F471987
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 643 | 385 | 536 | 180 |
Family's Representative Sequence
| Representative Sequence | 3300049569|Ga0501032_0248217|Ga0501032_0248217_511_1113 |
| Length | 200 |
| Sequence | MISVTRSIAETPMPRSAALKPEQVPADSKSTLDSFSKNIGFTPNMMAIFAQSPIAFNAWAALLGSLSKALDVKTRDSIGLAVSEVNGCDYCLTVHSFTAERMAKLPVDEIILARKGHASDVKRDAAVQFARKVIETRGQVGDADLKAVRDAGYTDANVMEIVALVAMYSLTNFFNNVFDPERDFPAVAPAGLDLNSVQPD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 2 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 3 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 4 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 5 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 6 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 7 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 8 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 9 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 10 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 11 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 12 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 13 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 14 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 15 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 16 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 17 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 18 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 19 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 20 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 21 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 22 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 23 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 24 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 25 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 26 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 27 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 28 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 29 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 30 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 31 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 32 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 33 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 34 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 35 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 36 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 37 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 38 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 39 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 40 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 41 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 42 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 43 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 44 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 45 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 46 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 47 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 48 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 49 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 50 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 51 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 52 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 53 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 54 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 55 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 56 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 57 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 58 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 59 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 60 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 61 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 62 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 63 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 64 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 65 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 66 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 67 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 68 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 69 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 70 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 71 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 72 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 73 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 74 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 75 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 76 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 77 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 78 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 79 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 80 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 81 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 82 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 83 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 84 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 85 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 86 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 87 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 88 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 89 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 90 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 91 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 92 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 94 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 95 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 103 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 104 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 106 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 107 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 109 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 110 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 111 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 112 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 113 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 114 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 115 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 116 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 117 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 119 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 120 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 121 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 122 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 123 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 130 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 133 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 142 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 145 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 146 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 148 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 149 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 150 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 157 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 194 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 196 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 197 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 202 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 204 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 207 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 208 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 209 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 210 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 211 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 212 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 213 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 215 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 216 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 217 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 218 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 219 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 220 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 221 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 222 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 223 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 224 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 225 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 226 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 227 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 228 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 229 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 230 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 231 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 232 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 233 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 234 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 235 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 236 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 237 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 238 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 239 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 240 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 311 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 312 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 313 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 314 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 315 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 316 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 319 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 320 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 321 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 322 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 323 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 324 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 325 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 326 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 327 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 328 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 329 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 330 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 331 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 353 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 355 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 356 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 357 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 358 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 359 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 360 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 361 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 362 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 363 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 364 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 367 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 368 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 369 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 370 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 371 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 372 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 373 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 374 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 375 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 376 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 377 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 378 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 379 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 380 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 381 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 382 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 383 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 384 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
