F472000

General Info

Members Datasets Scaffolds Average Seq Length
643 477 387 389

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2821443989|2821451009
Length 455
Sequence IEVTGVDVLAPIQQEGTKAAVRSWFAAVGDTVREGDPLVELETDKVAVEVPAPASGVLTEILIPADQDATPGAVLGRIGAGAGEARSSLVPPPLAGGGQGEGVVDDSHPHPPIPDRTSGQFLSGSGGGNPLPLAPSREGRGDAKVADRSIADFDPALRLSPSVRKLLAETGLDPAGLTGSGKDGRLTRQDVEQEVARRRAPVETPVETSAPAAPPLRTSAPGGSRLIQHDGMRRRIAEHMAHSLATAPHVTAVFEADFTAVLAHRTASRAAFERQGVALTVTAYIVQACVAAMQAVPVVNSRWHADALEVFDDINIGIGTALGDKGLVVPVVHRAQALSLLGTAGRLQETTALARAGKLAPADVQGGTFTISNHGVSGSLLAAPIIINQPQTAILGIGKVEKRVVVREVAGSDAMLIRPMAYVSLSIDHRALDGAQTNAWLTRFVAALEDWPPIS

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
5 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
6 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
7 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
8 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
9 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
10 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
11 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
12 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
13 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
14 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
15 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
16 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
17 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
18 2516143018 Ensifer sp. BR816 Isolate Nodule
19 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
20 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
21 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
22 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
23 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
24 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
25 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
26 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
27 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
28 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
29 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
30 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
31 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
32 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
33 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
34 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
35 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
36 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
37 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
38 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
39 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
40 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
41 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
42 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
43 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
44 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
45 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
46 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
47 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
48 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
49 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
50 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
51 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
52 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
53 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
54 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
55 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
56 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
57 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
58 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
59 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
60 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
61 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
62 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
63 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
64 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
65 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
66 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
67 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
68 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
69 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
70 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
71 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
72 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
73 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
74 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
75 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
76 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
77 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
78 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
79 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
80 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
81 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
82 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
83 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
84 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
85 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
86 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
87 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
88 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
89 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
90 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
91 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
92 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
93 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
94 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
95 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
96 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
97 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
98 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
99 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
100 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
101 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
102 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
103 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
104 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
105 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
106 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
107 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
108 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
109 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
110 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
111 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
112 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
113 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
114 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
115 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
116 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
117 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
118 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
119 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
120 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
121 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
122 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
123 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
124 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
125 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
126 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
127 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
128 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
129 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
130 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
131 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
132 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
133 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
134 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
135 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
136 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
137 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
138 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
139 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
140 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
141 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
142 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
143 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
144 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
145 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
146 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
147 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
148 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
149 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
150 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
151 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
152 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
153 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
154 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
155 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
156 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
157 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
158 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
159 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
160 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
161 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
162 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
163 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
164 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
165 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
166 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
167 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
168 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
169 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
170 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
171 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
172 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
173 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
174 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
175 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
176 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
177 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
178 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
179 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
180 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
181 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
182 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
183 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
184 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
185 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
186 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
187 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
188 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
189 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
190 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
191 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
192 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
193 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
194 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
195 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
196 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
197 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
198 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
199 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
200 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
201 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
202 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
203 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
204 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
205 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
206 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
207 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
208 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
209 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
210 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
211 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
212 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
213 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
214 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
215 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
216 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
217 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
218 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
219 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
220 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
221 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
222 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
223 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
224 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
225 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
226 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
227 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
228 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
229 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
230 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
231 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
232 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
233 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
234 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
235 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
236 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
237 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
238 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
239 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
240 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
241 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
242 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
243 2996887358 Rhizobium sp. R711 Isolate Nodule
244 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
245 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
246 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
247 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
248 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
249 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
250 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
