501082_0054094
1281 Ga0501082_0189082
1282 Ga0501082_0253716
1283 Ga0466962_0144284
1284 Ga0530510_1546875
1285 2644091760
1286 2644321563
1287 2855388911
1288 8054610548

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

5

94

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.9931 3 87
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.9592 2 90
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.9487 2 90
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.9382 3 87
1v8c-assembly1.cif.gz_A crystal structure of moad related protein from thermus thermophilus hb8 0.9098 4 87
ID Description Score Start End Superfamily
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9592 2 90 3.10.20.30
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9487 2 90 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9001 4 85 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8707 4 85 3.10.20.30
2l52A00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.847 2 90 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A7V9LQU8-F1-model_v4 MoaD/ThiS family protein 1.002 1 59
AF-X8F476-F1-model_v4 deleted 0.9987 1 90
AF-A0A2T4ZJT8-F1-model_v4 deleted 0.992 1 89
AF-P0A647-F1-model_v4 Sulfur carrier protein CysO (9.5 kDa culture filtrate antigen cfp10A) 0.9917 1 90 GO:0019344
AF-A0A6B3IN31-F1-model_v4 MoaD/ThiS family protein 0.9889 1 87

Map