| 385 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.71 |
| Metatranscriptomes | 0.47 |
| Isolates | 14.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.49 |
| Nodule | 11.98 |
| Rhizoplane | 6.22 |
| Rhizosphere | 60.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10003570 | 3300001979 | Bacteria | 6804 |
| 2 | JGI24735J21928_10060167 | 3300002067 | Bacteria | 1091 |
| 3 | JGI24738J21930_10002132 | 3300002075 | Bacteria | 5278 |
| 4 | JGI25156J39149_1000464 | 3300002705 | Bacteria | 24482 |
| 5 | JGI25159J45721_1001450 | 3300002987 | Bacteria | 9786 |
| 6 | JGI25159J45721_1008132 | 3300002987 | Bacteria | 2914 |
| 7 | JGI25151J46595_10000338 | 3300003187 | Bacteria | 50270 |
| 8 | JGI25153J46596_10000730 | 3300003215 | Bacteria | 20147 |
| 9 | rootL2_10080064 | 3300003322 | Bacteria | 2850 |
| 10 | JGI25160J50197_1000091 | 3300003354 | Bacteria | 90359 |
| 11 | JGI25160J50197_1000177 | 3300003354 | Bacteria | 53972 |
| 12 | JGI25161J50226_1000128 | 3300003374 | Bacteria | 53972 |
| 13 | Ga0032354_1093922 | 3300003693 | Bacteria | 866 |
| 14 | Ga0055533_1005848 | 3300003756 | Bacteria | 1909 |
| 15 | Ga0055527_1000047 | 3300003760 | Bacteria | 109679 |
| 16 | Ga0055535_1000040 | 3300003761 | Bacteria | 157988 |
| 17 | Ga0055542_1000065 | 3300003762 | Bacteria | 157988 |
| 18 | Ga0055529_1000094 | 3300003763 | Bacteria | 134217 |
| 19 | Ga0055526_1001794 | 3300003771 | Bacteria | 14879 |
| 20 | Ga0055536_1000103 | 3300003781 | Bacteria | 73706 |
| 21 | Ga0055534_1000104 | 3300003784 | Bacteria | 64767 |
| 22 | Ga0055534_1000158 | 3300003784 | Bacteria | 50846 |
| 23 | Ga0055531_10031081 | 3300003794 | Bacteria | 1776 |
| 24 | Ga0058692_1019790 | 3300003856 | Bacteria | 1428 |
| 25 | Ga0055543_1000174 | 3300004625 | Bacteria | 54010 |
| 26 | Ga0065165_1000317 | 3300005262 | Bacteria | 78478 |
| 27 | Ga0065165_1000580 | 3300005262 | Bacteria | 54010 |
| 28 | Ga0065165_1034621 | 3300005262 | Bacteria | 1560 |
| 29 | Ga0070670_100410065 | 3300005331 | Bacteria | 1197 |
| 30 | Ga0070680_100656373 | 3300005336 | Bacteria | 902 |
| 31 | Ga0068868_100546111 | 3300005338 | Bacteria | 1021 |
| 32 | Ga0070660_100452162 | 3300005339 | Bacteria | 1066 |
| 33 | Ga0070671_100060653 | 3300005355 | Bacteria | 3149 |
| 34 | Ga0070671_100398030 | 3300005355 | Bacteria | 1178 |
| 35 | Ga0070714_100354246 | 3300005435 | Bacteria | 1379 |
| 36 | Ga0070714_100809569 | 3300005435 | Bacteria | 907 |
| 37 | Ga0070713_100206264 | 3300005436 | Bacteria | 1777 |
| 38 | Ga0070710_10518296 | 3300005437 | Bacteria | 819 |
| 39 | Ga0070708_100734556 | 3300005445 | Bacteria | 928 |
| 40 | Ga0070663_101003365 | 3300005455 | Bacteria | 726 |
| 41 | Ga0070681_10051963 | 3300005458 | Bacteria | 4087 |
| 42 | Ga0070681_10085874 | 3300005458 | Bacteria | 3099 |
| 43 | Ga0068867_100584687 | 3300005459 | Bacteria | 972 |
| 44 | Ga0070707_100931443 | 3300005468 | Bacteria | 833 |
| 45 | Ga0070679_100319290 | 3300005530 | Bacteria | 1502 |
| 46 | Ga0068853_100878919 | 3300005539 | Bacteria | 860 |
| 47 | Ga0070665_100003864 | 3300005548 | Bacteria | 15851 |
| 48 | Ga0070665_100060216 | 3300005548 | Bacteria | 3806 |
| 49 | Ga0068855_100591174 | 3300005563 | Bacteria | 1198 |
| 50 | Ga0068857_100448670 | 3300005577 | Bacteria | 1206 |
| 51 | Ga0068864_100164171 | 3300005618 | Bacteria | 2021 |
| 52 | Ga0068864_100908058 | 3300005618 | Bacteria | 870 |
| 53 | Ga0068863_100739579 | 3300005841 | Bacteria | 979 |
| 54 | Ga0068858_101194683 | 3300005842 | Bacteria | 748 |
| 55 | Ga0081455_10029138 | 3300005937 | Bacteria | 5035 |
| 56 | Ga0081538_10089486 | 3300005981 | Bacteria | 1598 |
| 57 | Ga0081540_1050917 | 3300005983 | Bacteria | 2052 |
| 58 | Ga0075432_10006014 | 3300006058 | Bacteria | 4133 |
| 59 | Ga0070715_10325034 | 3300006163 | Bacteria | 831 |
| 60 | Ga0075362_10022226 | 3300006177 | Bacteria | 2670 |
| 61 | Ga0099825_1031931 | 3300006941 | Bacteria | 2183 |
| 62 | Ga0099824_1009101 | 3300006942 | Bacteria | 12377 |
| 63 | Ga0099824_1015049 | 3300006942 | Bacteria | 7473 |
| 64 | Ga0099824_1035917 | 3300006942 | Bacteria | 1475 |
| 65 | Ga0099794_10225119 | 3300007265 | Bacteria | 964 |
| 66 | Ga0099795_10018730 | 3300007788 | Bacteria | 2230 |
| 67 | Ga0105240_10001105 | 3300009093 | Bacteria | 47527 |
| 68 | Ga0105240_10003464 | 3300009093 | Bacteria | 24478 |
| 69 | Ga0105240_10182556 | 3300009093 | Bacteria | 2475 |
| 70 | Ga0105240_10275909 | 3300009093 | Bacteria | 1934 |
| 71 | Ga0105240_10441003 | 3300009093 | Bacteria | 1459 |
| 72 | Ga0111539_10005454 | 3300009094 | Bacteria | 16456 |
| 73 | Ga0105247_10832385 | 3300009101 | Bacteria | 707 |
| 74 | Ga0105248_11289283 | 3300009177 | Bacteria | 826 |
| 75 | Ga0105248_11696120 | 3300009177 | Bacteria | 716 |
| 76 | Ga0105237_10579633 | 3300009545 | Bacteria | 1129 |
| 77 | Ga0105237_11103672 | 3300009545 | Bacteria | 800 |
| 78 | Ga0105238_10134349 | 3300009551 | Bacteria | 2452 |
| 79 | Ga0105033_100546 | 3300009986 | Bacteria | 2904 |
| 80 | Ga0099796_10118574 | 3300010159 | Bacteria | 1015 |
| 81 | Ga0105239_10037089 | 3300010375 | Bacteria | 5347 |
| 82 | Ga0105239_10135042 | 3300010375 | Bacteria | 2746 |
| 83 | Ga0157327_1014753 | 3300012512 | Bacteria | 803 |
| 84 | Ga0157373_10017829 | 3300013100 | Bacteria | 5170 |
| 85 | Ga0157373_10205963 | 3300013100 | Bacteria | 1387 |
| 86 | Ga0157371_10000678 | 3300013102 | Bacteria | 40299 |
| 87 | Ga0157370_10025061 | 3300013104 | Bacteria | 5904 |
| 88 | Ga0157370_10330765 | 3300013104 | Bacteria | 1405 |
| 89 | Ga0157369_10084171 | 3300013105 | Bacteria | 3400 |
| 90 | Ga0157369_10311577 | 3300013105 | Bacteria | 1637 |
| 91 | Ga0157374_10613399 | 3300013296 | Bacteria | 1098 |
| 92 | Ga0157372_10000243 | 3300013307 | Bacteria | 60266 |
| 93 | Ga0157372_10389258 | 3300013307 | Bacteria | 1624 |
| 94 | Ga0157372_10561943 | 3300013307 | Bacteria | 1330 |
| 95 | Ga0163163_10276255 | 3300014325 | Bacteria | 1731 |
| 96 | Ga0163163_11079395 | 3300014325 | Bacteria | 866 |
| 97 | Ga0157380_10908730 | 3300014326 | Bacteria | 907 |
| 98 | Ga0182008_10007556 | 3300014497 | Bacteria | 5994 |
| 99 | Ga0182008_10140859 | 3300014497 | Bacteria | 1206 |
| 100 | Ga0157379_10835232 | 3300014968 | Bacteria | 871 |
| 101 | Ga0182006_1020772 | 3300015261 | Bacteria | 2747 |
| 102 | Ga0182007_10011645 | 3300015262 | Bacteria | 3418 |
| 103 | Ga0183368_1004 | 3300015687 | Bacteria | 1211761 |
| 104 | Ga0154015_1502891 | 3300020610 | Bacteria | 965 |
| 105 | Ga0213872_10000017 | 3300021361 | Bacteria | 178787 |
| 106 | Ga0213872_10000429 | 3300021361 | Bacteria | 34403 |
| 107 | Ga0213872_10001396 | 3300021361 | Bacteria | 15904 |
| 108 | Ga0213872_10006714 | 3300021361 | Bacteria | 5735 |
| 109 | Ga0213872_10011068 | 3300021361 | Bacteria | 4277 |
| 110 | Ga0213876_10004063 | 3300021384 | Bacteria | 8231 |
| 111 | Ga0209435_101001 | 3300025206 | Bacteria | 4042 |
| 112 | Ga0209436_112204 | 3300025208 | Bacteria | 1469 |
| 113 | Ga0209674_105225 | 3300025226 | Bacteria | 1961 |
| 114 | Ga0209672_100017 | 3300025228 | Bacteria | 514236 |
| 115 | Ga0209258_100038 | 3300025242 | Bacteria | 398959 |
| 116 | Ga0209677_108617 | 3300025253 | Bacteria | 1946 |
| 117 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 118 | Ga0209759_1000524 | 3300025256 | Bacteria | 40872 |
| 119 | Ga0209455_1000032 | 3300025272 | Bacteria | 514243 |
| 120 | Ga0209130_1000334 | 3300025284 | Bacteria | 54024 |
| 121 | Ga0209130_1001098 | 3300025284 | Bacteria | 20094 |
| 122 | Ga0209130_1001354 | 3300025284 | Bacteria | 16570 |
| 123 | Ga0209130_1024457 | 3300025284 | Bacteria | 1318 |
| 124 | Ga0209675_1000078 | 3300025291 | Bacteria | 156111 |
| 125 | Ga0209676_1000121 | 3300025292 | Bacteria | 198920 |
| 126 | Ga0209676_1010407 | 3300025292 | Bacteria | 3878 |
| 127 | Ga0209025_1000051 | 3300025294 | Bacteria | 330080 |
| 128 | Ga0209564_1000133 | 3300025295 | Bacteria | 189140 |
| 129 | Ga0209564_1005057 | 3300025295 | Bacteria | 7704 |
| 130 | Ga0209758_1002218 | 3300025297 | Bacteria | 20226 |
| 131 | Ga0209050_1004036 | 3300025298 | Bacteria | 10311 |
| 132 | Ga0207426_1000004 | 3300025302 | Bacteria | 1047900 |
| 133 | Ga0207426_1000272 | 3300025302 | Bacteria | 107804 |
| 134 | Ga0207426_1001300 | 3300025302 | Bacteria | 21462 |
| 135 | Ga0209051_1000850 | 3300025303 | Bacteria | 31150 |
| 136 | Ga0209257_1002935 | 3300025304 | Bacteria | 15709 |
| 137 | Ga0207647_10011058 | 3300025904 | Bacteria | 6346 |
| 138 | Ga0207685_10126951 | 3300025905 | Bacteria | 1127 |
| 139 | Ga0207699_10502201 | 3300025906 | Bacteria | 875 |
| 140 | Ga0207654_10291708 | 3300025911 | Bacteria | 1106 |
| 141 | Ga0207707_10064964 | 3300025912 | Bacteria | 3178 |
| 142 | Ga0207707_10154920 | 3300025912 | Bacteria | 2004 |
| 143 | Ga0207707_10568240 | 3300025912 | Bacteria | 962 |
| 144 | Ga0207695_10001233 | 3300025913 | Bacteria | 43793 |
| 145 | Ga0207695_10002566 | 3300025913 | Bacteria | 26692 |
| 146 | Ga0207695_10056312 | 3300025913 | Bacteria | 4092 |
| 147 | Ga0207695_10075225 | 3300025913 | Bacteria | 3436 |
| 148 | Ga0207695_10210106 | 3300025913 | Bacteria | 1857 |
| 149 | Ga0207663_10763611 | 3300025916 | Bacteria | 768 |
| 150 | Ga0207657_10113517 | 3300025919 | Bacteria | 2235 |
| 151 | Ga0207646_10254256 | 3300025922 | Bacteria | 1588 |
| 152 | Ga0207694_10356511 | 3300025924 | Bacteria | 1211 |
| 153 | Ga0207700_10638201 | 3300025928 | Bacteria | 949 |
| 154 | Ga0207664_10215544 | 3300025929 | Bacteria | 1663 |
| 155 | Ga0207644_10060662 | 3300025931 | Bacteria | 2737 |
| 156 | Ga0207644_10239071 | 3300025931 | Bacteria | 1445 |
| 157 | Ga0207644_10317495 | 3300025931 | Bacteria | 1259 |
| 158 | Ga0207644_10561374 | 3300025931 | Bacteria | 946 |
| 159 | Ga0207665_10066241 | 3300025939 | Bacteria | 2458 |
| 160 | Ga0207667_11058324 | 3300025949 | Bacteria | 796 |
| 161 | Ga0207658_11229330 | 3300025986 | Bacteria | 685 |
| 162 | Ga0207639_10372207 | 3300026041 | Bacteria | 1281 |
| 163 | Ga0207678_10039852 | 3300026067 | Bacteria | 4075 |
| 164 | Ga0207678_10229937 | 3300026067 | Bacteria | 1588 |
| 165 | Ga0207702_11483126 | 3300026078 | Bacteria | 672 |
| 166 | Ga0207641_10477228 | 3300026088 | Bacteria | 1208 |
| 167 | Ga0207648_10199348 | 3300026089 | Bacteria | 1775 |
| 168 | Ga0207676_10224021 | 3300026095 | Bacteria | 1677 |
| 169 | Ga0207676_10876010 | 3300026095 | Bacteria | 879 |
| 170 | Ga0207674_10070597 | 3300026116 | Bacteria | 3512 |
| 171 | Ga0207674_10151106 | 3300026116 | Bacteria | 2279 |
| 172 | Ga0207675_100665591 | 3300026118 | Bacteria | 1048 |