251 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
252 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
253 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
254 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
255 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
256 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
257 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
258 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
259 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
260 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
261 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
262 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
263 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
264 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
265 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
266 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
267 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
268 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
269 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
270 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
271 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
272 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
273 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
274 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
275 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
276 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
277 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
278 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
279 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
280 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
281 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
282 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
283 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
284 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
285 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
286 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
287 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
288 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
289 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
290 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
291 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
292 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
293 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
294 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
295 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
296 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
297 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
298 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
299 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
300 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
301 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
302 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
303 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
304 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
305 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
306 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
307 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
308 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
309 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
310 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
311 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
312 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
313 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
314 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
315 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
316 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
317 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
318 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
319 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
320 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
321 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
322 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
323 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
324 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
325 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
326 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
327 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
328 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
329 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
330 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
331 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
332 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
333 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
334 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
335 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
336 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
337 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
338 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
365 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
366 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
367 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
371 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
372 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
373 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
374 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
375 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
376 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
377 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
378 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
379 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
380 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
381 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
382 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
383 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
384 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
385 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
386 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
387 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
388 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
389 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
390 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
391 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
392 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
393 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
394 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
395 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
396 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
397 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
398 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
399 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
400 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
401 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
402 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
403 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
404 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
405 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
406 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
407 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
408 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
409 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
410 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
411 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
412 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
413 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
414 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
415 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
416 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
417 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
418 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
419 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
420 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
421 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
422 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
423 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
424 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
425 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
426 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
436 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
437 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
438 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
439 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
440 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
441 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
442 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
443 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
444 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
445 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
446 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
447 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
448 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
451 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
452 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
453 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
454 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
455 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
456 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
457 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
458 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
459 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
460 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
461 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
462 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
463 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
464 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
465 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
466 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
467 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
468 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
469 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
470 8005258706 Rhizobium sp. R693 Isolate Nodule
471 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
472 8005321885 Rhizobium sp. R72 Isolate Nodule
473 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
474 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
475 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
476 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
477 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 60.03
Metatranscriptomes 0
Isolates 39.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.84
Nodule 37.01
Rhizoplane 0.47
Rhizosphere 47.28
Stem 0
Stem Tuber 0
Unclassified 8.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1002088 3300001904 Bacteria 3549
2 JGI24740J21852_10002065 3300001979 Bacteria 9182
3 JGI24740J21852_10007846 3300001979 Bacteria 4307
4 JGI24739J22299_10003494 3300001989 Bacteria 5994
5 JGI24739J22299_10033070 3300001989 Bacteria 1773
6 JGI25155J39150_1000043 3300002704 Bacteria 87185
7 JGI25156J39149_1000056 3300002705 Bacteria 87185
8 JGI25162J39368_1000074 3300002737 Bacteria 121066
9 JGI25162J39368_1001761 3300002737 Bacteria 10300
10 JGI25154J39366_1000086 3300002738 Bacteria 87185
11 JGI25157J39369_1000086 3300002741 Bacteria 81114
12 JGI25152J39213_1000745 3300002773 Bacteria 16620
13 JGI25152J39213_1004117 3300002773 Bacteria 4696
14 JGI25151J46595_10000400 3300003187 Bacteria 45092
15 JGI25165J46597_1000068 3300003214 Bacteria 196201
16 JGI25165J46597_1000537 3300003214 Bacteria 35164
17 JGI25153J46596_10027636 3300003215 Bacteria 1983
18 rootH1_10018885 3300003316 Bacteria 9439
19 rootH1_10018885 3300003323 Bacteria 21610
20 rootH2_10003835 3300003320 Bacteria 12912
21 rootH2_10009015 3300003320 Bacteria 18262
22 rootL2_10012115 3300003322 Bacteria 43997
23 rootH1_10051830 3300003323 Bacteria 3596
24 rootH1_10070810 3300003323 Bacteria 7504
25 Ga0055524_1008339 3300003775 Bacteria 4310
26 Ga0055524_1010091 3300003775 Bacteria 3784
27 Ga0055528_1010360 3300003790 Bacteria 3795
28 Ga0070658_10000001 3300005327 Bacteria 856789
29 Ga0070658_10005984 3300005327 Bacteria 9859
30 Ga0070683_100039287 3300005329 Bacteria 4343
31 Ga0070670_100230551 3300005331 Bacteria 1611
32 Ga0068869_100020468 3300005334 Bacteria 4536
33 Ga0068868_100000001 3300005338 Bacteria 282170
34 Ga0070660_100000184 3300005339 Bacteria 41526
35 Ga0070660_100003723 3300005339 Bacteria 10534
36 Ga0070660_100006698 3300005339 Bacteria 7993
37 Ga0070661_100105148 3300005344 Bacteria 2104
38 Ga0070661_100153643 3300005344 Bacteria 1741
39 Ga0070692_10001068 3300005345 Bacteria 9508
40 Ga0070668_100131775 3300005347 Bacteria 2007
41 Ga0070669_100092494 3300005353 Bacteria 2270
42 Ga0070669_100136434 3300005353 Bacteria 1887
43 Ga0070671_100005893 3300005355 Bacteria 9766
44 Ga0070659_100000001 3300005366 Bacteria 576390
45 Ga0070659_100000984 3300005366 Bacteria 20941
46 Ga0070659_100001698 3300005366 Bacteria 15823
47 Ga0070659_100031264 3300005366 Bacteria 4123
48 Ga0070659_100060824 3300005366 Bacteria 2984
49 Ga0070667_100067074 3300005367 Bacteria 3050
50 Ga0070713_100016505 3300005436 Bacteria 5553
51 Ga0070663_100001497 3300005455 Bacteria 12844
52 Ga0070663_100031593 3300005455 Bacteria 3640
53 Ga0070663_100033565 3300005455 Bacteria 3547
54 Ga0070679_100207692 3300005530 Bacteria 1923
55 Ga0070684_100223228 3300005535 Bacteria 1719
56 Ga0068853_100067304 3300005539 Bacteria 3112
57 Ga0070686_100000194 3300005544 Bacteria 42189
58 Ga0070665_100006904 3300005548 Bacteria 11539
59 Ga0070665_100035910 3300005548 Bacteria 4986
60 Ga0068855_100341883 3300005563 Bacteria 1650
61 Ga0070664_100113106 3300005564 Bacteria 2371
62 Ga0068857_100065010 3300005577 Bacteria 3243
63 Ga0068854_100004180 3300005578 Bacteria 9084
64 Ga0068854_100109622 3300005578 Bacteria 2080
65 Ga0068854_100125592 3300005578 Bacteria 1953
66 Ga0068854_100211119 3300005578 Bacteria 1531
67 Ga0068856_100006069 3300005614 Bacteria 11869
68 Ga0068856_100011043 3300005614 Bacteria 8771
69 Ga0068856_100016897 3300005614 Bacteria 7072
70 Ga0068856_100024005 3300005614 Bacteria 5932
71 Ga0068856_100074238 3300005614 Bacteria 3367
72 Ga0068856_100125148 3300005614 Bacteria 2573
73 Ga0068852_100013467 3300005616 Bacteria 6262
74 Ga0068852_100068726 3300005616 Bacteria 3102
75 Ga0068852_100099006 3300005616 Bacteria 2627
76 Ga0068852_100109434 3300005616 Bacteria 2509
77 Ga0068864_100004726 3300005618 Bacteria 11154