| 173 | Ga0207698_10341387 | 3300026142 | Bacteria | 1411 |
| 174 | Ga0209389_1000151 | 3300027296 | Bacteria | 59143 |
| 175 | Ga0209389_1011383 | 3300027296 | Bacteria | 8052 |
| 176 | Ga0209371_1000282 | 3300027312 | Bacteria | 58487 |
| 177 | Ga0209589_1000002 | 3300027357 | Bacteria | 708598 |
| 178 | Ga0209589_1000399 | 3300027357 | Bacteria | 59143 |
| 179 | Ga0209489_100002 | 3300027361 | Bacteria | 708609 |
| 180 | Ga0209489_100724 | 3300027361 | Bacteria | 64817 |
| 181 | Ga0209489_116339 | 3300027361 | Bacteria | 4013 |
| 182 | Ga0209700_100002 | 3300027363 | Bacteria | 708598 |
| 183 | Ga0209700_100205 | 3300027363 | Bacteria | 97882 |
| 184 | Ga0207428_10000358 | 3300027907 | Bacteria | 58945 |
| 185 | Ga0207428_10001142 | 3300027907 | Bacteria | 28779 |
| 186 | Ga0207428_10064907 | 3300027907 | Bacteria | 2882 |
| 187 | Ga0268266_10001892 | 3300028379 | Bacteria | 23598 |
| 188 | Ga0268266_10009564 | 3300028379 | Bacteria | 8529 |
| 189 | Ga0268266_10030022 | 3300028379 | Bacteria | 4619 |
| 190 | Ga0268266_10055593 | 3300028379 | Bacteria | 3403 |
| 191 | Ga0268256_1000777 | 3300030500 | Bacteria | 23090 |
| 192 | Ga0307408_100407491 | 3300031548 | Bacteria | 1169 |
| 193 | Ga0307412_10000039 | 3300031911 | Bacteria | 182976 |
| 194 | Ga0307409_101553206 | 3300031995 | Bacteria | 690 |
| 195 | Ga0395899_0009133 | 3300037312 | Bacteria | 7616 |
| 196 | Ga0395899_0033579 | 3300037312 | Bacteria | 3852 |
| 197 | Ga0395899_0039417 | 3300037312 | Bacteria | 3536 |
| 198 | Ga0395899_0097093 | 3300037312 | Bacteria | 2130 |
| 199 | Ga0395900_0002731 | 3300037418 | Bacteria | 19279 |
| 200 | Ga0395900_0004671 | 3300037418 | Bacteria | 14441 |
| 201 | Ga0395900_0060795 | 3300037418 | Bacteria | 3886 |
| 202 | Ga0395900_0083185 | 3300037418 | Bacteria | 3288 |
| 203 | Ga0395900_0173190 | 3300037418 | Bacteria | 2196 |
| 204 | Ga0395900_0307716 | 3300037418 | Bacteria | 1569 |
| 205 | Ga0395900_0735380 | 3300037418 | Bacteria | 918 |
| 206 | Ga0395900_1015858 | 3300037418 | Bacteria | 749 |
| 207 | Ga0395900_1525543 | 3300037418 | Bacteria | 580 |
| 208 | Ga0395898_0003975 | 3300037466 | Bacteria | 16274 |
| 209 | Ga0395898_0014406 | 3300037466 | Bacteria | 8125 |
| 210 | Ga0395898_0016976 | 3300037466 | Bacteria | 7434 |
| 211 | Ga0395898_0058179 | 3300037466 | Bacteria | 3764 |
| 212 | Ga0395898_0091061 | 3300037466 | Bacteria | 2934 |
| 213 | Ga0395898_0294955 | 3300037466 | Bacteria | 1547 |
| 214 | Ga0395898_0992808 | 3300037466 | Bacteria | 775 |
| 215 | Ga0395905_0001244 | 3300037471 | Bacteria | 31543 |
| 216 | Ga0395905_0002694 | 3300037471 | Bacteria | 19467 |
| 217 | Ga0395905_0029193 | 3300037471 | Bacteria | 5198 |
| 218 | Ga0395905_0068163 | 3300037471 | Bacteria | 3333 |
| 219 | Ga0395905_0087345 | 3300037471 | Bacteria | 2924 |
| 220 | Ga0395905_0093780 | 3300037471 | Bacteria | 2815 |
| 221 | Ga0395905_0294689 | 3300037471 | Bacteria | 1509 |
| 222 | Ga0395905_0467129 | 3300037471 | Bacteria | 1160 |
| 223 | Ga0395905_0645298 | 3300037471 | Bacteria | 960 |
| 224 | Ga0395905_1696346 | 3300037471 | Bacteria | 537 |
| 225 | Ga0395901_0010766 | 3300038443 | Bacteria | 9273 |
| 226 | Ga0395901_0165443 | 3300038443 | Bacteria | 2322 |
| 227 | Ga0395901_0173739 | 3300038443 | Bacteria | 2260 |
| 228 | Ga0395901_0195539 | 3300038443 | Bacteria | 2121 |
| 229 | Ga0395901_0399548 | 3300038443 | Bacteria | 1412 |
| 230 | Ga0395901_0674449 | 3300038443 | Bacteria | 1034 |
| 231 | Ga0395901_0735864 | 3300038443 | Bacteria | 980 |
| 232 | Ga0395901_0805400 | 3300038443 | Bacteria | 928 |
| 233 | Ga0436365_0241183 | 3300039437 | Bacteria | 7989 |
| 234 | Ga0436360_0258205 | 3300039438 | Bacteria | 3746 |
| 235 | Ga0436360_0631847 | 3300039438 | Bacteria | 1729 |
| 236 | Ga0436360_0798062 | 3300039438 | Bacteria | 1475 |
| 237 | Ga0436361_0267501 | 3300039447 | Bacteria | 17700 |
| 238 | Ga0436361_0408050 | 3300039447 | Bacteria | 13949 |
| 239 | Ga0436361_0409682 | 3300039447 | Bacteria | 12676 |
| 240 | Ga0436361_0597211 | 3300039447 | Bacteria | 957 |
| 241 | Ga0436361_0868243 | 3300039447 | Bacteria | 3696 |
| 242 | Ga0436361_0960211 | 3300039447 | Bacteria | 4327 |
| 243 | Ga0436361_1114381 | 3300039447 | Bacteria | 8844 |
| 244 | Ga0436361_1141074 | 3300039447 | Bacteria | 2195 |
| 245 | Ga0439465_0273170 | 3300041413 | Bacteria | 629 |
| 246 | Ga0451802_0277294 | 3300041460 | Bacteria | 1208 |
| 247 | Ga0451833_0196066 | 3300041491 | Bacteria | 4946 |
| 248 | Ga0451835_1065705 | 3300041492 | Bacteria | 5982 |
| 249 | Ga0451837_0366658 | 3300041494 | Bacteria | 2775 |
| 250 | Ga0451839_0280360 | 3300041496 | Bacteria | 1262 |
| 251 | Ga0451841_0177268 | 3300041498 | Bacteria | 744 |
| 252 | Ga0451845_0283541 | 3300041501 | Bacteria | 8233 |
| 253 | Ga0451847_0223415 | 3300041503 | Bacteria | 3343 |
| 254 | Ga0451849_0327025 | 3300041505 | Bacteria | 4536 |
| 255 | Ga0451851_0481357 | 3300041507 | Bacteria | 1237 |
| 256 | Ga0451843_0291851 | 3300041509 | Bacteria | 4485 |
| 257 | Ga0451855_1502518 | 3300041511 | Bacteria | 6426 |
| 258 | Ga0451853_1825010 | 3300041512 | Bacteria | 1238 |
| 259 | Ga0439431_0005985 | 3300041997 | Bacteria | 2684 |
| 260 | Ga0439431_0030665 | 3300041997 | Bacteria | 1333 |
| 261 | Ga0439458_0085028 | 3300042157 | Bacteria | 810 |
| 262 | Ga0439459_0050802 | 3300042438 | Bacteria | 910 |
| 263 | Ga0439460_0024779 | 3300042461 | Bacteria | 1665 |
| 264 | Ga0466982_0000055 | 3300044672 | Bacteria | 30959 |
| 265 | Ga0466965_0228400 | 3300044683 | Bacteria | 993 |
| 266 | Ga0466966_0024812 | 3300044684 | Bacteria | 3921 |
| 267 | Ga0466961_0003402 | 3300044693 | Bacteria | 9925 |
| 268 | Ga0466961_0010597 | 3300044693 | Bacteria | 5882 |
| 269 | Ga0466971_0086068 | 3300044719 | Bacteria | 1436 |
| 270 | Ga0466968_0012950 | 3300044735 | Bacteria | 3273 |
| 271 | Ga0466970_0142359 | 3300044765 | Bacteria | 1321 |
| 272 | Ga0466957_0032520 | 3300044842 | Bacteria | 3124 |
| 273 | Ga0466957_0257711 | 3300044842 | Bacteria | 1161 |
| 274 | Ga0466959_0054003 | 3300045049 | Bacteria | 2936 |
| 275 | Ga0466959_0083545 | 3300045049 | Bacteria | 2299 |
| 276 | Ga0466967_0120270 | 3300045976 | Bacteria | 2425 |
| 277 | Ga0495617_002517 | 3300046452 | Bacteria | 7252 |
| 278 | Ga0495603_0003485 | 3300046455 | Bacteria | 9357 |
| 279 | Ga0495629_0000115 | 3300046459 | Bacteria | 72648 |
| 280 | Ga0495629_0037386 | 3300046459 | Bacteria | 3422 |
| 281 | Ga0495629_0131538 | 3300046459 | Bacteria | 1743 |
| 282 | Ga0495638_0028430 | 3300046460 | Bacteria | 3611 |
| 283 | Ga0495653_0167803 | 3300046463 | Bacteria | 1518 |
| 284 | Ga0495650_0100680 | 3300046471 | Bacteria | 1085 |
| 285 | Ga0495580_0005083 | 3300046472 | Bacteria | 10959 |
| 286 | Ga0495580_0007481 | 3300046472 | Bacteria | 8777 |
| 287 | Ga0495580_0007991 | 3300046472 | Bacteria | 8453 |
| 288 | Ga0495580_0017866 | 3300046472 | Bacteria | 5290 |
| 289 | Ga0495580_0300156 | 3300046472 | Bacteria | 1094 |
| 290 | Ga0495582_0041300 | 3300046473 | Bacteria | 2541 |
| 291 | Ga0495582_0043056 | 3300046473 | Bacteria | 2486 |
| 292 | Ga0495582_0335159 | 3300046473 | Bacteria | 871 |
| 293 | Ga0495605_0012210 | 3300046474 | Bacteria | 4770 |
| 294 | Ga0495605_0021218 | 3300046474 | Bacteria | 3443 |
| 295 | Ga0495662_0023296 | 3300046476 | Bacteria | 2989 |
| 296 | Ga0495664_0003646 | 3300046477 | Bacteria | 8392 |
| 297 | Ga0495664_0031579 | 3300046477 | Bacteria | 3106 |
| 298 | Ga0495584_0000044 | 3300046491 | Bacteria | 89613 |
| 299 | Ga0495584_0374165 | 3300046491 | Bacteria | 723 |
| 300 | Ga0495585_0053649 | 3300046492 | Bacteria | 2231 |
| 301 | Ga0495585_0195685 | 3300046492 | Bacteria | 1032 |
| 302 | Ga0495585_0341107 | 3300046492 | Bacteria | 729 |
| 303 | Ga0495594_0156693 | 3300046499 | Bacteria | 1293 |
| 304 | Ga0495596_0005728 | 3300046500 | Bacteria | 5832 |
| 305 | Ga0495596_0031390 | 3300046500 | Bacteria | 2122 |
| 306 | Ga0495583_0000078 | 3300046506 | Bacteria | 171719 |
| 307 | Ga0495583_0004535 | 3300046506 | Bacteria | 9889 |
| 308 | Ga0495583_0009898 | 3300046506 | Bacteria | 5638 |
| 309 | Ga0495583_0166409 | 3300046506 | Bacteria | 907 |
| 310 | Ga0495606_0012747 | 3300046507 | Bacteria | 6702 |
| 311 | Ga0495606_0029483 | 3300046507 | Bacteria | 3851 |
| 312 | Ga0495606_0031841 | 3300046507 | Bacteria | 3661 |
| 313 | Ga0495606_0101834 | 3300046507 | Bacteria | 1747 |
| 314 | Ga0495610_0000817 | 3300046512 | Bacteria | 29198 |
| 315 | Ga0495610_0005757 | 3300046512 | Bacteria | 8724 |
| 316 | Ga0495616_0025438 | 3300046513 | Bacteria | 3163 |
| 317 | Ga0495618_0029626 | 3300046514 | Bacteria | 3415 |
| 318 | Ga0495620_0243148 | 3300046515 | Bacteria | 687 |
| 319 | Ga0495628_0004561 | 3300046516 | Bacteria | 12265 |
| 320 | Ga0495628_0039365 | 3300046516 | Bacteria | 3781 |
| 321 | Ga0495628_0122219 | 3300046516 | Bacteria | 1996 |
| 322 | Ga0495628_0126087 | 3300046516 | Bacteria | 1961 |
| 323 | Ga0495630_0037973 | 3300046517 | Bacteria | 3601 |
| 324 | Ga0495630_0120724 | 3300046517 | Bacteria | 1988 |
| 325 | Ga0495643_0128984 | 3300046522 | Bacteria | 1271 |
| 326 | Ga0495648_0007550 | 3300046524 | Bacteria | 8691 |
| 327 | Ga0495648_0038936 | 3300046524 | Bacteria | 3032 |
| 328 | Ga0495648_0065131 | 3300046524 | Bacteria | 2144 |
| 329 | Ga0495648_0081605 | 3300046524 | Bacteria | 1838 |
| 330 | Ga0495648_0103768 | 3300046524 | Bacteria | 1562 |
| 331 | Ga0495666_0072511 | 3300046526 | Bacteria | 1635 |
| 332 | Ga0495666_0095592 | 3300046526 | Bacteria | 1401 |
| 333 | Ga0495666_0141488 | 3300046526 | Bacteria | 1121 |
| 334 | Ga0495652_0312438 | 3300046529 | Bacteria | 1138 |
| 335 | Ga0495665_0094787 | 3300046531 | Bacteria | 1567 |
| 336 | Ga0495665_0218922 | 3300046531 | Bacteria | 984 |
| 337 | Ga0495586_0585549 | 3300046535 | Bacteria | 644 |
| 338 | Ga0495598_0122468 | 3300046537 | Bacteria | 883 |
| 339 | Ga0495609_0007383 | 3300046538 | Bacteria | 5494 |
| 340 | Ga0495597_0046937 | 3300046542 | Bacteria | 1913 |
| 341 | Ga0495645_0060195 | 3300046543 | Bacteria | 2753 |
| 342 | Ga0495645_0106697 | 3300046543 | Bacteria | 1986 |
| 343 | Ga0495622_0032041 | 3300046557 | Bacteria | 2455 |
| 344 | Ga0495622_0060832 | 3300046557 | Bacteria | 1749 |
| 345 | Ga0495622_0133632 | 3300046557 | Bacteria | 1129 |
| 346 | Ga0495633_0044642 | 3300046558 | Bacteria | 2100 |
| 347 | Ga0495656_0249118 | 3300046615 | Bacteria | 897 |
| 348 | Ga0495668_0010203 | 3300046616 | Bacteria | 5707 |
| 349 | Ga0495668_0029860 | 3300046616 | Bacteria | 3080 |
| 350 | Ga0495634_0223937 | 3300046642 | Bacteria | 1160 |
| 351 | Ga0495611_0136681 | 3300046648 | Bacteria | 1144 |
| 352 | Ga0495625_0042718 | 3300046660 | Bacteria | 3292 |
| 353 | Ga0495625_0070500 | 3300046660 | Bacteria | 2454 |
| 354 | Ga0495625_0096783 | 3300046660 | Bacteria | 2033 |
| 355 | Ga0495625_0172748 | 3300046660 | Bacteria | 1442 |
| 356 | Ga0495635_0147920 | 3300046663 | Bacteria | 1599 |
| 357 | Ga0495635_0402918 | 3300046663 | Bacteria | 909 |
| 358 | Ga0495659_0008738 | 3300046664 | Bacteria | 3226 |
| 359 | Ga0495661_0002353 | 3300046665 | Bacteria | 14589 |
| 360 | Ga0495661_0243404 | 3300046665 | Bacteria | 921 |
| 361 | Ga0495588_0162257 | 3300046674 | Bacteria | 1182 |
| 362 | Ga0495623_0045465 | 3300046679 | Bacteria | 2789 |
| 363 | Ga0495623_0060007 | 3300046679 | Bacteria | 2388 |
| 364 | Ga0495623_0211647 | 3300046679 | Bacteria | 1109 |
| 365 | Ga0495646_0023672 | 3300046680 | Bacteria | 3865 |
| 366 | Ga0495646_0296433 | 3300046680 | Bacteria | 856 |
| 367 | Ga0495613_0717453 | 3300046689 | Bacteria | 657 |
| 368 | Ga0495624_0000978 | 3300046690 | Bacteria | 22572 |
| 369 | Ga0495624_0011981 | 3300046690 | Bacteria | 5942 |
| 370 | Ga0495624_0092045 | 3300046690 | Bacteria | 1870 |
| 371 | Ga0495624_0186190 | 3300046690 | Bacteria | 1263 |
| 372 | Ga0495671_0005615 | 3300046692 | Bacteria | 7318 |
| 373 | Ga0495671_0076163 | 3300046692 | Bacteria | 1645 |
| 374 | Ga0495671_0390541 | 3300046692 | Bacteria | 666 |
| 375 | Ga0495649_0010113 | 3300046694 | Bacteria | 5574 |
| 376 | Ga0495649_0354946 | 3300046694 | Bacteria | 740 |
| 377 | Ga0495589_0121557 | 3300046794 | Bacteria | 1257 |
| 378 | Ga0495660_0124384 | 3300046810 | Bacteria | 1301 |
| 379 | Ga0495604_0141989 | 3300047317 | Bacteria | 1715 |
| 380 | Ga0495604_0165120 | 3300047317 | Bacteria | 1561 |
| 381 | Ga0495636_0331509 | 3300047318 | Bacteria | 716 |
| 382 | Ga0495674_0004450 | 3300047319 | Bacteria | 13484 |
| 383 | Ga0495674_0007013 | 3300047319 | Bacteria | 10781 |
| 384 | Ga0495674_0012300 | 3300047319 | Bacteria | 8067 |
| 385 | Ga0495674_0016409 | 3300047319 | Bacteria | 6906 |
| 386 | Ga0495674_0027469 | 3300047319 | Bacteria | 5201 |
| 387 | Ga0495674_0037502 | 3300047319 | Bacteria | 4355 |
| 388 | Ga0495674_0063791 | 3300047319 | Bacteria | 3204 |
| 389 | Ga0495674_0081827 | 3300047319 | Bacteria | 2769 |
| 390 | Ga0495674_0379936 | 3300047319 | Bacteria | 1143 |
| 391 | Ga0495672_0010500 | 3300047320 | Bacteria | 6594 |
| 392 | Ga0495672_0079207 | 3300047320 | Bacteria | 1835 |
| 393 | Ga0495672_0089869 | 3300047320 | Bacteria | 1689 |
| 394 | Ga0495676_0025546 | 3300047321 | Bacteria | 5098 |
| 395 | Ga0495676_0026568 | 3300047321 | Bacteria | 4982 |
| 396 | Ga0495676_0038841 | 3300047321 | Bacteria | 3950 |
| 397 | Ga0495676_0088730 | 3300047321 | Bacteria | 2318 |
| 398 | Ga0495676_0104440 | 3300047321 | Bacteria | 2090 |
| 399 | Ga0495676_0124251 | 3300047321 | Bacteria | 1872 |
| 400 | Ga0495680_0131891 | 3300047322 | Bacteria | 1835 |
| 401 | Ga0495683_0001084 | 3300047323 | Bacteria | 18805 |
| 402 | Ga0495683_0005347 | 3300047323 | Bacteria | 7131 |
| 403 | Ga0495683_0023141 | 3300047323 | Bacteria | 3194 |
| 404 | Ga0495687_005866 | 3300047443 | Bacteria | 7687 |
| 405 | Ga0495687_012669 | 3300047443 | Bacteria | 4445 |
| 406 | Ga0495687_022679 | 3300047443 | Bacteria | 3010 |
| 407 | Ga0495679_000641 | 3300047446 | Bacteria | 23464 |
| 408 | Ga0495673_0009886 | 3300047469 | Bacteria | 5233 |
| 409 | Ga0495673_0019803 | 3300047469 | Bacteria | 3365 |
| 410 | Ga0495684_0646667 | 3300047471 | Bacteria | 708 |
| 411 | Ga0495686_0214228 | 3300047472 | Bacteria | 1099 |
| 412 | Ga0495593_0038558 | 3300047673 | Bacteria | 2580 |
| 413 | Ga0495593_0183539 | 3300047673 | Bacteria | 1053 |
| 414 | Ga0495593_0449942 | 3300047673 | Bacteria | 644 |
| 415 | Ga0495602_0008361 | 3300048088 | Bacteria | 10814 |
| 416 | Ga0495602_0046703 | 3300048088 | Bacteria | 3909 |
| 417 | Ga0495602_0065291 | 3300048088 | Bacteria | 3142 |
| 418 | Ga0495602_0190994 | 3300048088 | Bacteria | 1570 |
| 419 | Ga0495614_0048179 | 3300048089 | Bacteria | 1827 |
| 420 | Ga0495614_0052367 | 3300048089 | Bacteria | 1749 |
| 421 | Ga0495626_0003399 | 3300048091 | Bacteria | 10240 |
| 422 | Ga0495626_0029777 | 3300048091 | Bacteria | 2638 |
| 423 | Ga0495626_0051845 | 3300048091 | Bacteria | 1892 |
| 424 | Ga0495626_0313084 | 3300048091 | Bacteria | 618 |
| 425 | Ga0496100_0000408 | 3300048903 | Bacteria | 20729 |
| 426 | Ga0496101_0000741 | 3300048904 | Bacteria | 19422 |
| 427 | Ga0496101_0025872 | 3300048904 | Bacteria | 4075 |
| 428 | Ga0496102_0000675 | 3300048905 | Bacteria | 34171 |
| 429 | Ga0496102_0134510 | 3300048905 | Bacteria | 2316 |
| 430 | Ga0496102_0451998 | 3300048905 | Bacteria | 1205 |
| 431 | Ga0496102_0532990 | 3300048905 | Bacteria | 1097 |
| 432 | Ga0496102_1507259 | 3300048905 | Bacteria | 591 |
| 433 | Ga0496103_0001501 | 3300048906 | Bacteria | 15620 |
| 434 | Ga0496103_0216957 | 3300048906 | Bacteria | 1230 |
| 435 | Ga0496104_0006567 | 3300048907 | Bacteria | 10231 |
| 436 | Ga0496104_0201526 | 3300048907 | Bacteria | 1902 |
| 437 | Ga0496104_1018406 | 3300048907 | Bacteria | 732 |
| 438 | Ga0496104_1314280 | 3300048907 | Bacteria | 626 |
| 439 | Ga0496105_0021121 | 3300048908 | Bacteria | 5266 |
| 440 | Ga0496105_0032526 | 3300048908 | Bacteria | 4281 |
| 441 | Ga0496105_0187145 | 3300048908 | Bacteria | 1694 |
| 442 | Ga0496106_0000079 | 3300048909 | Bacteria | 77180 |
| 443 | Ga0496106_0031611 | 3300048909 | Bacteria | 3945 |
| 444 | Ga0496107_0077442 | 3300048910 | Bacteria | 2422 |
| 445 | Ga0496107_0574682 | 3300048910 | Bacteria | 834 |
| 446 | Ga0496108_0536459 | 3300048911 | Bacteria | 1021 |
| 447 | Ga0496108_0728525 | 3300048911 | Bacteria | 859 |
| 448 | Ga0496109_0157851 | 3300048912 | Bacteria | 2125 |
| 449 | Ga0496109_0273698 | 3300048912 | Bacteria | 1591 |
| 450 | Ga0496109_1358039 | 3300048912 | Bacteria | 646 |
| 451 | Ga0496111_0147815 | 3300048914 | Bacteria | 1743 |
| 452 | Ga0496112_0107647 | 3300048915 | Bacteria | 2758 |
| 453 | Ga0496112_0118854 | 3300048915 | Bacteria | 2613 |
| 454 | Ga0496112_0138942 | 3300048915 | Bacteria | 2399 |
| 455 | Ga0496112_0771072 | 3300048915 | Bacteria | 887 |
| 456 | Ga0496112_0966378 | 3300048915 | Bacteria | 772 |
| 457 | Ga0496113_0044934 | 3300048916 | Bacteria | 3274 |
| 458 | Ga0496113_0150045 | 3300048916 | Bacteria | 1838 |
| 459 | Ga0496114_0529773 | 3300048917 | Bacteria | 1041 |
| 460 | Ga0496115_0261851 | 3300048918 | Bacteria | 1422 |
| 461 | Ga0496116_0031713 | 3300048919 | Bacteria | 3778 |
| 462 | Ga0496117_0001301 | 3300048920 | Bacteria | 36722 |
| 463 | Ga0496117_0045486 | 3300048920 | Bacteria | 3169 |
| 464 | Ga0496117_0133549 | 3300048920 | Bacteria | 1499 |
| 465 | Ga0496117_0237154 | 3300048920 | Bacteria | 1004 |
| 466 | Ga0496118_0001539 | 3300048921 | Bacteria | 34281 |
| 467 | Ga0496118_0037057 | 3300048921 | Bacteria | 3931 |
| 468 | Ga0496118_0041020 | 3300048921 | Bacteria | 3671 |
| 469 | Ga0496118_0393329 | 3300048921 | Bacteria | 723 |
| 470 | Ga0496119_0061947 | 3300048922 | Bacteria | 2231 |
| 471 | Ga0496120_0121050 | 3300048923 | Bacteria | 1353 |
| 472 | Ga0496120_0159337 | 3300048923 | Bacteria | 1127 |
| 473 | Ga0496120_0183212 | 3300048923 | Bacteria | 1026 |
| 474 | Ga0496121_0000993 | 3300048924 | Bacteria | 50722 |
| 475 | Ga0496121_0019038 | 3300048924 | Bacteria | 6888 |
| 476 | Ga0496121_0028768 | 3300048924 | Bacteria | 5164 |
| 477 | Ga0496121_0050303 | 3300048924 | Bacteria | 3522 |
| 478 | Ga0496121_0175450 | 3300048924 | Bacteria | 1552 |
| 479 | Ga0496121_0190062 | 3300048924 | Bacteria | 1473 |
| 480 | Ga0496121_0449448 | 3300048924 | Bacteria | 831 |
| 481 | Ga0496124_0129939 | 3300048927 | Bacteria | 2002 |
| 482 | Ga0496124_0385582 | 3300048927 | Bacteria | 978 |
| 483 | Ga0496124_0566637 | 3300048927 | Bacteria | 746 |
| 484 | Ga0496126_0000271 | 3300048929 | Bacteria | 110289 |
| 485 | Ga0496126_0006836 | 3300048929 | Bacteria | 12650 |
| 486 | Ga0495682_0000114 | 3300049460 | Bacteria | 69788 |
| 487 | Ga0495682_0007721 | 3300049460 | Bacteria | 4263 |
| 488 | Ga0501032_0248217 | 3300049569 | Bacteria | 1156 |
| 489 | Ga0501033_0039676 | 3300049570 | Bacteria | 3517 |
| 490 | Ga0501033_0075737 | 3300049570 | Bacteria | 2470 |
| 491 | Ga0501034_0929655 | 3300049571 | Unclassified | 756 |
| 492 | Ga0501036_0478272 | 3300049572 | Bacteria | 1037 |
| 493 | Ga0501037_0056658 | 3300049573 | Bacteria | 2862 |
| 494 | Ga0501038_0047009 | 3300049574 | Bacteria | 3740 |
| 495 | Ga0501043_0128792 | 3300049579 | Bacteria | 1984 |
| 496 | Ga0501043_0217263 | 3300049579 | Bacteria | 1480 |
| 497 | Ga0501046_0363554 | 3300049580 | Bacteria | 1049 |
| 498 | Ga0501047_0012459 | 3300049581 | Bacteria | 8052 |
| 499 | Ga0501047_0015628 | 3300049581 | Bacteria | 7233 |
| 500 | Ga0501047_1278239 | 3300049581 | Unclassified | 548 |
| 501 | Ga0501068_0082913 | 3300049584 | Bacteria | 1970 |
| 502 | Ga0501069_0087893 | 3300049585 | Bacteria | 1756 |
| 503 | Ga0501070_0322270 | 3300049586 | Bacteria | 1257 |
| 504 | Ga0501072_0903838 | 3300049588 | Bacteria | 690 |
| 505 | Ga0501073_0029768 | 3300049589 | Bacteria | 3902 |
| 506 | Ga0501079_0457929 | 3300049741 | Bacteria | 1002 |
| 507 | Ga0501080_0013131 | 3300049742 | Bacteria | 7608 |
| 508 | Ga0501080_0548281 | 3300049742 | Bacteria | 1030 |
| 509 | Ga0501083_0025446 | 3300049744 | Bacteria | 4098 |
| 510 | Ga0501083_0496189 | 3300049744 | Bacteria | 795 |
| 511 | Ga0501035_0004139 | 3300049822 | Bacteria | 13782 |
| 512 | Ga0501044_0015752 | 3300049823 | Bacteria | 8143 |
| 513 | Ga0501044_0021527 | 3300049823 | Bacteria | 6877 |
| 514 | Ga0501044_0057444 | 3300049823 | Bacteria | 3993 |
| 515 | Ga0501044_0123376 | 3300049823 | Bacteria | 2589 |
| 516 | Ga0501044_0126146 | 3300049823 | Bacteria | 2557 |
| 517 | Ga0501044_0370964 | 3300049823 | Bacteria | 1348 |
| 518 | nmdc:mga08y16_1559_c1 | 3300050511 | Bacteria | 23103 |
| 519 | nmdc:mga0sz30_10285_c1 | 3300050516 | Bacteria | 3583 |
| 520 | Ga0495612_0060077 | 3300053078 | Bacteria | 1573 |
| 521 | Ga0500643_000028 | 3300053087 | Bacteria | 245672 |
| 522 | Ga0500566_0000206 | 3300053094 | Bacteria | 31132 |
| 523 | Ga0500566_0002818 | 3300053094 | Bacteria | 10354 |
| 524 | Ga0500555_012708 | 3300053103 | Bacteria | 2424 |
| 525 | Ga0500594_0119107 | 3300053118 | Bacteria | 827 |
| 526 | Ga0500614_139634 | 3300053123 | Bacteria | 724 |
| 527 | Ga0500652_125140 | 3300053131 | Bacteria | 1074 |
| 528 | Ga0500568_0000447 | 3300053139 | Bacteria | 31023 |
| 529 | Ga0500616_0000231 | 3300053153 | Bacteria | 87444 |
| 530 | Ga0500616_0098180 | 3300053153 | Bacteria | 1437 |
| 531 | Ga0500616_0106466 | 3300053153 | Bacteria | 1362 |
| 532 | Ga0500633_0000284 | 3300053160 | Bacteria | 7411 |
| 533 | Ga0500587_012891 | 3300053739 | Bacteria | 1054 |
| 534 | Ga0587082_039186 | 3300059504 | Bacteria | 861 |
| 535 | Ga0501082_0154969 | 3300060353 | Bacteria | 1990 |
| 536 | Ga0466962_0271276 | 3300061719 | Bacteria | 836 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049581 | Ga0501047_1278239 | Ga0501047_1278239_92_538 | 148 |
| 2 | 3300027907 | Ga0207428_10000358 | Ga0207428_1000035810 | 160 |
| 3 | 3300037471 | Ga0395905_1696346 | Ga0395905_1696346_42_524 | 160 |
| 4 | 3300039447 | Ga0436361_0597211 | Ga0436361_0597211_36_518 | 160 |
| 5 | 3300041997 | Ga0439431_0005985 | Ga0439431_0005985_2144_2626 | 160 |
| 6 | 3300045049 | Ga0466959_0083545 | Ga0466959_0083545_1803_2285 | 160 |
| 7 | 3300046499 | Ga0495594_0156693 | Ga0495594_0156693_769_1251 | 160 |
| 8 | 3300046500 | Ga0495596_0005728 | Ga0495596_0005728_3286_3768 | 160 |
| 9 | 3300046694 | Ga0495649_0354946 | Ga0495649_0354946_226_708 | 160 |
| 10 | 3300048910 | Ga0496107_0574682 | Ga0496107_0574682_219_701 | 160 |
| 11 | 3300048914 | Ga0496111_0147815 | Ga0496111_0147815_1229_1711 | 160 |
| 12 | 3300049823 | Ga0501044_0126146 | Ga0501044_0126146_1302_1859 | 160 |
| 13 | 3300061719 | Ga0466962_0271276 | Ga0466962_0271276_318_800 | 160 |
| 14 | iso_pu_bacteria | 2824704595 | 2824705141 | 160 |
| 15 | 3300053131 | Ga0500652_125140 | Ga0500652_125140_336_827 | 163 |
| 16 | 3300048923 | Ga0496120_0159337 | Ga0496120_0159337_99_599 | 165 |
| 17 | iso_pu_bacteria | 2903768456 | 2903774174 | 166 |
| 18 | iso_pu_bacteria | 2904615490 | 2904624351 | 166 |