78 Ga0068870_10083478 3300005840 Bacteria 1771
79 Ga0068863_100117729 3300005841 Bacteria 2532
80 Ga0068860_100040634 3300005843 Bacteria 4445
81 Ga0068860_100153007 3300005843 Bacteria 2222
82 Ga0068862_100009863 3300005844 Bacteria 7887
83 Ga0068862_100011017 3300005844 Bacteria 7471
84 Ga0068862_100073554 3300005844 Bacteria 2954
85 Ga0075367_10001856 3300006178 Bacteria 9328
86 Ga0075366_10020462 3300006195 Bacteria 3840
87 Ga0068871_100048960 3300006358 Bacteria 3414
88 Ga0075434_100061314 3300006871 Bacteria 3742
89 Ga0079104_1009785 3300006946 Bacteria 3220
90 Ga0105250_10083308 3300009092 Bacteria 1298
91 Ga0105240_10016809 3300009093 Bacteria 9894
92 Ga0105240_10052334 3300009093 Bacteria 5134
93 Ga0105240_10062030 3300009093 Bacteria 4656
94 Ga0105240_10120824 3300009093 Bacteria 3154
95 Ga0105245_10364339 3300009098 Bacteria 1435
96 Ga0105243_10000150 3300009148 Bacteria 79825
97 Ga0105241_10009912 3300009174 Bacteria 7001
98 Ga0105241_10030600 3300009174 Bacteria 4025
99 Ga0105248_10000005 3300009177 Bacteria 673111
100 Ga0105248_10001965 3300009177 Bacteria 22859
101 Ga0105248_10108184 3300009177 Bacteria 3135
102 Ga0105237_10019521 3300009545 Bacteria 7001
103 Ga0105237_10110555 3300009545 Bacteria 2740
104 Ga0105238_10046084 3300009551 Bacteria 4402
105 Ga0105238_10048684 3300009551 Bacteria 4270
106 Ga0123342_1004588 3300009766 Bacteria 20889
107 Ga0105239_10000300 3300010375 Bacteria 73306
108 Ga0105239_10024092 3300010375 Bacteria 6703
109 Ga0157373_10215976 3300013100 Bacteria 1352
110 Ga0157371_10000705 3300013102 Bacteria 39219
111 Ga0157371_10165399 3300013102 Bacteria 1580
112 Ga0157370_10044437 3300013104 Bacteria 4270
113 Ga0157370_10084977 3300013104 Bacteria 2973
114 Ga0157370_10116180 3300013104 Bacteria 2499
115 Ga0157370_10346663 3300013104 Bacteria 1369
116 Ga0157369_10000553 3300013105 Bacteria 49107
117 Ga0157369_10002565 3300013105 Bacteria 21747
118 Ga0157369_10009186 3300013105 Bacteria 11312
119 Ga0157369_10013284 3300013105 Bacteria 9318
120 Ga0157369_10107491 3300013105 Bacteria 2968
121 Ga0157369_10146826 3300013105 Bacteria 2494
122 Ga0171462_1018 3300013250 Bacteria 157875
123 Ga0157372_10157774 3300013307 Bacteria 2621
124 Ga0157372_10522377 3300013307 Bacteria 1384
125 Ga0163161_10004269 3300017792 Bacteria 9966
126 Ga0214544_1000130 3300021320 Bacteria 108844
127 Ga0214542_1000014 3300021321 Bacteria 233825
128 Ga0214542_1015520 3300021321 Bacteria 7896
129 Ga0214543_1000005 3300021327 Bacteria 454523
130 Ga0214543_1000146 3300021327 Bacteria 98609
131 Ga0213872_10018761 3300021361 Bacteria 3188
132 Ga0213876_10003603 3300021384 Bacteria 8810
133 Ga0213876_10024251 3300021384 Bacteria 3202
134 Ga0228711_1000009 3300022739 Bacteria 164684
135 Ga0228710_1000011 3300022740 Bacteria 154551
136 Ga0209435_100039 3300025206 Bacteria 116879
137 Ga0209437_100023 3300025233 Bacteria 614195
138 Ga0209437_100067 3300025233 Bacteria 317685
139 Ga0209646_1000137 3300025246 Bacteria 116791
140 Ga0209026_1000135 3300025250 Bacteria 117001
141 Ga0209759_1000154 3300025256 Bacteria 119427
142 Ga0209129_1001217 3300025258 Bacteria 14789
143 Ga0209233_1000088 3300025261 Bacteria 317980
144 Ga0209233_1000219 3300025261 Bacteria 104797
145 Ga0209673_1010743 3300025273 Bacteria 3834
146 Ga0209673_1013794 3300025273 Bacteria 3170
147 Ga0209025_1000486 3300025294 Bacteria 76804
148 Ga0209025_1029263 3300025294 Bacteria 2672
149 Ga0209564_1007884 3300025295 Bacteria 5388
150 Ga0209564_1015410 3300025295 Bacteria 3111
151 Ga0209758_1005395 3300025297 Bacteria 9889
152 Ga0209256_1004539 3300025299 Bacteria 8643
153 Ga0209256_1006393 3300025299 Bacteria 6263
154 Ga0207426_1000092 3300025302 Bacteria 278907
155 Ga0207426_1000730 3300025302 Bacteria 37639
156 Ga0209051_1000801 3300025303 Bacteria 33036
157 Ga0207647_10007269 3300025904 Bacteria 8015
158 Ga0207645_10067906 3300025907 Bacteria 2279
159 Ga0207705_10000002 3300025909 Bacteria 2046852
160 Ga0207705_10000050 3300025909 Bacteria 170078
161 Ga0207705_10000060 3300025909 Bacteria 152576
162 Ga0207705_10000274 3300025909 Bacteria 49320
163 Ga0207705_10006806 3300025909 Bacteria 8446
164 Ga0207705_10008785 3300025909 Bacteria 7365
165 Ga0207705_10089423 3300025909 Bacteria 2254
166 Ga0207654_10000442 3300025911 Bacteria 23622
167 Ga0207654_10004226 3300025911 Bacteria 7246
168 Ga0207707_10031948 3300025912 Bacteria 4608
169 Ga0207695_10003088 3300025913 Bacteria 23842
170 Ga0207695_10003338 3300025913 Bacteria 22726
171 Ga0207695_10042758 3300025913 Bacteria 4835
172 Ga0207695_10124933 3300025913 Bacteria 2537
173 Ga0207695_10153554 3300025913 Bacteria 2239
174 Ga0207671_10012484 3300025914 Bacteria 6825
175 Ga0207660_10003617 3300025917 Bacteria 10075
176 Ga0207657_10000210 3300025919 Bacteria 60425
177 Ga0207657_10000301 3300025919 Bacteria 52361
178 Ga0207657_10002610 3300025919 Bacteria 19473
179 Ga0207657_10009499 3300025919 Bacteria 9769
180 Ga0207649_10000826 3300025920 Bacteria 19904
181 Ga0207649_10042880 3300025920 Bacteria 2763
182 Ga0207649_10080598 3300025920 Bacteria 2106
183 Ga0207681_10026824 3300025923 Bacteria 3719
184 Ga0207694_10000230 3300025924 Bacteria 53897
185 Ga0207694_10010416 3300025924 Bacteria 7009
186 Ga0207694_10023287 3300025924 Bacteria 4701
187 Ga0207690_10000018 3300025932 Bacteria 238992
188 Ga0207690_10000052 3300025932 Bacteria 106112
189 Ga0207690_10006516 3300025932 Bacteria 6920
190 Ga0207690_10010071 3300025932 Bacteria 5615
191 Ga0207690_10033889 3300025932 Bacteria 3286
192 Ga0207706_10018713 3300025933 Bacteria 6230
193 Ga0207709_10000005 3300025935 Bacteria 806813
194 Ga0207689_10017877 3300025942 Bacteria 5988
195 Ga0207661_10134254 3300025944 Bacteria 2124
196 Ga0207667_10000327 3300025949 Bacteria 66205
197 Ga0207667_10004913 3300025949 Bacteria 16326
198 Ga0207667_10059054 3300025949 Bacteria 4019
199 Ga0207667_10080132 3300025949 Bacteria 3383
200 Ga0207640_10000668 3300025981 Bacteria 20054
201 Ga0207640_10001866 3300025981 Bacteria 11302
202 Ga0207640_10002879 3300025981 Bacteria 9230
203 Ga0207640_10031181 3300025981 Bacteria 3291
204 Ga0207640_10037021 3300025981 Bacteria 3067
205 Ga0207640_10102970 3300025981 Bacteria 2006
206 Ga0207658_10019218 3300025986 Bacteria 4724
207 Ga0207677_10000024 3300026023 Bacteria 127407
208 Ga0207639_10023974 3300026041 Bacteria 4409
209 Ga0207639_10027413 3300026041 Bacteria 4151
210 Ga0207639_10065772 3300026041 Bacteria 2815
211 Ga0207639_10084789 3300026041 Bacteria 2518
212 Ga0207678_10001868 3300026067 Bacteria 19215
213 Ga0207678_10017893 3300026067 Bacteria 6225
214 Ga0207678_10026057 3300026067 Bacteria 5102
215 Ga0207678_10191483 3300026067 Bacteria 1748
216 Ga0207702_10002001 3300026078 Bacteria 19755
217 Ga0207702_10002550 3300026078 Bacteria 17144
218 Ga0207702_10005497 3300026078 Bacteria 11083
219 Ga0207702_10054396 3300026078 Bacteria 3391
220 Ga0207702_10078685 3300026078 Bacteria 2855
221 Ga0207702_10098504 3300026078 Bacteria 2575
222 Ga0207641_10080359 3300026088 Bacteria 2828
223 Ga0207698_10011041 3300026142 Bacteria 5839
224 Ga0207698_10025825 3300026142 Bacteria 4145
225 Ga0207698_10121837 3300026142 Bacteria 2209
226 Ga0209281_1000132 3300027111 Bacteria 188464
227 Ga0209281_1000330 3300027111 Bacteria 82146
228 Ga0209371_1001602 3300027312 Bacteria 14718
229 Ga0209282_1000018 3300027666 Bacteria 188472
230 Ga0268266_10000118 3300028379 Bacteria 163466
231 Ga0268266_10001257 3300028379 Bacteria 30973
232 Ga0268266_10012602 3300028379 Bacteria 7305
233 Ga0268265_10002034 3300028380 Bacteria 15864
234 Ga0268265_10008567 3300028380 Bacteria 6914
235 Ga0268265_10041658 3300028380 Bacteria 3401
236 Ga0268264_10019402 3300028381 Bacteria 5556
237 Ga0268264_10278778 3300028381 Bacteria 1565
238 Ga0268256_1001086 3300030500 Bacteria 17888
239 Ga0307513_10126056 3300031456 Bacteria 2516
240 Ga0265314_10012997 3300031711 Bacteria 6759
241 Ga0307405_10017380 3300031731 Bacteria 3945
242 Ga0307405_10157754 3300031731 Bacteria 1603
243 Ga0307413_10038369 3300031824 Bacteria 2776
244 Ga0307413_10040926 3300031824 Bacteria 2709
245 Ga0307410_10001826 3300031852 Bacteria 9892
246 Ga0307410_10017272 3300031852 Bacteria 4328
247 Ga0307406_10017840 3300031901 Bacteria 4139
248 Ga0315914_1004045 3300031967 Bacteria 22019
249 Ga0307409_100183859 3300031995 Bacteria 1853
250 Ga0307416_100151308 3300032002 Bacteria 2128
251 Ga0307414_10034270 3300032004 Bacteria 3364
252 Ga0307414_10046824 3300032004 Bacteria 2972
253 Ga0307414_10049109 3300032004 Bacteria 2915
254 Ga0307414_10316523 3300032004 Bacteria 1326
255 Ga0307411_10041163 3300032005 Bacteria 2937
256 Ga0307411_10087535 3300032005 Bacteria 2163
257 Ga0315913_1002336 3300033430 Bacteria 22163
258 Ga0315915_1000006 3300033464 Bacteria 330709
259 Ga0373935_0167194 3300035692 Bacteria 1502
260 Ga0373947_0122000 3300035725 Bacteria 1656
261 Ga0373925_0015079 3300037068 Bacteria 5585
262 Ga0395899_0000004 3300037312 Bacteria 874267
263 Ga0395899_0000258 3300037312 Bacteria 69644
264 Ga0395899_0000756 3300037312 Bacteria 32002
265 Ga0395899_0088385 3300037312 Bacteria 2248
266 Ga0395899_0118361 3300037312 Bacteria 1899
267 Ga0395899_0220709 3300037312 Bacteria 1313
268 Ga0395900_0000254 3300037418 Bacteria 83296
269 Ga0395900_0050033 3300037418 Bacteria 4305
270 Ga0395900_0077101 3300037418 Bacteria 3424
271 Ga0395900_0078585 3300037418 Bacteria 3390
272 Ga0395900_0084080 3300037418 Bacteria 3269
273 Ga0395900_0408505 3300037418 Bacteria 1320
274 Ga0395898_0001500 3300037466 Bacteria 32350
275 Ga0395898_0019847 3300037466 Bacteria 6836
276 Ga0395898_0271759 3300037466 Bacteria 1616
277 Ga0395898_0365240 3300037466 Bacteria 1376
278 Ga0395905_0000092 3300037471 Bacteria 149300
279 Ga0395905_0001268 3300037471 Bacteria 31200
280 Ga0395905_0034799 3300037471 Bacteria 4730
281 Ga0395905_0135777 3300037471 Bacteria 2314
282 Ga0395905_0249630 3300037471 Bacteria 1657
283 Ga0395901_0000030 3300038443 Bacteria 241916
284 Ga0395901_0059836 3300038443 Bacteria 3963
285 Ga0436365_0225864 3300039437 Bacteria 4367
286 Ga0436365_1414469 3300039437 Bacteria 13821
287 Ga0436361_0579226 3300039447 Bacteria 15069
288 Ga0436361_0650369 3300039447 Bacteria 5166
289 Ga0436361_0884472 3300039447 Bacteria 1660
290 Ga0439462_0018367 3300042015 Bacteria 1816
291 Ga0466969_0009620 3300044656 Bacteria 5123
292 Ga0466966_0000040 3300044684 Bacteria 97159
293 Ga0466963_0001063 3300044694 Bacteria 14300
294 Ga0466963_0039216 3300044694 Bacteria 3101
295 Ga0466970_0000013 3300044765 Bacteria 83194
296 Ga0466957_0002063 3300044842 Bacteria 10743
297 Ga0466957_0035118 3300044842 Bacteria 3008
298 Ga0466957_0050135 3300044842 Bacteria 2540
299 Ga0466959_0015238 3300045049 Bacteria 5598
300 Ga0466958_0003594 3300045836 Bacteria 8077
301 Ga0466967_0183494 3300045976 Bacteria 1975
302 Ga0495627_000064 3300046453 Bacteria 132648
303 Ga0495638_0000271 3300046460 Bacteria 69977
304 Ga0495583_0043213 3300046506 Bacteria 2099
305 Ga0495642_0000077 3300046528 Bacteria 57843
306 Ga0495654_0011793 3300046530 Bacteria 4718
307 Ga0495668_0010095 3300046616 Bacteria 5745
308 Ga0495658_0001680 3300046683 Bacteria 11515
309 Ga0495669_0031567 3300046684 Bacteria 2326
310 Ga0495671_0003564 3300046692 Bacteria 9502
311 Ga0495672_0001456 3300047320 Bacteria 23217
312 Ga0495673_0000350 3300047469 Bacteria 57843
313 Ga0495681_0000876 3300047470 Bacteria 23218
314 Ga0495686_0000260 3300047472 Bacteria 94551
315 Ga0496104_0008143 3300048907 Bacteria 9302
316 Ga0496105_0036105 3300048908 Bacteria 4070
317 Ga0496116_0025300 3300048919 Bacteria 4366
318 Ga0496117_0134261 3300048920 Bacteria 1494
319 Ga0496118_0086478 3300048921 Bacteria 2178
320 Ga0496119_0012032 3300048922 Bacteria 7078
321 Ga0496119_0073807 3300048922 Bacteria 1988
322 Ga0496122_0084643 3300048925 Bacteria 2192
323 Ga0496123_0018934 3300048926 Bacteria 5447
324 Ga0496124_0027225 3300048927 Bacteria 5137
325 Ga0496125_0029974 3300048928 Bacteria 4876
326 Ga0496125_0038285 3300048928 Bacteria 4154
327 Ga0501031_0018775 3300049568 Bacteria 4502
328 Ga0501032_0008644 3300049569 Bacteria 7422
329 Ga0501033_0107322 3300049570 Bacteria 2034
330 Ga0501038_0021682 3300049574 Bacteria 5763
331 Ga0501039_0033762 3300049575 Bacteria 3947
332 Ga0501039_0045899 3300049575 Bacteria 3376
333 Ga0501040_0032549 3300049576 Bacteria 3528
334 Ga0501043_0017544 3300049579 Bacteria 5612
335 Ga0501043_0122813 3300049579 Bacteria 2037
336 Ga0501047_0000070 3300049581 Bacteria 127146
337 Ga0501047_0021206 3300049581 Bacteria 6240
338 Ga0501048_0085365 3300049582 Bacteria 2226
339 Ga0501068_0035931 3300049584 Bacteria 2960
340 Ga0501068_0056684 3300049584 Bacteria 2375
341 Ga0501070_0000020 3300049586 Bacteria 169025
342 Ga0501071_0014607 3300049587 Bacteria 5373
343 Ga0501071_0042035 3300049587 Bacteria 3273
344 Ga0501072_0045747 3300049588 Bacteria 3442
345 Ga0501072_0057633 3300049588 Bacteria 3061
346 Ga0501072_0088535 3300049588 Bacteria 2456
347 Ga0501073_0010417 3300049589 Bacteria 6818
348 Ga0501074_0084923 3300049590 Bacteria 2269
349 Ga0501074_0092271 3300049590 Bacteria 2169
350 Ga0501075_0000489 3300049591 Bacteria 23691
351 Ga0501076_0074909 3300049592 Bacteria 2712
352 Ga0501076_0095251 3300049592 Bacteria 2397
353 Ga0501077_0099469 3300049593 Bacteria 1843
354 Ga0501079_0010578 3300049741 Bacteria 7019
355 Ga0501079_0152883 3300049741 Bacteria 1799
356 Ga0501080_0001196 3300049742 Bacteria 21518
357 Ga0501080_0020528 3300049742 Bacteria 6117
358 Ga0501080_0024995 3300049742 Bacteria 5541
359 Ga0501080_0121938 3300049742 Bacteria 2415
360 Ga0501081_0197992 3300049743 Bacteria 1456
361 Ga0501083_0001136 3300049744 Bacteria 17863
362 Ga0501035_0000349 3300049822 Bacteria 53020
363 Ga0501035_0042177 3300049822 Bacteria 4117
364 Ga0501044_0008968 3300049823 Bacteria 10936
365 Ga0501044_0017133 3300049823 Bacteria 7776
366 Ga0501045_0078570 3300049824 Bacteria 2432
367 nmdc:mga06z11_8558_c1 3300050494 Bacteria 4277
368 nmdc:mga06r32_7180_c1 3300050510 Bacteria 9642
369 Ga0500643_000386 3300053087 Bacteria 34137
370 Ga0500643_002276 3300053087 Bacteria 10073
371 Ga0500643_007177 3300053087 Bacteria 4551
372 Ga0500643_015919 3300053087 Bacteria 2565
373 Ga0500556_0001231 3300053104 Bacteria 11899
374 Ga0500592_000010 3300053116 Bacteria 76714
375 Ga0500618_001503 3300053125 Bacteria 10266
376 Ga0500658_0000041 3300053134 Bacteria 77435
377 Ga0500559_0032177 3300053136 Bacteria 2253
378 Ga0500568_0007029 3300053139 Bacteria 5567
379 Ga0500616_0000087 3300053153 Bacteria 192225
380 Ga0500627_0000036 3300053158 Bacteria 79400
381 Ga0500596_000669 3300053735 Bacteria 6639
382 Ga0501084_0015084 3300054114 Bacteria 6408
383 Ga0501084_0052768 3300054114 Bacteria 3401
384 Ga0501082_0002930 3300060353 Bacteria 14892
385 Ga0501082_0005325 3300060353 Bacteria 11184
386 Ga0501082_0103514 3300060353 Bacteria 2462
387 Ga0530510_0003021 3300061734 Bacteria 11553