| 19 | iso_pu_bacteria | 2906643746 | 2906651806 | 166 |
| 20 | 3300014968 | Ga0157379_10835232 | Ga0157379_108352321 | 170 |
| 21 | 3300037418 | Ga0395900_0083185 | Ga0395900_0083185_1206_1754 | 170 |
| 22 | 3300037418 | Ga0395900_0307716 | Ga0395900_0307716_226_738 | 170 |
| 23 | 3300037418 | Ga0395900_1525543 | Ga0395900_1525543_14_526 | 170 |
| 24 | 3300037466 | Ga0395898_0992808 | Ga0395898_0992808_213_761 | 170 |
| 25 | 3300037471 | Ga0395905_0645298 | Ga0395905_0645298_30_578 | 170 |
| 26 | 3300038443 | Ga0395901_0165443 | Ga0395901_0165443_1076_1624 | 170 |
| 27 | 3300041413 | Ga0439465_0273170 | Ga0439465_0273170_12_524 | 170 |
| 28 | 3300044735 | Ga0466968_0012950 | Ga0466968_0012950_2014_2526 | 170 |
| 29 | 3300046459 | Ga0495629_0000115 | Ga0495629_0000115_30559_31071 | 170 |
| 30 | 3300046472 | Ga0495580_0007481 | Ga0495580_0007481_904_1416 | 170 |
| 31 | 3300046476 | Ga0495662_0023296 | Ga0495662_0023296_646_1158 | 170 |
| 32 | 3300046506 | Ga0495583_0166409 | Ga0495583_0166409_11_523 | 170 |
| 33 | 3300046516 | Ga0495628_0004561 | Ga0495628_0004561_1550_2062 | 170 |
| 34 | 3300046516 | Ga0495628_0039365 | Ga0495628_0039365_448_960 | 170 |
| 35 | 3300046524 | Ga0495648_0081605 | Ga0495648_0081605_518_1030 | 170 |
| 36 | 3300046529 | Ga0495652_0312438 | Ga0495652_0312438_584_1096 | 170 |
| 37 | 3300046531 | Ga0495665_0218922 | Ga0495665_0218922_445_957 | 170 |
| 38 | 3300046535 | Ga0495586_0585549 | Ga0495586_0585549_119_631 | 170 |
| 39 | 3300046616 | Ga0495668_0029860 | Ga0495668_0029860_1609_2121 | 170 |
| 40 | 3300046642 | Ga0495634_0223937 | Ga0495634_0223937_339_851 | 170 |
| 41 | 3300046663 | Ga0495635_0402918 | Ga0495635_0402918_319_879 | 170 |
| 42 | 3300046680 | Ga0495646_0023672 | Ga0495646_0023672_3319_3831 | 170 |
| 43 | 3300046680 | Ga0495646_0296433 | Ga0495646_0296433_21_533 | 170 |
| 44 | 3300046690 | Ga0495624_0000978 | Ga0495624_0000978_455_967 | 170 |
| 45 | 3300047320 | Ga0495672_0010500 | Ga0495672_0010500_1318_1830 | 170 |
| 46 | 3300047443 | Ga0495687_022679 | Ga0495687_022679_1338_1850 | 170 |
| 47 | 3300048088 | Ga0495602_0046703 | Ga0495602_0046703_573_1085 | 170 |
| 48 | 3300048905 | Ga0496102_0532990 | Ga0496102_0532990_89_601 | 170 |
| 49 | 3300048905 | Ga0496102_1507259 | Ga0496102_1507259_67_579 | 170 |
| 50 | 3300048924 | Ga0496121_0028768 | Ga0496121_0028768_3823_4335 | 170 |
| 51 | 3300048929 | Ga0496126_0006836 | Ga0496126_0006836_7187_7699 | 170 |
| 52 | 3300049586 | Ga0501070_0322270 | Ga0501070_0322270_497_1084 | 170 |
| 53 | 3300049588 | Ga0501072_0903838 | Ga0501072_0903838_80_592 | 170 |
| 54 | 3300049822 | Ga0501035_0004139 | Ga0501035_0004139_2711_3223 | 170 |
| 55 | iso_pu_bacteria | 3005409236 | 3005415336 | 170 |
| 56 | 3300006941 | Ga0099825_1031931 | Ga0099825_10319313 | 171 |
| 57 | 3300027296 | Ga0209389_1011383 | Ga0209389_101138312 | 171 |
| 58 | 3300027361 | Ga0209489_116339 | Ga0209489_1163392 | 171 |
| 59 | 3300027363 | Ga0209700_100205 | Ga0209700_100205103 | 171 |
| 60 | 3300046492 | Ga0495585_0053649 | Ga0495585_0053649_1481_1999 | 172 |
| 61 | 3300009094 | Ga0111539_10005454 | Ga0111539_100054547 | 173 |
| 62 | 3300050511 | nmdc:mga08y16_1559_c1 | nmdc:mga08y16_1559_c1_18975_19496 | 173 |
| 63 | 3300013100 | Ga0157373_10205963 | Ga0157373_102059632 | 174 |
| 64 | 3300013104 | Ga0157370_10025061 | Ga0157370_100250613 | 174 |
| 65 | 3300013105 | Ga0157369_10084171 | Ga0157369_100841712 | 174 |
| 66 | 3300014497 | Ga0182008_10007556 | Ga0182008_100075565 | 174 |
| 67 | 3300015261 | Ga0182006_1020772 | Ga0182006_10207722 | 174 |
| 68 | 3300015262 | Ga0182007_10011645 | Ga0182007_100116454 | 174 |
| 69 | 3300045976 | Ga0466967_0120270 | Ga0466967_0120270_50_595 | 174 |
| 70 | 3300046524 | Ga0495648_0065131 | Ga0495648_0065131_836_1360 | 174 |
| 71 | 3300049823 | Ga0501044_0370964 | Ga0501044_0370964_556_1083 | 175 |
| 72 | 3300048909 | Ga0496106_0000079 | Ga0496106_0000079_4310_4840 | 176 |
| 73 | iso_pu_bacteria | 2508501042 | 2508690525 | 177 |
| 74 | iso_pu_bacteria | 2509276021 | 2509385988 | 177 |
| 75 | iso_pu_bacteria | 2511231017 | 2511335531 | 177 |
| 76 | iso_pu_bacteria | 2513237096 | 2513660398 | 177 |
| 77 | iso_pu_bacteria | 2513237098 | 2513677386 | 177 |
| 78 | iso_pu_bacteria | 2513237137 | 2513860737 | 177 |
| 79 | iso_pu_bacteria | 2513237137 | 2513863334 | 177 |
| 80 | iso_pu_bacteria | 2513237139 | 2513876121 | 177 |
| 81 | iso_pu_bacteria | 2513237145 | 2513916916 | 177 |
| 82 | iso_pu_bacteria | 2513237151 | 2513961383 | 177 |
| 83 | iso_pu_bacteria | 2513237166 | 2514053923 | 177 |
| 84 | iso_pu_bacteria | 2515075009 | 2515109739 | 177 |
| 85 | iso_pu_bacteria | 2515154189 | 2516022070 | 177 |
| 86 | iso_pu_bacteria | 2524023205 | 2524441330 | 177 |
| 87 | iso_pu_bacteria | 2524023210 | 2524469642 | 177 |
| 88 | iso_pu_bacteria | 2582581316 | 2585336316 | 177 |
| 89 | iso_pu_bacteria | 2667528175 | 2671123674 | 177 |
| 90 | iso_pu_bacteria | 2728368998 | 2728748093 | 177 |
| 91 | iso_pu_bacteria | 2738541296 | 2738819296 | 177 |
| 92 | iso_pu_bacteria | 2738541298 | 2738831775 | 177 |
| 93 | iso_pu_bacteria | 2738541306 | 2738873303 | 177 |
| 94 | iso_pu_bacteria | 2738543002 | 2739184933 | 177 |
| 95 | iso_pu_bacteria | 2738543008 | 2739219902 | 177 |
| 96 | iso_pu_bacteria | 2738543009 | 2739226806 | 177 |
| 97 | iso_pu_bacteria | 2739367700 | 2739731142 | 177 |
| 98 | iso_pu_bacteria | 2739367874 | 2740058635 | 177 |
| 99 | iso_pu_bacteria | 2765235942 | 2766067080 | 177 |
| 100 | iso_pu_bacteria | 2791355137 | 2792837538 | 177 |
| 101 | iso_pu_bacteria | 2791355199 | 2793079095 | 177 |
| 102 | iso_pu_bacteria | 2791355267 | 2793371196 | 177 |
| 103 | iso_pu_bacteria | 2821443989 | 2821449144 | 177 |
| 104 | iso_pu_bacteria | 2824773399 | 2824774465 | 177 |
| 105 | iso_pu_bacteria | 2838074704 | 2838079194 | 177 |
| 106 | iso_pu_bacteria | 2841941048 | 2841942974 | 177 |
| 107 | iso_pu_bacteria | 2841974524 | 2841980918 | 177 |
| 108 | iso_pu_bacteria | 2852387548 | 2852393746 | 177 |
| 109 | iso_pu_bacteria | 2852387548 | 2852393753 | 177 |
| 110 | iso_pu_bacteria | 2879099564 | 2879102520 | 177 |
| 111 | iso_pu_bacteria | 2881665667 | 2881667118 | 177 |
| 112 | iso_pu_bacteria | 2885270888 | 2885277603 | 177 |
| 113 | iso_pu_bacteria | 2885383462 | 2885385823 | 177 |
| 114 | iso_pu_bacteria | 2904615490 | 2904623008 | 177 |
| 115 | iso_pu_bacteria | 2904690495 | 2904698488 | 177 |
| 116 | iso_pu_bacteria | 2906635258 | 2906641358 | 177 |
| 117 | iso_pu_bacteria | 2906635258 | 2906643301 | 177 |
| 118 | iso_pu_bacteria | 2906660503 | 2906661114 | 177 |
| 119 | iso_pu_bacteria | 2906660503 | 2906662569 | 177 |
| 120 | iso_pu_bacteria | 2906660503 | 2906668763 | 177 |
| 121 | iso_pu_bacteria | 2908756301 | 2908762500 | 177 |
| 122 | iso_pu_bacteria | 2921643360 | 2921652247 | 177 |
| 123 | iso_pu_bacteria | 2922368715 | 2922371553 | 177 |
| 124 | iso_pu_bacteria | 2933577622 | 2933577708 | 177 |
| 125 | iso_pu_bacteria | 2935648319 | 2935653112 | 177 |
| 126 | iso_pu_bacteria | 2935656913 | 2935661695 | 177 |
| 127 | iso_pu_bacteria | 2935675223 | 2935681010 | 177 |
| 128 | iso_pu_bacteria | 2935760218 | 2935769296 | 177 |
| 129 | iso_pu_bacteria | 2935837841 | 2935845925 | 177 |
| 130 | iso_pu_bacteria | 2935883170 | 2935886342 | 177 |
| 131 | iso_pu_bacteria | 2935992306 | 2935993665 | 177 |
| 132 | iso_pu_bacteria | 2936011229 | 2936015948 | 177 |
| 133 | iso_pu_bacteria | 2936019824 | 2936024616 | 177 |
| 134 | iso_pu_bacteria | 2936028420 | 2936033846 | 177 |
| 135 | iso_pu_bacteria | 2936046547 | 2936051691 | 177 |
| 136 | iso_pu_bacteria | 2936055302 | 2936061649 | 177 |
| 137 | iso_pu_bacteria | 2936055302 | 2936062453 | 177 |
| 138 | iso_pu_bacteria | 2941538514 | 2941546040 | 177 |
| 139 | iso_pu_bacteria | 2945934425 | 2945940311 | 177 |
| 140 | iso_pu_bacteria | 2960617483 | 2960618589 | 177 |
| 141 | iso_pu_bacteria | 2967735183 | 2967737053 | 177 |
| 142 | iso_pu_bacteria | 2990703756 | 2990707440 | 177 |
| 143 | iso_pu_bacteria | 3005474847 | 3005481691 | 177 |
| 144 | iso_pu_bacteria | 641736151 | 642423880 | 177 |
| 145 | iso_pu_bacteria | 643348564 | 643597468 | 177 |
| 146 | iso_pu_bacteria | 8005301065 | 8005301727 | 177 |
| 147 | iso_pu_bacteria | 8005301065 | 8005301735 | 177 |
| 148 | iso_pu_bacteria | 8005460587 | 8005465779 | 177 |
| 149 | iso_pu_bacteria | 8005682033 | 8005686724 | 177 |
| 150 | iso_pu_bacteria | 8016522445 | 8016525332 | 177 |
| 151 | iso_pu_bacteria | 8016530956 | 8016538915 | 177 |
| 152 | iso_pu_bacteria | 8016539877 | 8016543200 | 177 |
| 153 | iso_pu_bacteria | 8016548790 | 8016550092 | 177 |
| 154 | iso_pu_bacteria | 8016557553 | 8016558506 | 177 |
| 155 | iso_pu_bacteria | 8016566248 | 8016568610 | 177 |
| 156 | iso_pu_bacteria | 8016575299 | 8016581256 | 177 |
| 157 | iso_pu_bacteria | 8016595262 | 8016596489 | 177 |
| 158 | iso_pu_bacteria | 8019530166 | 8019538583 | 177 |
| 159 | iso_pu_bacteria | 8019619141 | 8019621512 | 177 |
| 160 | iso_pu_bacteria | 8046767195 | 8046769120 | 177 |
| 161 | iso_pu_bacteria | 8055301274 | 8055306889 | 177 |
| 162 | iso_pu_bacteria | 8055742211 | 8055748656 | 177 |
| 163 | 3300013307 | Ga0157372_10389258 | Ga0157372_103892582 | 178 |
| 164 | iso_pu_bacteria | 8055266321 | 8055273061 | 178 |
| 165 | 3300014326 | Ga0157380_10908730 | Ga0157380_109087301 | 180 |
| 166 | 3300026116 | Ga0207674_10070597 | Ga0207674_100705974 | 180 |
| 167 | 3300037312 | Ga0395899_0097093 | Ga0395899_0097093_1107_1649 | 180 |
| 168 | 3300037418 | Ga0395900_0004671 | Ga0395900_0004671_12751_13293 | 180 |
| 169 | 3300037466 | Ga0395898_0091061 | Ga0395898_0091061_2345_2887 | 180 |
| 170 | 3300037471 | Ga0395905_0093780 | Ga0395905_0093780_568_1110 | 180 |
| 171 | 3300049571 | Ga0501034_0929655 | Ga0501034_0929655_53_595 | 180 |
| 172 | 3300049823 | Ga0501044_0021527 | Ga0501044_0021527_1771_2313 | 180 |
| 173 | 3300001979 | JGI24740J21852_10003570 | JGI24740J21852_100035703 | 181 |
| 174 | 3300002067 | JGI24735J21928_10060167 | JGI24735J21928_100601671 | 181 |
| 175 | 3300002075 | JGI24738J21930_10002132 | JGI24738J21930_100021328 | 181 |
| 176 | 3300002705 | JGI25156J39149_1000464 | JGI25156J39149_100046422 | 181 |
| 177 | 3300002987 | JGI25159J45721_1001450 | JGI25159J45721_100145012 | 181 |
| 178 | 3300002987 | JGI25159J45721_1008132 | JGI25159J45721_10081324 | 181 |
| 179 | 3300003187 | JGI25151J46595_10000338 | JGI25151J46595_1000033846 | 181 |
| 180 | 3300003215 | JGI25153J46596_10000730 | JGI25153J46596_100007304 | 181 |
| 181 | 3300003322 | rootL2_10080064 | rootL2_100800641 | 181 |
| 182 | 3300003354 | JGI25160J50197_1000091 | JGI25160J50197_100009121 | 181 |
| 183 | 3300003354 | JGI25160J50197_1000177 | JGI25160J50197_100017766 | 181 |
| 184 | 3300003374 | JGI25161J50226_1000128 | JGI25161J50226_100012867 | 181 |
| 185 | 3300003693 | Ga0032354_1093922 | Ga0032354_10939221 | 181 |
| 186 | 3300003756 | Ga0055533_1005848 | Ga0055533_10058482 | 181 |
| 187 | 3300003760 | Ga0055527_1000047 | Ga0055527_100004772 | 181 |
| 188 | 3300003761 | Ga0055535_1000040 | Ga0055535_1000040117 | 181 |
| 189 | 3300003762 | Ga0055542_1000065 | Ga0055542_10000652 | 181 |
| 190 | 3300003763 | Ga0055529_1000094 | Ga0055529_100009497 | 181 |
| 191 | 3300003771 | Ga0055526_1001794 | Ga0055526_10017944 | 181 |
| 192 | 3300003781 | Ga0055536_1000103 | Ga0055536_100010318 | 181 |
| 193 | 3300003784 | Ga0055534_1000104 | Ga0055534_100010462 | 181 |
| 194 | 3300003784 | Ga0055534_1000158 | Ga0055534_100015829 | 181 |
| 195 | 3300003794 | Ga0055531_10031081 | Ga0055531_100310812 | 181 |
| 196 | 3300003856 | Ga0058692_1019790 | Ga0058692_10197902 | 181 |
| 197 | 3300004625 | Ga0055543_1000174 | Ga0055543_100017470 | 181 |
| 198 | 3300005262 | Ga0065165_1000317 | Ga0065165_10003178 | 181 |
| 199 | 3300005262 | Ga0065165_1000580 | Ga0065165_100058070 | 181 |
| 200 | 3300005262 | Ga0065165_1034621 | Ga0065165_10346211 | 181 |
| 201 | 3300005331 | Ga0070670_100410065 | Ga0070670_1004100652 | 181 |
| 202 | 3300005336 | Ga0070680_100656373 | Ga0070680_1006563732 | 181 |
| 203 | 3300005338 | Ga0068868_100546111 | Ga0068868_1005461112 | 181 |
| 204 | 3300005339 | Ga0070660_100452162 | Ga0070660_1004521622 | 181 |
| 205 | 3300005355 | Ga0070671_100060653 | Ga0070671_1000606533 | 181 |
| 206 | 3300005355 | Ga0070671_100398030 | Ga0070671_1003980302 | 181 |
| 207 | 3300005435 | Ga0070714_100354246 | Ga0070714_1003542461 | 181 |
| 208 | 3300005435 | Ga0070714_100809569 | Ga0070714_1008095692 | 181 |
| 209 | 3300005436 | Ga0070713_100206264 | Ga0070713_1002062642 | 181 |
| 210 | 3300005437 | Ga0070710_10518296 | Ga0070710_105182961 | 181 |
| 211 | 3300005445 | Ga0070708_100734556 | Ga0070708_1007345562 | 181 |
| 212 | 3300005455 | Ga0070663_101003365 | Ga0070663_1010033651 | 181 |
| 213 | 3300005458 | Ga0070681_10051963 | Ga0070681_100519636 | 181 |
| 214 | 3300005458 | Ga0070681_10085874 | Ga0070681_100858745 | 181 |
| 215 | 3300005459 | Ga0068867_100584687 | Ga0068867_1005846872 | 181 |
| 216 | 3300005468 | Ga0070707_100931443 | Ga0070707_1009314431 | 181 |
| 217 | 3300005530 | Ga0070679_100319290 | Ga0070679_1003192902 | 181 |
| 218 | 3300005539 | Ga0068853_100878919 | Ga0068853_1008789192 | 181 |
| 219 | 3300005548 | Ga0070665_100003864 | Ga0070665_10000386413 | 181 |
| 220 | 3300005548 | Ga0070665_100060216 | Ga0070665_1000602162 | 181 |
| 221 | 3300005563 | Ga0068855_100591174 | Ga0068855_1005911741 | 181 |
| 222 | 3300005577 | Ga0068857_100448670 | Ga0068857_1004486702 | 181 |
| 223 | 3300005618 | Ga0068864_100164171 | Ga0068864_1001641713 | 181 |
| 224 | 3300005618 | Ga0068864_100908058 | Ga0068864_1009080582 | 181 |
| 225 | 3300005841 | Ga0068863_100739579 | Ga0068863_1007395792 | 181 |
| 226 | 3300005842 | Ga0068858_101194683 | Ga0068858_1011946831 | 181 |
| 227 | 3300005937 | Ga0081455_10029138 | Ga0081455_100291384 | 181 |
| 228 | 3300005981 | Ga0081538_10089486 | Ga0081538_100894863 | 181 |
| 229 | 3300005983 | Ga0081540_1050917 | Ga0081540_10509172 | 181 |
| 230 | 3300006058 | Ga0075432_10006014 | Ga0075432_100060144 | 181 |
| 231 | 3300006163 | Ga0070715_10325034 | Ga0070715_103250341 | 181 |
| 232 | 3300006177 | Ga0075362_10022226 | Ga0075362_100222263 | 181 |
| 233 | 3300006942 | Ga0099824_1009101 | Ga0099824_10091013 | 181 |
| 234 | 3300006942 | Ga0099824_1015049 | Ga0099824_101504912 | 181 |
| 235 | 3300006942 | Ga0099824_1035917 | Ga0099824_10359172 | 181 |
| 236 | 3300007265 | Ga0099794_10225119 | Ga0099794_102251191 | 181 |
| 237 | 3300007788 | Ga0099795_10018730 | Ga0099795_100187302 | 181 |
| 238 | 3300009093 | Ga0105240_10001105 | Ga0105240_1000110518 | 181 |
| 239 | 3300009093 | Ga0105240_10003464 | Ga0105240_100034649 | 181 |
| 240 | 3300009093 | Ga0105240_10182556 | Ga0105240_101825562 | 181 |
| 241 | 3300009093 | Ga0105240_10275909 | Ga0105240_102759093 | 181 |
| 242 | 3300009093 | Ga0105240_10441003 | Ga0105240_104410032 | 181 |
| 243 | 3300009101 | Ga0105247_10832385 | Ga0105247_108323851 | 181 |
| 244 | 3300009177 | Ga0105248_11289283 | Ga0105248_112892831 | 181 |
| 245 | 3300009177 | Ga0105248_11696120 | Ga0105248_116961201 | 181 |
| 246 | 3300009545 | Ga0105237_10579633 | Ga0105237_105796332 | 181 |
| 247 | 3300009545 | Ga0105237_11103672 | Ga0105237_111036721 | 181 |
| 248 | 3300009551 | Ga0105238_10134349 | Ga0105238_101343492 | 181 |
| 249 | 3300009986 | Ga0105033_100546 | Ga0105033_1005463 | 181 |
| 250 | 3300010159 | Ga0099796_10118574 | Ga0099796_101185741 | 181 |
| 251 | 3300010375 | Ga0105239_10037089 | Ga0105239_100370894 | 181 |
| 252 | 3300010375 | Ga0105239_10135042 | Ga0105239_101350423 | 181 |
| 253 | 3300012512 | Ga0157327_1014753 | Ga0157327_10147531 | 181 |
| 254 | 3300013100 | Ga0157373_10017829 | Ga0157373_100178293 | 181 |
| 255 | 3300013102 | Ga0157371_10000678 | Ga0157371_1000067826 | 181 |
| 256 | 3300013104 | Ga0157370_10330765 | Ga0157370_103307652 | 181 |
| 257 | 3300013105 | Ga0157369_10311577 | Ga0157369_103115771 | 181 |
| 258 | 3300013296 | Ga0157374_10613399 | Ga0157374_106133992 | 181 |
| 259 | 3300013307 | Ga0157372_10000243 | Ga0157372_1000024325 | 181 |
| 260 | 3300013307 | Ga0157372_10561943 | Ga0157372_105619432 | 181 |
| 261 | 3300014325 | Ga0163163_10276255 | Ga0163163_102762552 | 181 |
| 262 | 3300014325 | Ga0163163_11079395 | Ga0163163_110793952 | 181 |
| 263 | 3300014497 | Ga0182008_10140859 | Ga0182008_101408592 | 181 |
| 264 | 3300015687 | Ga0183368_1004 | Ga0183368_1004473 | 181 |
| 265 | 3300020610 | Ga0154015_1502891 | Ga0154015_15028912 | 181 |
| 266 | 3300021361 | Ga0213872_10000017 | Ga0213872_1000001723 | 181 |
| 267 | 3300021361 | Ga0213872_10000429 | Ga0213872_100004294 | 181 |
| 268 | 3300021361 | Ga0213872_10001396 | Ga0213872_100013969 | 181 |
| 269 | 3300021361 | Ga0213872_10006714 | Ga0213872_100067145 | 181 |
| 270 | 3300021361 | Ga0213872_10011068 | Ga0213872_100110684 | 181 |
| 271 | 3300021384 | Ga0213876_10004063 | Ga0213876_100040633 | 181 |
| 272 | 3300025206 | Ga0209435_101001 | Ga0209435_1010015 | 181 |
| 273 | 3300025208 | Ga0209436_112204 | Ga0209436_1122042 | 181 |
| 274 | 3300025226 | Ga0209674_105225 | Ga0209674_1052252 | 181 |
| 275 | 3300025228 | Ga0209672_100017 | Ga0209672_1000172 | 181 |
| 276 | 3300025242 | Ga0209258_100038 | Ga0209258_100038310 | 181 |
| 277 | 3300025253 | Ga0209677_108617 | Ga0209677_1086172 | 181 |
| 278 | 3300025254 | Ga0209148_1000009 | Ga0209148_10000091210 | 181 |
| 279 | 3300025256 | Ga0209759_1000524 | Ga0209759_100052433 | 181 |
| 280 | 3300025272 | Ga0209455_1000032 | Ga0209455_10000322 | 181 |
| 281 | 3300025284 | Ga0209130_1000334 | Ga0209130_10003342 | 181 |
| 282 | 3300025284 | Ga0209130_1001098 | Ga0209130_100109820 | 181 |
| 283 | 3300025284 | Ga0209130_1001354 | Ga0209130_10013543 | 181 |
| 284 | 3300025284 | Ga0209130_1024457 | Ga0209130_10244571 | 181 |
| 285 | 3300025291 | Ga0209675_1000078 | Ga0209675_100007848 | 181 |
| 286 | 3300025292 | Ga0209676_1000121 | Ga0209676_1000121139 | 181 |
| 287 | 3300025292 | Ga0209676_1010407 | Ga0209676_10104074 | 181 |
| 288 | 3300025294 | Ga0209025_1000051 | Ga0209025_100005149 | 181 |
| 289 | 3300025295 | Ga0209564_1000133 | Ga0209564_1000133131 | 181 |
| 290 | 3300025295 | Ga0209564_1005057 | Ga0209564_10050572 | 181 |
| 291 | 3300025297 | Ga0209758_1002218 | Ga0209758_10022185 | 181 |
| 292 | 3300025298 | Ga0209050_1004036 | Ga0209050_10040366 | 181 |
| 293 | 3300025302 | Ga0207426_1000004 | Ga0207426_100000487 | 181 |
| 294 | 3300025302 | Ga0207426_1000272 | Ga0207426_10002723 | 181 |
| 295 | 3300025302 | Ga0207426_1000272 | Ga0207426_100027257 | 181 |
| 296 | 3300025302 | Ga0207426_1001300 | Ga0207426_100130020 | 181 |
| 297 | 3300025303 | Ga0209051_1000850 | Ga0209051_100085019 | 181 |
| 298 | 3300025304 | Ga0209257_1002935 | Ga0209257_100293512 | 181 |
| 299 | 3300025904 | Ga0207647_10011058 | Ga0207647_100110586 | 181 |
| 300 | 3300025905 | Ga0207685_10126951 | Ga0207685_101269512 | 181 |
| 301 | 3300025906 | Ga0207699_10502201 | Ga0207699_105022011 | 181 |
| 302 | 3300025911 | Ga0207654_10291708 | Ga0207654_102917082 | 181 |
| 303 | 3300025912 | Ga0207707_10064964 | Ga0207707_100649642 | 181 |
| 304 | 3300025912 | Ga0207707_10154920 | Ga0207707_101549202 | 181 |
| 305 | 3300025912 | Ga0207707_10568240 | Ga0207707_105682402 | 181 |
| 306 | 3300025913 | Ga0207695_10001233 | Ga0207695_1000123326 | 181 |
| 307 | 3300025913 | Ga0207695_10002566 | Ga0207695_100025666 | 181 |
| 308 | 3300025913 | Ga0207695_10056312 | Ga0207695_100563125 | 181 |
| 309 | 3300025913 | Ga0207695_10075225 | Ga0207695_100752253 | 181 |
| 310 | 3300025913 | Ga0207695_10210106 | Ga0207695_102101063 | 181 |
| 311 | 3300025916 | Ga0207663_10763611 | Ga0207663_107636112 | 181 |
| 312 | 3300025919 | Ga0207657_10113517 | Ga0207657_101135173 | 181 |
| 313 | 3300025922 | Ga0207646_10254256 | Ga0207646_102542562 | 181 |
| 314 | 3300025924 | Ga0207694_10356511 | Ga0207694_103565112 | 181 |
| 315 | 3300025928 | Ga0207700_10638201 | Ga0207700_106382012 | 181 |
| 316 | 3300025929 | Ga0207664_10215544 | Ga0207664_102155442 | 181 |
| 317 | 3300025931 | Ga0207644_10060662 | Ga0207644_100606623 | 181 |
| 318 | 3300025931 | Ga0207644_10239071 | Ga0207644_102390712 | 181 |
| 319 | 3300025931 | Ga0207644_10317495 | Ga0207644_103174952 | 181 |
| 320 | 3300025931 | Ga0207644_10561374 | Ga0207644_105613742 | 181 |
| 321 | 3300025939 | Ga0207665_10066241 | Ga0207665_100662412 | 181 |
| 322 | 3300025949 | Ga0207667_11058324 | Ga0207667_110583241 | 181 |
| 323 | 3300025986 | Ga0207658_11229330 | Ga0207658_112293301 | 181 |
| 324 | 3300026041 | Ga0207639_10372207 | Ga0207639_103722072 | 181 |
| 325 | 3300026067 | Ga0207678_10039852 | Ga0207678_100398526 | 181 |
| 326 | 3300026067 | Ga0207678_10229937 | Ga0207678_102299372 | 181 |
| 327 | 3300026078 | Ga0207702_11483126 | Ga0207702_114831261 | 181 |
| 328 | 3300026088 | Ga0207641_10477228 | Ga0207641_104772282 | 181 |
| 329 | 3300026089 | Ga0207648_10199348 | Ga0207648_101993481 | 181 |
| 330 | 3300026095 | Ga0207676_10224021 | Ga0207676_102240213 | 181 |
| 331 | 3300026095 | Ga0207676_10876010 | Ga0207676_108760101 | 181 |
| 332 | 3300026116 | Ga0207674_10151106 | Ga0207674_101511062 | 181 |
| 333 | 3300026118 | Ga0207675_100665591 | Ga0207675_1006655911 | 181 |
| 334 | 3300026142 | Ga0207698_10341387 | Ga0207698_103413872 | 181 |
| 335 | 3300027296 | Ga0209389_1000151 | Ga0209389_100015122 | 181 |
| 336 | 3300027296 | Ga0209389_1000151 | Ga0209389_100015134 | 181 |
| 337 | 3300027312 | Ga0209371_1000282 | Ga0209371_100028223 | 181 |
| 338 | 3300027357 | Ga0209589_1000002 | Ga0209589_1000002535 | 181 |
| 339 | 3300027357 | Ga0209589_1000002 | Ga0209589_1000002542 | 181 |
| 340 | 3300027357 | Ga0209589_1000399 | Ga0209589_100039922 | 181 |
| 341 | 3300027357 | Ga0209589_1000399 | Ga0209589_100039934 | 181 |
| 342 | 3300027361 | Ga0209489_100002 | Ga0209489_100002535 | 181 |
| 343 | 3300027361 | Ga0209489_100002 | Ga0209489_100002542 | 181 |
| 344 | 3300027361 | Ga0209489_100724 | Ga0209489_10072428 | 181 |
| 345 | 3300027361 | Ga0209489_100724 | Ga0209489_10072440 | 181 |
| 346 | 3300027363 | Ga0209700_100002 | Ga0209700_100002535 | 181 |
| 347 | 3300027363 | Ga0209700_100002 | Ga0209700_100002542 | 181 |
| 348 | 3300027907 | Ga0207428_10001142 | Ga0207428_1000114217 | 181 |
| 349 | 3300027907 | Ga0207428_10064907 | Ga0207428_100649072 | 181 |
| 350 | 3300028379 | Ga0268266_10001892 | Ga0268266_100018928 | 181 |
| 351 | 3300028379 | Ga0268266_10009564 | Ga0268266_100095645 | 181 |
| 352 | 3300028379 | Ga0268266_10030022 | Ga0268266_100300226 | 181 |
| 353 | 3300028379 | Ga0268266_10055593 | Ga0268266_100555934 | 181 |
| 354 | 3300030500 | Ga0268256_1000777 | Ga0268256_100077723 | 181 |
| 355 | 3300031548 | Ga0307408_100407491 | Ga0307408_1004074911 | 181 |
| 356 | 3300031911 | Ga0307412_10000039 | Ga0307412_1000003979 | 181 |
| 357 | 3300031995 | Ga0307409_101553206 | Ga0307409_1015532061 | 181 |