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025924 Ga0207694_10023287 Ga0207694_100232874 307
2 3300009766 Ga0123342_1004588 Ga0123342_10045883 322
3 3300045049 Ga0466959_0015238 Ga0466959_0015238_3822_5057 327
4 3300047472 Ga0495686_0000260 Ga0495686_0000260_73457_74695 329
5 3300028379 Ga0268266_10000118 Ga0268266_1000011896 332
6 3300037312 Ga0395899_0000004 Ga0395899_0000004_204557_205780 336
7 3300005334 Ga0068869_100020468 Ga0068869_1000204682 337
8 3300025942 Ga0207689_10017877 Ga0207689_100178774 337
9 3300001979 JGI24740J21852_10002065 JGI24740J21852_100020652 338
10 3300002737 JGI25162J39368_1000074 JGI25162J39368_10000742 338
11 3300003214 JGI25165J46597_1000068 JGI25165J46597_100006835 338
12 3300005614 Ga0068856_100074238 Ga0068856_1000742382 338
13 3300025233 Ga0209437_100067 Ga0209437_100067113 338
14 3300025261 Ga0209233_1000088 Ga0209233_1000088113 338
15 3300026078 Ga0207702_10054396 Ga0207702_100543962 338
16 3300037418 Ga0395900_0078585 Ga0395900_0078585_411_1604 338
17 3300048922 Ga0496119_0012032 Ga0496119_0012032_4684_5901 338
18 3300048926 Ga0496123_0018934 Ga0496123_0018934_201_1418 338
19 3300048927 Ga0496124_0027225 Ga0496124_0027225_201_1418 338
20 3300005616 Ga0068852_100068726 Ga0068852_1000687262 340
21 3300005844 Ga0068862_100009863 Ga0068862_1000098636 340
22 3300009148 Ga0105243_10000150 Ga0105243_1000015036 340
23 3300025935 Ga0207709_10000005 Ga0207709_1000000580 340
24 3300028380 Ga0268265_10002034 Ga0268265_1000203413 340
25 3300031456 Ga0307513_10126056 Ga0307513_101260563 341
26 3300006195 Ga0075366_10020462 Ga0075366_100204622 344
27 3300039447 Ga0436361_0579226 Ga0436361_0579226_13643_14902 346
28 3300049579 Ga0501043_0017544 Ga0501043_0017544_3397_4659 346
29 3300049581 Ga0501047_0000070 Ga0501047_0000070_72463_73725 346
30 3300049822 Ga0501035_0042177 Ga0501035_0042177_31_1293 346
31 3300003316 rootH1_10018885 rootH1_100188859 347
32 3300003320 rootH2_10003835 rootH2_100038359 347
33 3300003322 rootL2_10012115 rootL2_100121155 347
34 3300003323 rootH1_10070810 rootH1_100708107 347
35 3300048920 Ga0496117_0134261 Ga0496117_0134261_310_1470 349
36 iso_pu_bacteria 2551306087 2551700326 349
37 3300001979 JGI24740J21852_10007846 JGI24740J21852_100078462 350
38 3300005366 Ga0070659_100000984 Ga0070659_10000098418 350
39 3300005455 Ga0070663_100033565 Ga0070663_1000335652 350
40 3300005535 Ga0070684_100223228 Ga0070684_1002232282 350
41 3300005564 Ga0070664_100113106 Ga0070664_1001131063 350
42 3300005614 Ga0068856_100125148 Ga0068856_1001251482 350
43 3300009551 Ga0105238_10048684 Ga0105238_100486842 350
44 3300013104 Ga0157370_10044437 Ga0157370_100444372 350
45 3300013105 Ga0157369_10002565 Ga0157369_100025658 350
46 3300025911 Ga0207654_10000442 Ga0207654_100004429 350
47 3300025913 Ga0207695_10003338 Ga0207695_1000333811 350
48 3300025919 Ga0207657_10002610 Ga0207657_100026108 350
49 3300025920 Ga0207649_10042880 Ga0207649_100428803 350
50 3300025924 Ga0207694_10010416 Ga0207694_100104164 350
51 3300025932 Ga0207690_10000052 Ga0207690_1000005220 350
52 3300026041 Ga0207639_10027413 Ga0207639_100274132 350
53 3300026067 Ga0207678_10026057 Ga0207678_100260575 350
54 3300026078 Ga0207702_10002550 Ga0207702_100025504 350
55 3300026142 Ga0207698_10025825 Ga0207698_100258252 350
56 3300039447 Ga0436361_0884472 Ga0436361_0884472_213_1496 350
57 3300049570 Ga0501033_0107322 Ga0501033_0107322_584_1726 350
58 iso_pu_bacteria 2510065057 2510303981 350
59 iso_pu_bacteria 2511231052 2511497349 350
60 iso_pu_bacteria 2513237086 2513582045 350
61 iso_pu_bacteria 2513237091 2513615146 350
62 iso_pu_bacteria 2513237140 2513881543 350
63 iso_pu_bacteria 2513237143 2513901234 350
64 iso_pu_bacteria 2513237156 2513984693 350
65 iso_pu_bacteria 2516653046 2516895419 350
66 iso_pu_bacteria 2517487022 2517565152 350
67 iso_pu_bacteria 2551306084 2551682404 350
68 iso_pu_bacteria 2551306085 2551688597 350
69 iso_pu_bacteria 2551306086 2551690319 350
70 iso_pu_bacteria 2551306089 2551711060 350
71 iso_pu_bacteria 2551306090 2551720506 350
72 iso_pu_bacteria 2551306091 2551730778 350
73 iso_pu_bacteria 2551306093 2551744942 350
74 iso_pu_bacteria 2802428863 2802748192 350
75 iso_pu_bacteria 2855825444 2855828182 350
76 iso_pu_bacteria 2855839649 2855843289 350
77 iso_pu_bacteria 2858800743 2858805685 350
78 iso_pu_bacteria 2915986958 2915987535 350
79 iso_pu_bacteria 2915993759 2915995671 350
80 iso_pu_bacteria 2916007675 2916012020 350
81 iso_pu_bacteria 2916014648 2916017028 350
82 iso_pu_bacteria 2916021584 2916025350 350
83 iso_pu_bacteria 2916028427 2916029560 350
84 iso_pu_bacteria 2916035215 2916039969 350
85 iso_pu_bacteria 2916041962 2916047209 350
86 iso_pu_bacteria 2916048683 2916051438 350
87 iso_pu_bacteria 2916055098 2916059257 350
88 iso_pu_bacteria 2916076590 2916083232 350
89 iso_pu_bacteria 2921201388 2921208238 350
90 iso_pu_bacteria 2921208531 2921211363 350
91 iso_pu_bacteria 2921237296 2921241369 350
92 iso_pu_bacteria 2921244191 2921246988 350
93 iso_pu_bacteria 2921250672 2921255777 350
94 iso_pu_bacteria 2921257292 2921257808 350
95 iso_pu_bacteria 2921263974 2921267276 350
96 iso_pu_bacteria 2921282425 2921287584 350
97 iso_pu_bacteria 2921289301 2921293144 350
98 iso_pu_bacteria 2921296804 2921296813 350
99 iso_pu_bacteria 2924144063 2924144161 350
100 iso_pu_bacteria 2924150972 2924151089 350
101 iso_pu_bacteria 2924158325 2924158420 350
102 iso_pu_bacteria 2924165586 2924166257 350
103 iso_pu_bacteria 2924172951 2924173004 350
104 iso_pu_bacteria 2924179722 2924179866 350
105 iso_pu_bacteria 2924186466 2924187040 350
106 iso_pu_bacteria 2924193448 2924197679 350
107 iso_pu_bacteria 2924200457 2924202314 350
108 iso_pu_bacteria 2924207177 2924210444 350
109 iso_pu_bacteria 2924214083 2924214199 350
110 iso_pu_bacteria 2924221636 2924228055 350
111 iso_pu_bacteria 2924228884 2924229955 350
112 iso_pu_bacteria 2937002841 2937004917 350
113 iso_pu_bacteria 2937009748 2937013653 350
114 iso_pu_bacteria 2937016420 2937016578 350
115 iso_pu_bacteria 2937023124 2937026435 350
116 iso_pu_bacteria 2937042894 2937044791 350
117 iso_pu_bacteria 2937049772 2937055022 350
118 iso_pu_bacteria 2937056579 2937059720 350
119 iso_pu_bacteria 2937063883 2937066882 350
120 iso_pu_bacteria 2937071275 2937073601 350
121 iso_pu_bacteria 2937091812 2937094793 350
122 iso_pu_bacteria 2937098957 2937100751 350
123 iso_pu_bacteria 2937106411 2937108101 350
124 iso_pu_bacteria 2937113482 2937119109 350
125 iso_pu_bacteria 2937119839 2937121574 350
126 iso_pu_bacteria 2937126314 2937127152 350
127 iso_pu_bacteria 2957382221 2957387985 350
128 iso_pu_bacteria 2957388812 2957392364 350
129 iso_pu_bacteria 2957395598 2957395662 350
130 iso_pu_bacteria 2957402308 2957402453 350
131 iso_pu_bacteria 2957408893 2957413979 350
132 iso_pu_bacteria 2957415311 2957418514 350
133 iso_pu_bacteria 2957430029 2957433300 350
134 iso_pu_bacteria 2957437181 2957438318 350
135 iso_pu_bacteria 2957450854 2957455562 350
136 iso_pu_bacteria 2957457609 2957460615 350
137 iso_pu_bacteria 2957464669 2957466704 350
138 iso_pu_bacteria 2957471148 2957471180 350
139 iso_pu_bacteria 2957478035 2957482629 350
140 iso_pu_bacteria 2957484790 2957490674 350
141 iso_pu_bacteria 2957491536 2957497045 350
142 iso_pu_bacteria 2957498199 2957503915 350
143 iso_pu_bacteria 2957505466 2957512662 350
144 iso_pu_bacteria 2960584000 2960586292 350
145 iso_pu_bacteria 2960591022 2960592393 350
146 iso_pu_bacteria 2960597568 2960599445 350
147 iso_pu_bacteria 2960603979 2960607272 350
148 iso_pu_bacteria 2960610863 2960611217 350
149 iso_pu_bacteria 2960624210 2960627890 350
150 iso_pu_bacteria 2960637947 2960641642 350
151 iso_pu_bacteria 2960645483 2960647152 350
152 iso_pu_bacteria 2960652885 2960653995 350
153 iso_pu_bacteria 2960667422 2960669109 350
154 iso_pu_bacteria 2960674078 2960674122 350
155 iso_pu_bacteria 2960687367 2960689445 350
156 iso_pu_bacteria 2964607997 2964608375 350
157 iso_pu_bacteria 2964615318 2964617432 350
158 iso_pu_bacteria 2964621998 2964623135 350
159 iso_pu_bacteria 2964628898 2964630088 350
160 iso_pu_bacteria 2964636051 2964638802 350
161 iso_pu_bacteria 2964643177 2964645114 350
162 iso_pu_bacteria 2964649959 2964651856 350
163 iso_pu_bacteria 2964656573 2964660901 350
164 iso_pu_bacteria 2964663802 2964667175 350
165 iso_pu_bacteria 2964670856 2964672861 350
166 iso_pu_bacteria 2964678106 2964682040 350
167 iso_pu_bacteria 2964685014 2964688716 350
168 iso_pu_bacteria 2964691889 2964697011 350
169 iso_pu_bacteria 2964698721 2964701201 350
170 iso_pu_bacteria 2964705432 2964705725 350
171 iso_pu_bacteria 2964712639 2964715040 350
172 iso_pu_bacteria 2964719344 2964724144 350
173 iso_pu_bacteria 2967664464 2967669166 350
174 iso_pu_bacteria 2967671571 2967675834 350
175 iso_pu_bacteria 2967678726 2967683079 350