| 358 | 3300037312 | Ga0395899_0009133 | Ga0395899_0009133_6254_6802 | 181 |
| 359 | 3300037312 | Ga0395899_0033579 | Ga0395899_0033579_449_997 | 181 |
| 360 | 3300037312 | Ga0395899_0039417 | Ga0395899_0039417_2631_3176 | 181 |
| 361 | 3300037418 | Ga0395900_0002731 | Ga0395900_0002731_5535_6083 | 181 |
| 362 | 3300037418 | Ga0395900_0060795 | Ga0395900_0060795_3014_3559 | 181 |
| 363 | 3300037418 | Ga0395900_0173190 | Ga0395900_0173190_511_1056 | 181 |
| 364 | 3300037418 | Ga0395900_0735380 | Ga0395900_0735380_87_632 | 181 |
| 365 | 3300037418 | Ga0395900_1015858 | Ga0395900_1015858_153_701 | 181 |
| 366 | 3300037466 | Ga0395898_0003975 | Ga0395898_0003975_9933_10481 | 181 |
| 367 | 3300037466 | Ga0395898_0014406 | Ga0395898_0014406_5491_6036 | 181 |
| 368 | 3300037466 | Ga0395898_0016976 | Ga0395898_0016976_957_1529 | 181 |
| 369 | 3300037466 | Ga0395898_0058179 | Ga0395898_0058179_1204_1761 | 181 |
| 370 | 3300037466 | Ga0395898_0294955 | Ga0395898_0294955_581_1126 | 181 |
| 371 | 3300037471 | Ga0395905_0001244 | Ga0395905_0001244_28735_29283 | 181 |
| 372 | 3300037471 | Ga0395905_0002694 | Ga0395905_0002694_5465_6010 | 181 |
| 373 | 3300037471 | Ga0395905_0029193 | Ga0395905_0029193_362_907 | 181 |
| 374 | 3300037471 | Ga0395905_0068163 | Ga0395905_0068163_1755_2300 | 181 |
| 375 | 3300037471 | Ga0395905_0087345 | Ga0395905_0087345_1668_2213 | 181 |
| 376 | 3300037471 | Ga0395905_0294689 | Ga0395905_0294689_220_765 | 181 |
| 377 | 3300037471 | Ga0395905_0467129 | Ga0395905_0467129_411_956 | 181 |
| 378 | 3300038443 | Ga0395901_0010766 | Ga0395901_0010766_7626_8183 | 181 |
| 379 | 3300038443 | Ga0395901_0173739 | Ga0395901_0173739_1350_1922 | 181 |
| 380 | 3300038443 | Ga0395901_0195539 | Ga0395901_0195539_786_1334 | 181 |
| 381 | 3300038443 | Ga0395901_0399548 | Ga0395901_0399548_388_933 | 181 |
| 382 | 3300038443 | Ga0395901_0674449 | Ga0395901_0674449_320_865 | 181 |
| 383 | 3300038443 | Ga0395901_0735864 | Ga0395901_0735864_129_674 | 181 |
| 384 | 3300038443 | Ga0395901_0805400 | Ga0395901_0805400_271_816 | 181 |
| 385 | 3300039437 | Ga0436365_0241183 | Ga0436365_0241183_784_1368 | 181 |
| 386 | 3300039438 | Ga0436360_0258205 | Ga0436360_0258205_1852_2397 | 181 |
| 387 | 3300039438 | Ga0436360_0631847 | Ga0436360_0631847_303_848 | 181 |
| 388 | 3300039438 | Ga0436360_0798062 | Ga0436360_0798062_126_671 | 181 |
| 389 | 3300039447 | Ga0436361_0267501 | Ga0436361_0267501_16724_17269 | 181 |
| 390 | 3300039447 | Ga0436361_0408050 | Ga0436361_0408050_2951_3499 | 181 |
| 391 | 3300039447 | Ga0436361_0409682 | Ga0436361_0409682_9393_9938 | 181 |
| 392 | 3300039447 | Ga0436361_0868243 | Ga0436361_0868243_288_833 | 181 |
| 393 | 3300039447 | Ga0436361_0960211 | Ga0436361_0960211_2666_3211 | 181 |
| 394 | 3300039447 | Ga0436361_1114381 | Ga0436361_1114381_2757_3302 | 181 |
| 395 | 3300039447 | Ga0436361_1141074 | Ga0436361_1141074_1518_2063 | 181 |
| 396 | 3300041460 | Ga0451802_0277294 | Ga0451802_0277294_259_804 | 181 |
| 397 | 3300041491 | Ga0451833_0196066 | Ga0451833_0196066_138_683 | 181 |
| 398 | 3300041492 | Ga0451835_1065705 | Ga0451835_1065705_857_1402 | 181 |
| 399 | 3300041494 | Ga0451837_0366658 | Ga0451837_0366658_873_1418 | 181 |
| 400 | 3300041496 | Ga0451839_0280360 | Ga0451839_0280360_273_818 | 181 |
| 401 | 3300041498 | Ga0451841_0177268 | Ga0451841_0177268_92_637 | 181 |
| 402 | 3300041501 | Ga0451845_0283541 | Ga0451845_0283541_6411_6956 | 181 |
| 403 | 3300041503 | Ga0451847_0223415 | Ga0451847_0223415_1404_1949 | 181 |
| 404 | 3300041505 | Ga0451849_0327025 | Ga0451849_0327025_2600_3145 | 181 |
| 405 | 3300041507 | Ga0451851_0481357 | Ga0451851_0481357_390_935 | 181 |
| 406 | 3300041509 | Ga0451843_0291851 | Ga0451843_0291851_1472_2017 | 181 |
| 407 | 3300041511 | Ga0451855_1502518 | Ga0451855_1502518_3571_4116 | 181 |
| 408 | 3300041512 | Ga0451853_1825010 | Ga0451853_1825010_219_764 | 181 |
| 409 | 3300041997 | Ga0439431_0030665 | Ga0439431_0030665_770_1315 | 181 |
| 410 | 3300042157 | Ga0439458_0085028 | Ga0439458_0085028_29_574 | 181 |
| 411 | 3300042438 | Ga0439459_0050802 | Ga0439459_0050802_85_630 | 181 |
| 412 | 3300042461 | Ga0439460_0024779 | Ga0439460_0024779_46_591 | 181 |
| 413 | 3300044672 | Ga0466982_0000055 | Ga0466982_0000055_15699_16244 | 181 |
| 414 | 3300044683 | Ga0466965_0228400 | Ga0466965_0228400_144_689 | 181 |
| 415 | 3300044684 | Ga0466966_0024812 | Ga0466966_0024812_3020_3571 | 181 |
| 416 | 3300044693 | Ga0466961_0003402 | Ga0466961_0003402_470_1015 | 181 |
| 417 | 3300044693 | Ga0466961_0010597 | Ga0466961_0010597_569_1114 | 181 |
| 418 | 3300044719 | Ga0466971_0086068 | Ga0466971_0086068_227_772 | 181 |
| 419 | 3300044765 | Ga0466970_0142359 | Ga0466970_0142359_195_746 | 181 |
| 420 | 3300044842 | Ga0466957_0032520 | Ga0466957_0032520_159_704 | 181 |
| 421 | 3300044842 | Ga0466957_0257711 | Ga0466957_0257711_16_561 | 181 |
| 422 | 3300045049 | Ga0466959_0054003 | Ga0466959_0054003_1202_1747 | 181 |
| 423 | 3300046452 | Ga0495617_002517 | Ga0495617_002517_5889_6434 | 181 |
| 424 | 3300046455 | Ga0495603_0003485 | Ga0495603_0003485_2209_2754 | 181 |
| 425 | 3300046459 | Ga0495629_0000115 | Ga0495629_0000115_25175_25720 | 181 |
| 426 | 3300046459 | Ga0495629_0037386 | Ga0495629_0037386_2863_3408 | 181 |
| 427 | 3300046459 | Ga0495629_0131538 | Ga0495629_0131538_401_946 | 181 |
| 428 | 3300046460 | Ga0495638_0028430 | Ga0495638_0028430_2816_3361 | 181 |
| 429 | 3300046463 | Ga0495653_0167803 | Ga0495653_0167803_91_636 | 181 |
| 430 | 3300046471 | Ga0495650_0100680 | Ga0495650_0100680_273_818 | 181 |
| 431 | 3300046472 | Ga0495580_0005083 | Ga0495580_0005083_3412_3957 | 181 |
| 432 | 3300046472 | Ga0495580_0007991 | Ga0495580_0007991_4063_4608 | 181 |
| 433 | 3300046472 | Ga0495580_0017866 | Ga0495580_0017866_3948_4493 | 181 |
| 434 | 3300046472 | Ga0495580_0300156 | Ga0495580_0300156_489_1034 | 181 |
| 435 | 3300046473 | Ga0495582_0041300 | Ga0495582_0041300_373_918 | 181 |
| 436 | 3300046473 | Ga0495582_0043056 | Ga0495582_0043056_213_758 | 181 |
| 437 | 3300046473 | Ga0495582_0335159 | Ga0495582_0335159_282_827 | 181 |
| 438 | 3300046474 | Ga0495605_0012210 | Ga0495605_0012210_2448_2993 | 181 |
| 439 | 3300046474 | Ga0495605_0021218 | Ga0495605_0021218_273_818 | 181 |
| 440 | 3300046477 | Ga0495664_0003646 | Ga0495664_0003646_3562_4107 | 181 |
| 441 | 3300046477 | Ga0495664_0031579 | Ga0495664_0031579_2186_2731 | 181 |
| 442 | 3300046491 | Ga0495584_0000044 | Ga0495584_0000044_80314_80862 | 181 |
| 443 | 3300046491 | Ga0495584_0374165 | Ga0495584_0374165_14_559 | 181 |
| 444 | 3300046492 | Ga0495585_0195685 | Ga0495585_0195685_212_757 | 181 |
| 445 | 3300046492 | Ga0495585_0341107 | Ga0495585_0341107_51_626 | 181 |
| 446 | 3300046500 | Ga0495596_0031390 | Ga0495596_0031390_236_781 | 181 |
| 447 | 3300046506 | Ga0495583_0000078 | Ga0495583_0000078_167742_168287 | 181 |
| 448 | 3300046506 | Ga0495583_0004535 | Ga0495583_0004535_8551_9096 | 181 |
| 449 | 3300046506 | Ga0495583_0009898 | Ga0495583_0009898_4982_5527 | 181 |
| 450 | 3300046507 | Ga0495606_0012747 | Ga0495606_0012747_5773_6321 | 181 |
| 451 | 3300046507 | Ga0495606_0029483 | Ga0495606_0029483_949_1503 | 181 |
| 452 | 3300046507 | Ga0495606_0031841 | Ga0495606_0031841_3005_3580 | 181 |
| 453 | 3300046507 | Ga0495606_0101834 | Ga0495606_0101834_171_719 | 181 |
| 454 | 3300046512 | Ga0495610_0000817 | Ga0495610_0000817_3699_4244 | 181 |
| 455 | 3300046512 | Ga0495610_0005757 | Ga0495610_0005757_3977_4522 | 181 |
| 456 | 3300046513 | Ga0495616_0025438 | Ga0495616_0025438_731_1276 | 181 |
| 457 | 3300046514 | Ga0495618_0029626 | Ga0495618_0029626_1756_2301 | 181 |
| 458 | 3300046515 | Ga0495620_0243148 | Ga0495620_0243148_102_647 | 181 |
| 459 | 3300046516 | Ga0495628_0122219 | Ga0495628_0122219_255_800 | 181 |
| 460 | 3300046516 | Ga0495628_0126087 | Ga0495628_0126087_544_1089 | 181 |
| 461 | 3300046517 | Ga0495630_0037973 | Ga0495630_0037973_2089_2634 | 181 |
| 462 | 3300046517 | Ga0495630_0120724 | Ga0495630_0120724_1262_1807 | 181 |
| 463 | 3300046522 | Ga0495643_0128984 | Ga0495643_0128984_179_733 | 181 |
| 464 | 3300046524 | Ga0495648_0007550 | Ga0495648_0007550_6433_6981 | 181 |
| 465 | 3300046524 | Ga0495648_0038936 | Ga0495648_0038936_971_1516 | 181 |
| 466 | 3300046524 | Ga0495648_0103768 | Ga0495648_0103768_924_1469 | 181 |
| 467 | 3300046526 | Ga0495666_0072511 | Ga0495666_0072511_21_566 | 181 |
| 468 | 3300046526 | Ga0495666_0095592 | Ga0495666_0095592_257_802 | 181 |
| 469 | 3300046526 | Ga0495666_0141488 | Ga0495666_0141488_519_1064 | 181 |
| 470 | 3300046531 | Ga0495665_0094787 | Ga0495665_0094787_648_1193 | 181 |
| 471 | 3300046537 | Ga0495598_0122468 | Ga0495598_0122468_175_723 | 181 |
| 472 | 3300046538 | Ga0495609_0007383 | Ga0495609_0007383_3607_4164 | 181 |
| 473 | 3300046542 | Ga0495597_0046937 | Ga0495597_0046937_1002_1556 | 181 |
| 474 | 3300046543 | Ga0495645_0060195 | Ga0495645_0060195_1824_2369 | 181 |
| 475 | 3300046543 | Ga0495645_0106697 | Ga0495645_0106697_867_1412 | 181 |
| 476 | 3300046557 | Ga0495622_0032041 | Ga0495622_0032041_769_1314 | 181 |
| 477 | 3300046557 | Ga0495622_0060832 | Ga0495622_0060832_1152_1697 | 181 |
| 478 | 3300046557 | Ga0495622_0133632 | Ga0495622_0133632_268_816 | 181 |
| 479 | 3300046558 | Ga0495633_0044642 | Ga0495633_0044642_1166_1714 | 181 |
| 480 | 3300046615 | Ga0495656_0249118 | Ga0495656_0249118_235_780 | 181 |
| 481 | 3300046616 | Ga0495668_0010203 | Ga0495668_0010203_2440_2988 | 181 |
| 482 | 3300046648 | Ga0495611_0136681 | Ga0495611_0136681_479_1024 | 181 |
| 483 | 3300046660 | Ga0495625_0042718 | Ga0495625_0042718_877_1425 | 181 |
| 484 | 3300046660 | Ga0495625_0070500 | Ga0495625_0070500_686_1231 | 181 |
| 485 | 3300046660 | Ga0495625_0096783 | Ga0495625_0096783_596_1144 | 181 |
| 486 | 3300046660 | Ga0495625_0172748 | Ga0495625_0172748_333_878 | 181 |
| 487 | 3300046663 | Ga0495635_0147920 | Ga0495635_0147920_761_1306 | 181 |
| 488 | 3300046664 | Ga0495659_0008738 | Ga0495659_0008738_2105_2653 | 181 |
| 489 | 3300046665 | Ga0495661_0002353 | Ga0495661_0002353_210_758 | 181 |
| 490 | 3300046665 | Ga0495661_0243404 | Ga0495661_0243404_38_583 | 181 |
| 491 | 3300046674 | Ga0495588_0162257 | Ga0495588_0162257_424_969 | 181 |
| 492 | 3300046679 | Ga0495623_0045465 | Ga0495623_0045465_1888_2433 | 181 |
| 493 | 3300046679 | Ga0495623_0060007 | Ga0495623_0060007_1309_1854 | 181 |
| 494 | 3300046679 | Ga0495623_0211647 | Ga0495623_0211647_271_816 | 181 |
| 495 | 3300046689 | Ga0495613_0717453 | Ga0495613_0717453_62_607 | 181 |
| 496 | 3300046690 | Ga0495624_0011981 | Ga0495624_0011981_1263_1808 | 181 |
| 497 | 3300046690 | Ga0495624_0092045 | Ga0495624_0092045_824_1369 | 181 |
| 498 | 3300046690 | Ga0495624_0186190 | Ga0495624_0186190_530_1075 | 181 |
| 499 | 3300046692 | Ga0495671_0005615 | Ga0495671_0005615_6530_7105 | 181 |
| 500 | 3300046692 | Ga0495671_0076163 | Ga0495671_0076163_605_1150 | 181 |
| 501 | 3300046692 | Ga0495671_0390541 | Ga0495671_0390541_33_578 | 181 |
| 502 | 3300046694 | Ga0495649_0010113 | Ga0495649_0010113_4068_4613 | 181 |
| 503 | 3300046794 | Ga0495589_0121557 | Ga0495589_0121557_320_865 | 181 |
| 504 | 3300046810 | Ga0495660_0124384 | Ga0495660_0124384_64_609 | 181 |
| 505 | 3300047317 | Ga0495604_0141989 | Ga0495604_0141989_216_761 | 181 |
| 506 | 3300047317 | Ga0495604_0165120 | Ga0495604_0165120_400_945 | 181 |
| 507 | 3300047318 | Ga0495636_0331509 | Ga0495636_0331509_121_669 | 181 |