176 iso_pu_bacteria 2967693043 2967697155 350
177 iso_pu_bacteria 2967699805 2967705109 350
178 iso_pu_bacteria 2967706974 2967707014 350
179 iso_pu_bacteria 2967714385 2967717754 350
180 iso_pu_bacteria 2967721400 2967727192 350
181 iso_pu_bacteria 2967735183 2967740476 350
182 iso_pu_bacteria 2967742019 2967742061 350
183 iso_pu_bacteria 2967748971 2967752952 350
184 iso_pu_bacteria 2967755722 2967758369 350
185 iso_pu_bacteria 2967762386 2967768356 350
186 iso_pu_bacteria 2967769361 2967771115 350
187 iso_pu_bacteria 2967775926 2967776079 350
188 iso_pu_bacteria 2970019648 2970021417 350
189 iso_pu_bacteria 2970026789 2970026937 350
190 iso_pu_bacteria 2970033650 2970036472 350
191 iso_pu_bacteria 2970040964 2970045658 350
192 iso_pu_bacteria 2970047711 2970051220 350
193 iso_pu_bacteria 2970054988 2970055039 350
194 iso_pu_bacteria 2970061556 2970066893 350
195 iso_pu_bacteria 2970068827 2970071973 350
196 iso_pu_bacteria 2970076120 2970076276 350
197 iso_pu_bacteria 2970082768 2970082879 350
198 iso_pu_bacteria 2970088815 2970090850 350
199 iso_pu_bacteria 2970095765 2970096030 350
200 iso_pu_bacteria 2970102677 2970104787 350
201 iso_pu_bacteria 2970109326 2970109422 350
202 iso_pu_bacteria 2970116247 2970116360 350
203 iso_pu_bacteria 2970129317 2970132744 350
204 iso_pu_bacteria 2970136068 2970142192 350
205 iso_pu_bacteria 2970149975 2970150189 350
206 iso_pu_bacteria 2970156795 2970159720 350
207 iso_pu_bacteria 2970164137 2970166042 350
208 iso_pu_bacteria 2970170962 2970175117 350
209 iso_pu_bacteria 2970177841 2970177960 350
210 iso_pu_bacteria 2970184632 2970188362 350
211 iso_pu_bacteria 2970191845 2970195319 350
212 iso_pu_bacteria 2977516862 2977516974 350
213 iso_pu_bacteria 2977537788 2977544232 350
214 iso_pu_bacteria 2977551784 2977553907 350
215 iso_pu_bacteria 2977558990 2977561038 350
216 iso_pu_bacteria 2977565890 2977568160 350
217 iso_pu_bacteria 2977572785 2977577229 350
218 iso_pu_bacteria 2977579622 2977582777 350
219 iso_pu_bacteria 648276728 648736886 350
220 iso_pu_bacteria 8003992118 8003995873 350
221 3300006946 Ga0079104_1009785 Ga0079104_10097853 351
222 3300027111 Ga0209281_1000330 Ga0209281_100033051 351
223 iso_pu_bacteria 2512047086 2512529784 351
224 iso_pu_bacteria 2512875026 2512969972 351
225 iso_pu_bacteria 2513237089 2513602576 351
226 iso_pu_bacteria 2513237160 2514005667 351
227 iso_pu_bacteria 2515154107 2515609633 351
228 iso_pu_bacteria 2802428858 2802716397 351
229 iso_pu_bacteria 2802428859 2802722565 351
230 iso_pu_bacteria 2802428860 2802729293 351
231 iso_pu_bacteria 2802428861 2802735685 351
232 iso_pu_bacteria 2802428862 2802741740 351
233 iso_pu_bacteria 2915980308 2915984655 351
234 iso_pu_bacteria 2916061851 2916061870 351
235 iso_pu_bacteria 2936996657 2936996896 351
236 iso_pu_bacteria 2937029754 2937032200 351
237 iso_pu_bacteria 2937036028 2937041785 351
238 iso_pu_bacteria 2937078374 2937080941 351
239 iso_pu_bacteria 2957375807 2957377625 351
240 iso_pu_bacteria 2957443900 2957444298 351
241 iso_pu_bacteria 2960617483 2960619463 351
242 iso_pu_bacteria 2960631154 2960631320 351
243 iso_pu_bacteria 2960660292 2960662381 351
244 iso_pu_bacteria 2960680706 2960682859 351
245 iso_pu_bacteria 2960693952 2960696074 351
246 iso_pu_bacteria 2967686174 2967686831 351
247 iso_pu_bacteria 2967728569 2967731565 351
248 iso_pu_bacteria 2970122695 2970128893 351
249 iso_pu_bacteria 2970143518 2970148224 351
250 iso_pu_bacteria 2977523885 2977526208 351
251 iso_pu_bacteria 2977530762 2977533478 351
252 iso_pu_bacteria 2977544691 2977548412 351
253 iso_pu_bacteria 8003999396 8004003626 351
254 3300005347 Ga0070668_100131775 Ga0070668_1001317751 352
255 3300021320 Ga0214544_1000130 Ga0214544_100013058 352
256 3300021384 Ga0213876_10024251 Ga0213876_100242512 352
257 3300022739 Ga0228711_1000009 Ga0228711_10000093 352
258 3300022740 Ga0228710_1000011 Ga0228710_10000111 352
259 3300027111 Ga0209281_1000132 Ga0209281_1000132169 352
260 3300027666 Ga0209282_1000018 Ga0209282_1000018169 352
261 3300031967 Ga0315914_1004045 Ga0315914_100404518 352
262 3300033430 Ga0315913_1002336 Ga0315913_100233618 352
263 3300033464 Ga0315915_1000006 Ga0315915_1000006135 352
264 3300039437 Ga0436365_0225864 Ga0436365_0225864_1770_2999 352
265 3300049575 Ga0501039_0045899 Ga0501039_0045899_672_1916 352
266 3300049584 Ga0501068_0035931 Ga0501068_0035931_352_1596 352
267 3300049588 Ga0501072_0088535 Ga0501072_0088535_841_2085 352
268 3300049742 Ga0501080_0121938 Ga0501080_0121938_618_1862 352
269 3300021321 Ga0214542_1000014 Ga0214542_100001469 353
270 3300021327 Ga0214543_1000146 Ga0214543_100014669 353
271 3300021361 Ga0213872_10018761 Ga0213872_100187614 353
272 3300039447 Ga0436361_0650369 Ga0436361_0650369_1158_2294 353
273 3300044842 Ga0466957_0050135 Ga0466957_0050135_770_1987 353
274 3300046453 Ga0495627_000064 Ga0495627_000064_82902_84119 353
275 3300049593 Ga0501077_0099469 Ga0501077_0099469_108_1352 353
276 3300046530 Ga0495654_0011793 Ga0495654_0011793_1939_3171 355
277 3300053116 Ga0500592_000010 Ga0500592_000010_18754_19986 355
278 3300053139 Ga0500568_0007029 Ga0500568_0007029_1989_3215 355
279 3300053158 Ga0500627_0000036 Ga0500627_0000036_42018_43250 355
280 iso_pu_bacteria 2516143018 2516207733 355
281 iso_pu_bacteria 2842775625 2842777487 355
282 3300005345 Ga0070692_10001068 Ga0070692_100010689 356
283 3300035692 Ga0373935_0167194 Ga0373935_0167194_116_1270 356
284 3300035725 Ga0373947_0122000 Ga0373947_0122000_380_1534 356
285 3300037068 Ga0373925_0015079 Ga0373925_0015079_231_1385 356
286 3300046616 Ga0495668_0010095 Ga0495668_0010095_1875_3053 356
287 3300053134 Ga0500658_0000041 Ga0500658_0000041_38180_39358 356
288 iso_pu_bacteria 3003930520 3003935782 356
289 3300005843 Ga0068860_100040634 Ga0068860_1000406342 357
290 3300028381 Ga0268264_10278778 Ga0268264_102787781 357
291 3300053087 Ga0500643_007177 Ga0500643_007177_2918_4135 357
292 iso_pu_bacteria 2996887358 2996887881 357
293 iso_pu_bacteria 8005258706 8005259250 357
294 iso_pu_bacteria 8005321885 8005322408 357
295 3300005339 Ga0070660_100000184 Ga0070660_10000018413 358
296 3300013102 Ga0157371_10000705 Ga0157371_1000070523 358
297 3300013104 Ga0157370_10084977 Ga0157370_100849772 358
298 3300025294 Ga0209025_1029263 Ga0209025_10292631 358
299 3300025904 Ga0207647_10007269 Ga0207647_100072693 358
300 3300025909 Ga0207705_10000050 Ga0207705_1000005046 358
301 3300025919 Ga0207657_10000301 Ga0207657_1000030130 358
302 3300025949 Ga0207667_10000327 Ga0207667_1000032744 358
303 3300049568 Ga0501031_0018775 Ga0501031_0018775_2924_4063 358
304 3300049569 Ga0501032_0008644 Ga0501032_0008644_2818_3957 358
305 3300049576 Ga0501040_0032549 Ga0501040_0032549_999_2243 358
306 3300049579 Ga0501043_0122813 Ga0501043_0122813_696_1835 358
307 3300049586 Ga0501070_0000020 Ga0501070_0000020_136655_137794 358
308 3300049587 Ga0501071_0042035 Ga0501071_0042035_1000_2244 358
309 3300049590 Ga0501074_0092271 Ga0501074_0092271_480_1619 358
310 3300049592 Ga0501076_0074909 Ga0501076_0074909_823_2067 358
311 3300049822 Ga0501035_0000349 Ga0501035_0000349_18749_19888 358
312 3300049823 Ga0501044_0008968 Ga0501044_0008968_9552_10691 358
313 3300049823 Ga0501044_0017133 Ga0501044_0017133_3757_4896 358
314 3300053087 Ga0500643_015919 Ga0500643_015919_944_2146 358
315 3300053735 Ga0500596_000669 Ga0500596_000669_2711_3919 358
316 3300054114 Ga0501084_0052768 Ga0501084_0052768_412_1656 358
317 3300060353 Ga0501082_0103514 Ga0501082_0103514_297_1541 358
318 3300009093 Ga0105240_10062030 Ga0105240_100620302 359
319 3300025303 Ga0209051_1000801 Ga0209051_100080111 359
320 3300031901 Ga0307406_10017840 Ga0307406_100178402 359
321 3300032004 Ga0307414_10034270 Ga0307414_100342703 359
322 3300032004 Ga0307414_10049109 Ga0307414_100491092 359
323 3300049574 Ga0501038_0021682 Ga0501038_0021682_2300_3553 359
324 3300049575 Ga0501039_0033762 Ga0501039_0033762_79_1332 359
325 3300049582 Ga0501048_0085365 Ga0501048_0085365_186_1439 359
326 3300049584 Ga0501068_0056684 Ga0501068_0056684_1083_2336 359
327 3300049587 Ga0501071_0014607 Ga0501071_0014607_1258_2511 359
328 3300049588 Ga0501072_0057633 Ga0501072_0057633_1751_3004 359
329 3300049591 Ga0501075_0000489 Ga0501075_0000489_2465_3718 359
330 3300049592 Ga0501076_0095251 Ga0501076_0095251_1060_2313 359
331 3300049741 Ga0501079_0010578 Ga0501079_0010578_25_1278 359
332 3300049742 Ga0501080_0024995 Ga0501080_0024995_1307_2560 359
333 3300049743 Ga0501081_0197992 Ga0501081_0197992_186_1439 359
334 3300049824 Ga0501045_0078570 Ga0501045_0078570_174_1427 359
335 3300054114 Ga0501084_0015084 Ga0501084_0015084_189_1442 359
336 3300060353 Ga0501082_0005325 Ga0501082_0005325_6973_8226 359
337 3300061734 Ga0530510_0003021 Ga0530510_0003021_9772_11025 359
338 iso_pu_bacteria 2513237088 2513595863 359
339 iso_pu_bacteria 2524023209 2524463227 359
340 iso_pu_bacteria 2842298080 2842303937 359
341 3300003320 rootH2_10009015 rootH2_1000901512 360
342 3300005578 Ga0068854_100211119 Ga0068854_1002111192 360
343 3300025909 Ga0207705_10000274 Ga0207705_1000027426 360
344 3300025912 Ga0207707_10031948 Ga0207707_100319483 360
345 3300025917 Ga0207660_10003617 Ga0207660_100036172 360
346 3300025919 Ga0207657_10009499 Ga0207657_100094992 360
347 3300025932 Ga0207690_10033889 Ga0207690_100338893 360
348 3300031711 Ga0265314_10012997 Ga0265314_100129975 360
349 3300048921 Ga0496118_0086478 Ga0496118_0086478_910_2124 360
350 3300049581 Ga0501047_0021206 Ga0501047_0021206_2567_3715 360
351 3300049588 Ga0501072_0045747 Ga0501072_0045747_1998_3146 360
352 3300049589 Ga0501073_0010417 Ga0501073_0010417_609_1757 360
353 3300049590 Ga0501074_0084923 Ga0501074_0084923_198_1346 360
354 3300049741 Ga0501079_0152883 Ga0501079_0152883_145_1293 360
355 3300049742 Ga0501080_0020528 Ga0501080_0020528_2372_3520 360
356 iso_pu_bacteria 2508501122 2509110350 360
357 iso_pu_bacteria 2509276019 2509377306 360
358 iso_pu_bacteria 2510917028 2511184899 360
359 iso_pu_bacteria 2513237138 2513869141 360
360 iso_pu_bacteria 2534681796 2535519683 360
361 iso_pu_bacteria 2558860100 2558862169 360
362 iso_pu_bacteria 2582581294 2585200741 360
363 iso_pu_bacteria 2582581316 2585334895 360
364 iso_pu_bacteria 2582581867 2585401754 360
365 iso_pu_bacteria 2585427590 2585820145 360
366 iso_pu_bacteria 2850079185 2850085444 360
367 iso_pu_bacteria 2923556063 2923560915 360
368 iso_pu_bacteria 8005542996 8005547395 360
369 3300002773 JGI25152J39213_1000745 JGI25152J39213_10007454 361
370 3300002773 JGI25152J39213_1004117 JGI25152J39213_10041173 361
371 3300003775 Ga0055524_1008339 Ga0055524_10083392 361
372 3300003775 Ga0055524_1010091 Ga0055524_10100912 361
373 3300003790 Ga0055528_1010360 Ga0055528_10103604 361
374 3300005843 Ga0068860_100153007 Ga0068860_1001530072 361
375 3300006178 Ga0075367_10001856 Ga0075367_100018567 361
376 3300009092 Ga0105250_10083308 Ga0105250_100833081 361
377 3300009177 Ga0105248_10000005 Ga0105248_10000005432 361
378 3300009177 Ga0105248_10108184 Ga0105248_101081842 361
379 3300021321 Ga0214542_1015520 Ga0214542_10155205 361
380 3300021327 Ga0214543_1000005 Ga0214543_1000005174 361
381 3300025258 Ga0209129_1001217 Ga0209129_10012176 361
382 3300025273 Ga0209673_1010743 Ga0209673_10107432 361
383 3300025273 Ga0209673_1013794 Ga0209673_10137942 361
384 3300025295 Ga0209564_1007884 Ga0209564_10078842 361
385 3300025295 Ga0209564_1015410 Ga0209564_10154102 361
386 3300025299 Ga0209256_1004539 Ga0209256_10045393 361
387 3300025299 Ga0209256_1006393 Ga0209256_10063932 361
388 3300025302 Ga0207426_1000730 Ga0207426_10007302 361
389 3300028381 Ga0268264_10019402 Ga0268264_100194025 361
390 3300048907 Ga0496104_0008143 Ga0496104_0008143_4654_5874 361
391 3300048908 Ga0496105_0036105 Ga0496105_0036105_686_1906 361
392 3300048919 Ga0496116_0025300 Ga0496116_0025300_685_1905 361
393 3300048922 Ga0496119_0073807 Ga0496119_0073807_84_1304 361
394 3300048925 Ga0496122_0084643 Ga0496122_0084643_317_1537 361
395 3300048928 Ga0496125_0038285 Ga0496125_0038285_912_2132 361
396 3300050494 nmdc:mga06z11_8558_c1 nmdc:mga06z11_8558_c1_580_1806 361
397 iso_pu_bacteria 2841859092 2841863035 361
398 iso_pu_bacteria 2842515876 2842519448 361
399 iso_pu_bacteria 2933011516 2933016653 361
400 iso_pu_bacteria 2989349275 2989353711 361
401 iso_pu_bacteria 8005484373 8005487709 361
402 3300053136 Ga0500559_0032177 Ga0500559_0032177_805_2001 362
403 iso_pu_bacteria 2818991448 2819608079 362
404 iso_pu_bacteria 2995392953 2995393694 362
405 iso_pu_bacteria 8005645114 8005650344 362
406 3300002737 JGI25162J39368_1001761 JGI25162J39368_100176110 363
407 3300003214 JGI25165J46597_1000537 JGI25165J46597_100053720 363
408 3300025233 Ga0209437_100023 Ga0209437_10002383 363
409 3300025261 Ga0209233_1000219 Ga0209233_100021983 363
410 3300046506 Ga0495583_0043213 Ga0495583_0043213_698_1933 363
411 3300046528 Ga0495642_0000077 Ga0495642_0000077_15614_16918 363
412 3300046683 Ga0495658_0001680 Ga0495658_0001680_5162_6319 363
413 3300046692 Ga0495671_0003564 Ga0495671_0003564_1898_3202 363
414 3300047320 Ga0495672_0001456 Ga0495672_0001456_15613_16917 363
415 3300047469 Ga0495673_0000350 Ga0495673_0000350_15614_16918 363
416 3300047470 Ga0495681_0000876 Ga0495681_0000876_15614_16918 363
417 3300049742 Ga0501080_0001196 Ga0501080_0001196_10682_11893 363
418 3300049744 Ga0501083_0001136 Ga0501083_0001136_8978_10189 363
419 3300060353 Ga0501082_0002930 Ga0501082_0002930_13152_14363 363
420 iso_pu_bacteria 2617270742 2617380939 363
421 iso_pu_bacteria 2657244999 2657684394 363
422 iso_pu_bacteria 2775507266 2778174720 363
423 iso_pu_bacteria 2791355082 2792583546 363
424 iso_pu_bacteria 2802429268 2804754799 363
425 iso_pu_bacteria 2842482326 2842485970 363
426 iso_pu_bacteria 2913295892 2913295994 363
427 iso_pu_bacteria 8049293176 8049297926 363
428 3300005578 Ga0068854_100125592 Ga0068854_1001255922 364
429 3300009545 Ga0105237_10110555 Ga0105237_101105552 364
430 3300010375 Ga0105239_10000300 Ga0105239_1000030039 364
431 3300025933 Ga0207706_10018713 Ga0207706_100187134 364
432 3300025981 Ga0207640_10001866 Ga0207640_100018663 364
433 3300025981 Ga0207640_10031181 Ga0207640_100311813 364
434 3300042015 Ga0439462_0018367 Ga0439462_0018367_159_1370 364
435 3300046460 Ga0495638_0000271 Ga0495638_0000271_55035_56339 364
436 3300053087 Ga0500643_000386 Ga0500643_000386_25876_27075 364
437 3300053087 Ga0500643_002276 Ga0500643_002276_3399_4604 364
438 3300053125 Ga0500618_001503 Ga0500618_001503_4693_5928 364
439 iso_pu_bacteria 2615840698 2616552754 364
440 iso_pu_bacteria 2667528174 2671114294 364
441 iso_pu_bacteria 2690316117 2692318394 364
442 iso_pu_bacteria 2751185821 2753462733 364
443 iso_pu_bacteria 2791355091 2792619456 364
444 iso_pu_bacteria 2791355092 2792627228 364
445 iso_pu_bacteria 2791355094 2792639876 364
446 iso_pu_bacteria 2838029111 2838030600 364
447 iso_pu_bacteria 2842475841 2842477119 364
448 iso_pu_bacteria 2842502639 2842503916 364
449 iso_pu_bacteria 2847417321 2847423104 364
450 iso_pu_bacteria 2848992105 2848997504 364
451 iso_pu_bacteria 2855872281 2855874089 364
452 iso_pu_bacteria 2919408235 2919412379 364
453 iso_pu_bacteria 3005416602 3005420585 364
454 iso_pu_bacteria 643692032 643823002 364
455 iso_pu_bacteria 8005314921 8005318006 364
456 iso_pu_bacteria 8005682033 8005683805 364
457 3300002704 JGI25155J39150_1000043 JGI25155J39150_100004365 365
458 3300002705 JGI25156J39149_1000056 JGI25156J39149_100005617 365
459 3300002738 JGI25154J39366_1000086 JGI25154J39366_100008665 365
460 3300002741 JGI25157J39369_1000086 JGI25157J39369_100008617 365
461 3300003323 rootH1_10051830 rootH1_100518305 365
462 3300005327 Ga0070658_10000001 Ga0070658_10000001109 365
463 3300005344 Ga0070661_100153643 Ga0070661_1001536432 365
464 3300005366 Ga0070659_100001698 Ga0070659_1000016987 365
465 3300005577 Ga0068857_100065010 Ga0068857_1000650101 365
466 3300005614 Ga0068856_100016897 Ga0068856_1000168974 365
467 3300005616 Ga0068852_100099006 Ga0068852_1000990062 365
468 3300006871 Ga0075434_100061314 Ga0075434_1000613143 365
469 3300009093 Ga0105240_10052334 Ga0105240_100523344 365
470 3300009174 Ga0105241_10009912 Ga0105241_100099124 365
471 3300009174 Ga0105241_10030600 Ga0105241_100306004 365
472 3300009545 Ga0105237_10019521 Ga0105237_100195214 365
473 3300009551 Ga0105238_10046084 Ga0105238_100460844 365
474 3300010375 Ga0105239_10024092 Ga0105239_100240924 365
475 3300013250 Ga0171462_1018 Ga0171462_1018150 365
476 3300025206 Ga0209435_100039 Ga0209435_10003969 365
477 3300025246 Ga0209646_1000137 Ga0209646_100013742 365
478 3300025250 Ga0209026_1000135 Ga0209026_100013569 365
479 3300025256 Ga0209759_1000154 Ga0209759_100015442 365
480 3300025909 Ga0207705_10000002 Ga0207705_100000021770 365
481 3300025911 Ga0207654_10004226 Ga0207654_100042264 365
482 3300025913 Ga0207695_10042758 Ga0207695_100427582 365
483 3300025914 Ga0207671_10012484 Ga0207671_100124844 365
484 3300025924 Ga0207694_10000230 Ga0207694_1000023052 365
485 3300025932 Ga0207690_10010071 Ga0207690_100100715 365
486 3300025949 Ga0207667_10004913 Ga0207667_100049132 365
487 3300025949 Ga0207667_10059054 Ga0207667_100590542 365
488 3300025981 Ga0207640_10002879 Ga0207640_100028797 365
489 3300026041 Ga0207639_10023974 Ga0207639_100239742 365
490 3300026078 Ga0207702_10002001 Ga0207702_100020014 365
491 3300027312 Ga0209371_1001602 Ga0209371_10016027 365
492 3300030500 Ga0268256_1001086 Ga0268256_10010864 365
493 3300044694 Ga0466963_0001063 Ga0466963_0001063_5408_6625 365
494 3300044765 Ga0466970_0000013 Ga0466970_0000013_1228_2445 365
495 3300044842 Ga0466957_0002063 Ga0466957_0002063_7324_8541 365
496 3300045836 Ga0466958_0003594 Ga0466958_0003594_2300_3517 365
497 3300048928 Ga0496125_0029974 Ga0496125_0029974_3541_4758 365
498 3300053153 Ga0500616_0000087 Ga0500616_0000087_37182_38408 365
499 3300005548 Ga0070665_100006904 Ga0070665_1000069045 366
500 3300006358 Ga0068871_100048960 Ga0068871_1000489602 366
501 3300017792 Ga0163161_10004269 Ga0163161_100042693 366
502 3300028379 Ga0268266_10001257 Ga0268266_100012577 366
503 3300031824 Ga0307413_10038369 Ga0307413_100383692 366
504 3300009098 Ga0105245_10364339 Ga0105245_103643391 367
505 3300003187 JGI25151J46595_10000400 JGI25151J46595_1000040039 368
506 3300005339 Ga0070660_100006698 Ga0070660_1000066982 368
507 3300005353 Ga0070669_100136434 Ga0070669_1001364341 368
508 3300025909 Ga0207705_10006806 Ga0207705_100068068 368
509 3300026041 Ga0207639_10084789 Ga0207639_100847892 368
510 3300032005 Ga0307411_10087535 Ga0307411_100875352 368
511 iso_pu_bacteria 2643221541 2643727265 368
512 iso_pu_bacteria 2643221606 2644041574 368
513 iso_pu_bacteria 2643221671 2644395114 368
514 3300001989 JGI24739J22299_10033070 JGI24739J22299_100330702 369
515 3300005338 Ga0068868_100000001 Ga0068868_100000001236 369
516 3300005344 Ga0070661_100105148 Ga0070661_1001051482 369
517 3300005366 Ga0070659_100000001 Ga0070659_100000001119 369
518 3300005366 Ga0070659_100060824 Ga0070659_1000608241 369
519 3300005455 Ga0070663_100001497 Ga0070663_1000014974 369
520 3300005614 Ga0068856_100011043 Ga0068856_1000110432 369
521 3300005616 Ga0068852_100013467 Ga0068852_1000134672 369
522 3300005616 Ga0068852_100109434 Ga0068852_1001094342 369
523 3300009093 Ga0105240_10120824 Ga0105240_101208242 369
524 3300013104 Ga0157370_10346663 Ga0157370_103466632 369
525 3300013105 Ga0157369_10009186 Ga0157369_100091869 369
526 3300013307 Ga0157372_10157774 Ga0157372_101577742 369
527 3300025913 Ga0207695_10153554 Ga0207695_101535542 369
528 3300025920 Ga0207649_10080598 Ga0207649_100805982 369
529 3300025932 Ga0207690_10000018 Ga0207690_10000018146 369
530 3300025981 Ga0207640_10102970 Ga0207640_101029702 369
531 3300026023 Ga0207677_10000024 Ga0207677_1000002497 369
532 3300026067 Ga0207678_10001868 Ga0207678_1000186811 369
533 3300026067 Ga0207678_10191483 Ga0207678_101914832 369
534 3300026078 Ga0207702_10078685 Ga0207702_100786852 369
535 3300026142 Ga0207698_10011041 Ga0207698_100110413 369
536 iso_pu_bacteria 2821443989 2821451009 369
537 3300005539 Ga0068853_100067304 Ga0068853_1000673042 370
538 3300021384 Ga0213876_10003603 Ga0213876_100036032 370
539 3300026041 Ga0207639_10065772 Ga0207639_100657722 370
540 3300039437 Ga0436365_1414469 Ga0436365_1414469_12038_13270 370
541 3300044656 Ga0466969_0009620 Ga0466969_0009620_2131_3273 370
542 3300044842 Ga0466957_0035118 Ga0466957_0035118_1851_2993 370
543 3300053104 Ga0500556_0001231 Ga0500556_0001231_8107_9324 370
544 3300003215 JGI25153J46596_10027636 JGI25153J46596_100276362 371
545 3300025294 Ga0209025_1000486 Ga0209025_100048674 371
546 3300025297 Ga0209758_1005395 Ga0209758_10053957 371
547 3300025302 Ga0207426_1000092 Ga0207426_100009298 371
548 3300025907 Ga0207645_10067906 Ga0207645_100679062 371
549 3300031731 Ga0307405_10157754 Ga0307405_101577541 372
550 3300031824 Ga0307413_10040926 Ga0307413_100409261 372
551 3300038443 Ga0395901_0059836 Ga0395901_0059836_2454_3611 372
552 3300050510 nmdc:mga06r32_7180_c1 nmdc:mga06r32_7180_c1_6763_7947 372
553 3300005840 Ga0068870_10083478 Ga0068870_100834782 373
554 3300032004 Ga0307414_10316523 Ga0307414_103165231 373
555 3300045976 Ga0466967_0183494 Ga0466967_0183494_502_1695 373
556 3300046684 Ga0495669_0031567 Ga0495669_0031567_483_1667 373
557 3300005544 Ga0070686_100000194 Ga0070686_1000001942 374
558 3300005548 Ga0070665_100035910 Ga0070665_1000359102 374
559 3300005614 Ga0068856_100024005 Ga0068856_1000240052 374
560 3300013105 Ga0157369_10013284 Ga0157369_100132843 374
561 3300028379 Ga0268266_10012602 Ga0268266_100126027 374
562 3300032005 Ga0307411_10041163 Ga0307411_100411632 374
563 3300037312 Ga0395899_0000756 Ga0395899_0000756_5480_6670 374
564 3300037466 Ga0395898_0001500 Ga0395898_0001500_29165_30355 374
565 3300037471 Ga0395905_0001268 Ga0395905_0001268_12980_14170 374
566 iso_pu_bacteria 2643221605 2644040598 374
567 3300005353 Ga0070669_100092494 Ga0070669_1000924942 375
568 3300005618 Ga0068864_100004726 Ga0068864_1000047264 375
569 3300025923 Ga0207681_10026824 Ga0207681_100268242 375
570 3300031852 Ga0307410_10001826 Ga0307410_100018261 375
571 3300031852 Ga0307410_10017272 Ga0307410_100172723 375
572 iso_pu_bacteria 2844533157 2844535864 375
573 3300005331 Ga0070670_100230551 Ga0070670_1002305511 376
574 3300005367 Ga0070667_100067074 Ga0070667_1000670743 376
575 3300025986 Ga0207658_10019218 Ga0207658_100192185 376
576 3300037418 Ga0395900_0084080 Ga0395900_0084080_638_1891 376
577 3300032004 Ga0307414_10046824 Ga0307414_100468242 377
578 3300013105 Ga0157369_10000553 Ga0157369_1000055340 378
579 3300037471 Ga0395905_0034799 Ga0395905_0034799_2137_3360 378
580 3300005844 Ga0068862_100073554 Ga0068862_1000735542 379
581 3300028380 Ga0268265_10041658 Ga0268265_100416582 379
582 3300031731 Ga0307405_10017380 Ga0307405_100173804 379
583 3300037471 Ga0395905_0000092 Ga0395905_0000092_9498_10736 379
584 3300001989 JGI24739J22299_10003494 JGI24739J22299_100034943 380
585 3300005530 Ga0070679_100207692 Ga0070679_1002076922 380
586 3300005841 Ga0068863_100117729 Ga0068863_1001177292 380
587 3300005844 Ga0068862_100011017 Ga0068862_1000110172 380
588 3300009177 Ga0105248_10001965 Ga0105248_100019656 380
589 3300026088 Ga0207641_10080359 Ga0207641_100803594 380
590 3300028380 Ga0268265_10008567 Ga0268265_100085672 380
591 3300005327 Ga0070658_10005984 Ga0070658_100059842 381
592 3300005329 Ga0070683_100039287 Ga0070683_1000392872 381
593 3300005339 Ga0070660_100003723 Ga0070660_1000037238 381
594 3300005355 Ga0070671_100005893 Ga0070671_1000058938 381
595 3300005436 Ga0070713_100016505 Ga0070713_1000165052 381
596 3300005563 Ga0068855_100341883 Ga0068855_1003418832 381
597 3300025909 Ga0207705_10089423 Ga0207705_100894231 381
598 3300025919 Ga0207657_10000210 Ga0207657_1000021046 381
599 3300025944 Ga0207661_10134254 Ga0207661_101342542 381
600 3300032002 Ga0307416_100151308 Ga0307416_1001513083 381
601 3300037312 Ga0395899_0000258 Ga0395899_0000258_58929_60122 381
602 3300037312 Ga0395899_0118361 Ga0395899_0118361_488_1729 381
603 3300037418 Ga0395900_0000254 Ga0395900_0000254_7161_8354 381
604 3300037466 Ga0395898_0019847 Ga0395898_0019847_2954_4147 381
605 3300037471 Ga0395905_0135777 Ga0395905_0135777_1077_2270 381
606 3300037471 Ga0395905_0249630 Ga0395905_0249630_246_1487 381
607 3300038443 Ga0395901_0000030 Ga0395901_0000030_74943_76136 381
608 3300037418 Ga0395900_0050033 Ga0395900_0050033_1670_2887 384
609 3300005614 Ga0068856_100006069 Ga0068856_10000606912 385
610 3300013105 Ga0157369_10146826 Ga0157369_101468262 385
611 3300026078 Ga0207702_10005497 Ga0207702_1000549712 385
612 3300031995 Ga0307409_100183859 Ga0307409_1001838592 386
613 3300044684 Ga0466966_0000040 Ga0466966_0000040_37352_38530 387
614 3300005578 Ga0068854_100004180 Ga0068854_1000041805 388
615 3300009093 Ga0105240_10016809 Ga0105240_100168093 388
616 3300013105 Ga0157369_10107491 Ga0157369_101074912 388
617 3300025913 Ga0207695_10003088 Ga0207695_100030889 388
618 3300025981 Ga0207640_10000668 Ga0207640_100006685 388
619 3300037312 Ga0395899_0220709 Ga0395899_0220709_21_1199 389
620 3300001904 JGI24736J21556_1002088 JGI24736J21556_10020883 397
621 3300005366 Ga0070659_100031264 Ga0070659_1000312644 397
622 3300005455 Ga0070663_100031593 Ga0070663_1000315932 397
623 3300005578 Ga0068854_100109622 Ga0068854_1001096222 397
624 3300013100 Ga0157373_10215976 Ga0157373_102159761 397
625 3300013102 Ga0157371_10165399 Ga0157371_101653992 397
626 3300013104 Ga0157370_10116180 Ga0157370_101161802 397
627 3300013307 Ga0157372_10522377 Ga0157372_105223771 397
628 3300025909 Ga0207705_10000060 Ga0207705_100000605 397
629 3300025909 Ga0207705_10008785 Ga0207705_100087855 397
630 3300025913 Ga0207695_10124933 Ga0207695_101249332 397
631 3300025920 Ga0207649_10000826 Ga0207649_1000082611 397
632 3300025932 Ga0207690_10006516 Ga0207690_100065163 397
633 3300025949 Ga0207667_10080132 Ga0207667_100801324 397
634 3300025981 Ga0207640_10037021 Ga0207640_100370212 397
635 3300026067 Ga0207678_10017893 Ga0207678_100178933 397
636 3300026078 Ga0207702_10098504 Ga0207702_100985042 397
637 3300026142 Ga0207698_10121837 Ga0207698_101218372 397
638 3300037312 Ga0395899_0088385 Ga0395899_0088385_478_1671 397
639 3300037418 Ga0395900_0077101 Ga0395900_0077101_879_2075 397
640 3300037418 Ga0395900_0408505 Ga0395900_0408505_63_1256 397
641 3300037466 Ga0395898_0271759 Ga0395898_0271759_42_1235 397
642 3300037466 Ga0395898_0365240 Ga0395898_0365240_37_1233 397
643 3300044694 Ga0466963_0039216 Ga0466963_0039216_904_2100 397

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02817

E3_binding

e3 binding domain

157

192

0.97

PF00198

2-oxoacid_dh

2-oxoacid dehydrogenases acyltransferase (catalytic domain)

221

454

0.95

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

6

78

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ejg-assembly1.cif.gz_C crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3 0.9453 3 75
1w4h-assembly1.cif.gz_A peripheral-subunit from mesophilic, thermophilic and hyperthermophilic bacteria fold by ultrafast, apparently two-state transitions 0.9436 128 167
1w88-assembly1.cif.gz_I the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2 0.9426 129 164
5gu9-assembly1.cif.gz_A structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138i mutant 0.9411 1 75
5gua-assembly1.cif.gz_A structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138y mutant 0.9354 3 75
ID Description Score Start End Superfamily
3rnmF00 Few Secondary Structures;Irregular;Dihydrolipoamide Transferase;E3-binding domain 0.9617 129 169 4.10.320.10
af_Q9FLQ4_93_170_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9585 1 75 2.40.50.100
af_Q8H107_76_169_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9579 2 74 2.40.50.100
af_P9WIS7_123_196_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9528 4 75 2.40.50.100
af_P0AFG6_2_81_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9491 2 78 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A0F2QVG6-F1-model_v4 Glutaconyl-CoA decarboxylase subunit gamma 0.96 3 75
AF-A0A6G6X4P7-F1-model_v4 2-oxoglutarate dehydrogenase E1 component (Alpha-ketoglutarate dehydrogenase) 0.9589 3 74 GO:0016624
AF-A0A7C2YCB7-F1-model_v4 Biotin attachment protein 0.9572 2 74 GO:0005737
GO:0016407
GO:0031405
AF-A0A6N2EAQ1-F1-model_v4 Lipoyl-binding domain-containing protein 0.956 2 75 GO:0005737
GO:0016407
GO:0031405
AF-A0A2V8L4T0-F1-model_v4 Acetyl-CoA carboxylase biotin carboxyl carrier protein subunit 0.9543 3 75

Feature Viewer

pLDDT pTM Quality
81.71 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map