| 508 | 3300047319 | Ga0495674_0004450 | Ga0495674_0004450_1877_2422 | 181 |
| 509 | 3300047319 | Ga0495674_0007013 | Ga0495674_0007013_6767_7312 | 181 |
| 510 | 3300047319 | Ga0495674_0012300 | Ga0495674_0012300_2268_2816 | 181 |
| 511 | 3300047319 | Ga0495674_0016409 | Ga0495674_0016409_4391_4936 | 181 |
| 512 | 3300047319 | Ga0495674_0027469 | Ga0495674_0027469_713_1258 | 181 |
| 513 | 3300047319 | Ga0495674_0037502 | Ga0495674_0037502_485_1030 | 181 |
| 514 | 3300047319 | Ga0495674_0063791 | Ga0495674_0063791_1727_2272 | 181 |
| 515 | 3300047319 | Ga0495674_0081827 | Ga0495674_0081827_1991_2536 | 181 |
| 516 | 3300047319 | Ga0495674_0379936 | Ga0495674_0379936_385_930 | 181 |
| 517 | 3300047320 | Ga0495672_0079207 | Ga0495672_0079207_39_584 | 181 |
| 518 | 3300047320 | Ga0495672_0089869 | Ga0495672_0089869_750_1295 | 181 |
| 519 | 3300047321 | Ga0495676_0025546 | Ga0495676_0025546_952_1497 | 181 |
| 520 | 3300047321 | Ga0495676_0026568 | Ga0495676_0026568_1044_1589 | 181 |
| 521 | 3300047321 | Ga0495676_0038841 | Ga0495676_0038841_3172_3717 | 181 |
| 522 | 3300047321 | Ga0495676_0088730 | Ga0495676_0088730_1165_1713 | 181 |
| 523 | 3300047321 | Ga0495676_0104440 | Ga0495676_0104440_843_1388 | 181 |
| 524 | 3300047321 | Ga0495676_0124251 | Ga0495676_0124251_761_1306 | 181 |
| 525 | 3300047322 | Ga0495680_0131891 | Ga0495680_0131891_1251_1796 | 181 |
| 526 | 3300047323 | Ga0495683_0001084 | Ga0495683_0001084_1404_1958 | 181 |
| 527 | 3300047323 | Ga0495683_0005347 | Ga0495683_0005347_1090_1635 | 181 |
| 528 | 3300047323 | Ga0495683_0023141 | Ga0495683_0023141_1708_2253 | 181 |
| 529 | 3300047443 | Ga0495687_005866 | Ga0495687_005866_1659_2204 | 181 |
| 530 | 3300047443 | Ga0495687_012669 | Ga0495687_012669_2039_2584 | 181 |
| 531 | 3300047446 | Ga0495679_000641 | Ga0495679_000641_3989_4534 | 181 |
| 532 | 3300047446 | Ga0495679_000641 | Ga0495679_000641_9367_9912 | 181 |
| 533 | 3300047469 | Ga0495673_0009886 | Ga0495673_0009886_3287_3832 | 181 |
| 534 | 3300047469 | Ga0495673_0019803 | Ga0495673_0019803_1878_2423 | 181 |
| 535 | 3300047471 | Ga0495684_0646667 | Ga0495684_0646667_54_653 | 181 |
| 536 | 3300047472 | Ga0495686_0214228 | Ga0495686_0214228_72_617 | 181 |
| 537 | 3300047673 | Ga0495593_0038558 | Ga0495593_0038558_1920_2465 | 181 |
| 538 | 3300047673 | Ga0495593_0183539 | Ga0495593_0183539_52_597 | 181 |
| 539 | 3300047673 | Ga0495593_0449942 | Ga0495593_0449942_53_598 | 181 |
| 540 | 3300048088 | Ga0495602_0008361 | Ga0495602_0008361_6580_7125 | 181 |
| 541 | 3300048088 | Ga0495602_0065291 | Ga0495602_0065291_1028_1573 | 181 |
| 542 | 3300048088 | Ga0495602_0190994 | Ga0495602_0190994_74_619 | 181 |
| 543 | 3300048089 | Ga0495614_0048179 | Ga0495614_0048179_62_607 | 181 |
| 544 | 3300048089 | Ga0495614_0052367 | Ga0495614_0052367_749_1294 | 181 |
| 545 | 3300048091 | Ga0495626_0003399 | Ga0495626_0003399_7197_7742 | 181 |
| 546 | 3300048091 | Ga0495626_0029777 | Ga0495626_0029777_233_778 | 181 |
| 547 | 3300048091 | Ga0495626_0051845 | Ga0495626_0051845_1250_1795 | 181 |
| 548 | 3300048091 | Ga0495626_0313084 | Ga0495626_0313084_38_592 | 181 |
| 549 | 3300048903 | Ga0496100_0000408 | Ga0496100_0000408_16095_16643 | 181 |
| 550 | 3300048904 | Ga0496101_0000741 | Ga0496101_0000741_14542_15090 | 181 |
| 551 | 3300048904 | Ga0496101_0025872 | Ga0496101_0025872_1018_1563 | 181 |
| 552 | 3300048905 | Ga0496102_0000675 | Ga0496102_0000675_19078_19626 | 181 |
| 553 | 3300048905 | Ga0496102_0134510 | Ga0496102_0134510_138_686 | 181 |
| 554 | 3300048905 | Ga0496102_0451998 | Ga0496102_0451998_161_706 | 181 |
| 555 | 3300048906 | Ga0496103_0001501 | Ga0496103_0001501_14449_14997 | 181 |
| 556 | 3300048906 | Ga0496103_0216957 | Ga0496103_0216957_303_848 | 181 |
| 557 | 3300048907 | Ga0496104_0006567 | Ga0496104_0006567_3806_4354 | 181 |
| 558 | 3300048907 | Ga0496104_0201526 | Ga0496104_0201526_779_1324 | 181 |
| 559 | 3300048907 | Ga0496104_1018406 | Ga0496104_1018406_51_596 | 181 |
| 560 | 3300048907 | Ga0496104_1314280 | Ga0496104_1314280_70_615 | 181 |
| 561 | 3300048908 | Ga0496105_0021121 | Ga0496105_0021121_3347_3892 | 181 |
| 562 | 3300048908 | Ga0496105_0032526 | Ga0496105_0032526_696_1244 | 181 |
| 563 | 3300048908 | Ga0496105_0187145 | Ga0496105_0187145_307_852 | 181 |
| 564 | 3300048909 | Ga0496106_0000079 | Ga0496106_0000079_18519_19067 | 181 |
| 565 | 3300048909 | Ga0496106_0031611 | Ga0496106_0031611_3242_3790 | 181 |
| 566 | 3300048910 | Ga0496107_0077442 | Ga0496107_0077442_1739_2287 | 181 |
| 567 | 3300048911 | Ga0496108_0536459 | Ga0496108_0536459_417_962 | 181 |
| 568 | 3300048911 | Ga0496108_0728525 | Ga0496108_0728525_35_592 | 181 |
| 569 | 3300048912 | Ga0496109_0157851 | Ga0496109_0157851_130_675 | 181 |
| 570 | 3300048912 | Ga0496109_0273698 | Ga0496109_0273698_251_796 | 181 |
| 571 | 3300048912 | Ga0496109_1358039 | Ga0496109_1358039_30_587 | 181 |
| 572 | 3300048915 | Ga0496112_0107647 | Ga0496112_0107647_2117_2662 | 181 |
| 573 | 3300048915 | Ga0496112_0118854 | Ga0496112_0118854_1584_2129 | 181 |
| 574 | 3300048915 | Ga0496112_0138942 | Ga0496112_0138942_431_976 | 181 |
| 575 | 3300048915 | Ga0496112_0771072 | Ga0496112_0771072_60_608 | 181 |
| 576 | 3300048915 | Ga0496112_0966378 | Ga0496112_0966378_87_632 | 181 |
| 577 | 3300048916 | Ga0496113_0044934 | Ga0496113_0044934_2159_2704 | 181 |
| 578 | 3300048916 | Ga0496113_0150045 | Ga0496113_0150045_671_1216 | 181 |
| 579 | 3300048917 | Ga0496114_0529773 | Ga0496114_0529773_458_1006 | 181 |
| 580 | 3300048918 | Ga0496115_0261851 | Ga0496115_0261851_99_644 | 181 |
| 581 | 3300048919 | Ga0496116_0031713 | Ga0496116_0031713_154_702 | 181 |
| 582 | 3300048920 | Ga0496117_0001301 | Ga0496117_0001301_21638_22186 | 181 |
| 583 | 3300048920 | Ga0496117_0045486 | Ga0496117_0045486_908_1453 | 181 |
| 584 | 3300048920 | Ga0496117_0133549 | Ga0496117_0133549_907_1452 | 181 |
| 585 | 3300048920 | Ga0496117_0237154 | Ga0496117_0237154_56_601 | 181 |
| 586 | 3300048921 | Ga0496118_0001539 | Ga0496118_0001539_19063_19611 | 181 |
| 587 | 3300048921 | Ga0496118_0037057 | Ga0496118_0037057_1681_2226 | 181 |
| 588 | 3300048921 | Ga0496118_0041020 | Ga0496118_0041020_1437_1982 | 181 |
| 589 | 3300048921 | Ga0496118_0393329 | Ga0496118_0393329_99_647 | 181 |
| 590 | 3300048922 | Ga0496119_0061947 | Ga0496119_0061947_1384_1941 | 181 |
| 591 | 3300048923 | Ga0496120_0121050 | Ga0496120_0121050_693_1250 | 181 |
| 592 | 3300048923 | Ga0496120_0183212 | Ga0496120_0183212_410_958 | 181 |
| 593 | 3300048924 | Ga0496121_0000993 | Ga0496121_0000993_48902_49450 | 181 |
| 594 | 3300048924 | Ga0496121_0019038 | Ga0496121_0019038_4183_4728 | 181 |
| 595 | 3300048924 | Ga0496121_0050303 | Ga0496121_0050303_1182_1727 | 181 |
| 596 | 3300048924 | Ga0496121_0175450 | Ga0496121_0175450_635_1180 | 181 |
| 597 | 3300048924 | Ga0496121_0190062 | Ga0496121_0190062_312_857 | 181 |
| 598 | 3300048924 | Ga0496121_0449448 | Ga0496121_0449448_184_729 | 181 |
| 599 | 3300048927 | Ga0496124_0129939 | Ga0496124_0129939_962_1510 | 181 |
| 600 | 3300048927 | Ga0496124_0385582 | Ga0496124_0385582_381_938 | 181 |
| 601 | 3300048927 | Ga0496124_0566637 | Ga0496124_0566637_171_719 | 181 |
| 602 | 3300048929 | Ga0496126_0000271 | Ga0496126_0000271_53537_54082 | 181 |
| 603 | 3300049460 | Ga0495682_0000114 | Ga0495682_0000114_64898_65443 | 181 |
| 604 | 3300049460 | Ga0495682_0007721 | Ga0495682_0007721_3490_4035 | 181 |
| 605 | 3300049569 | Ga0501032_0248217 | Ga0501032_0248217_511_1113 | 181 |
| 606 | 3300049570 | Ga0501033_0039676 | Ga0501033_0039676_157_702 | 181 |
| 607 | 3300049570 | Ga0501033_0075737 | Ga0501033_0075737_592_1164 | 181 |
| 608 | 3300049572 | Ga0501036_0478272 | Ga0501036_0478272_414_986 | 181 |
| 609 | 3300049573 | Ga0501037_0056658 | Ga0501037_0056658_1685_2257 | 181 |
| 610 | 3300049574 | Ga0501038_0047009 | Ga0501038_0047009_2088_2639 | 181 |
| 611 | 3300049579 | Ga0501043_0128792 | Ga0501043_0128792_336_908 | 181 |
| 612 | 3300049579 | Ga0501043_0217263 | Ga0501043_0217263_573_1154 | 181 |
| 613 | 3300049580 | Ga0501046_0363554 | Ga0501046_0363554_180_752 | 181 |
| 614 | 3300049581 | Ga0501047_0012459 | Ga0501047_0012459_1811_2383 | 181 |
| 615 | 3300049581 | Ga0501047_0015628 | Ga0501047_0015628_1734_2279 | 181 |
| 616 | 3300049584 | Ga0501068_0082913 | Ga0501068_0082913_874_1446 | 181 |
| 617 | 3300049585 | Ga0501069_0087893 | Ga0501069_0087893_1023_1595 | 181 |
| 618 | 3300049589 | Ga0501073_0029768 | Ga0501073_0029768_2522_3094 | 181 |
| 619 | 3300049741 | Ga0501079_0457929 | Ga0501079_0457929_373_954 | 181 |
| 620 | 3300049742 | Ga0501080_0013131 | Ga0501080_0013131_5121_5693 | 181 |
| 621 | 3300049742 | Ga0501080_0548281 | Ga0501080_0548281_57_638 | 181 |
| 622 | 3300049744 | Ga0501083_0025446 | Ga0501083_0025446_3226_3798 | 181 |
| 623 | 3300049744 | Ga0501083_0496189 | Ga0501083_0496189_200_745 | 181 |
| 624 | 3300049823 | Ga0501044_0015752 | Ga0501044_0015752_3288_3860 | 181 |
| 625 | 3300049823 | Ga0501044_0057444 | Ga0501044_0057444_1319_1900 | 181 |
| 626 | 3300049823 | Ga0501044_0123376 | Ga0501044_0123376_1883_2428 | 181 |
| 627 | 3300050516 | nmdc:mga0sz30_10285_c1 | nmdc:mga0sz30_10285_c1_324_869 | 181 |
| 628 | 3300053078 | Ga0495612_0060077 | Ga0495612_0060077_709_1254 | 181 |
| 629 | 3300053087 | Ga0500643_000028 | Ga0500643_000028_49626_50171 | 181 |
| 630 | 3300053094 | Ga0500566_0000206 | Ga0500566_0000206_10708_11256 | 181 |
| 631 | 3300053094 | Ga0500566_0002818 | Ga0500566_0002818_9666_10211 | 181 |
| 632 | 3300053103 | Ga0500555_012708 | Ga0500555_012708_1065_1610 | 181 |
| 633 | 3300053118 | Ga0500594_0119107 | Ga0500594_0119107_11_559 | 181 |
| 634 | 3300053123 | Ga0500614_139634 | Ga0500614_139634_149_694 | 181 |
| 635 | 3300053139 | Ga0500568_0000447 | Ga0500568_0000447_24005_24550 | 181 |
| 636 | 3300053153 | Ga0500616_0000231 | Ga0500616_0000231_22227_22772 | 181 |
| 637 | 3300053153 | Ga0500616_0098180 | Ga0500616_0098180_753_1298 | 181 |
| 638 | 3300053153 | Ga0500616_0106466 | Ga0500616_0106466_316_861 | 181 |
| 639 | 3300053160 | Ga0500633_0000284 | Ga0500633_0000284_1700_2245 | 181 |
| 640 | 3300053739 | Ga0500587_012891 | Ga0500587_012891_494_1039 | 181 |
| 641 | 3300059504 | Ga0587082_039186 | Ga0587082_039186_260_805 | 181 |
| 642 | 3300060353 | Ga0501082_0154969 | Ga0501082_0154969_874_1446 | 181 |
| 643 | iso_pu_bacteria | 2834641062 | 2834643615 | 181 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6e8l-assembly3.cif.gz_F | crystal structure of alkyl hydroperoxidase d (ahpd) from streptococcus pneumoniae (strain d39/ nctc 7466) | 0.9276 | 1 | 171 |
| 3lvy-assembly3.cif.gz_E | crystal structure of carboxymuconolactone decarboxylase family protein smu.961 from streptococcus mutans | 0.9274 | 5 | 173 |
| 3lvy-assembly2.cif.gz_D | crystal structure of carboxymuconolactone decarboxylase family protein smu.961 from streptococcus mutans | 0.9266 | 2 | 171 |
| 3lvy-assembly3.cif.gz_F | crystal structure of carboxymuconolactone decarboxylase family protein smu.961 from streptococcus mutans | 0.8996 | 2 | 180 |
| 2prr-assembly1.cif.gz_E | crystal structure of alkylhydroperoxidase ahpd core: uncharacterized peroxidase-related protein (yp_296737.1) from ralstonia eutropha jmp134 at 2.15 a resolution | 0.8984 | 2 | 171 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3lvyC01 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9113 | 13 | 171 | 1.20.1290.10 |
| af_Q2FVE0_2_139_1.20.1290.10 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9027 | 39 | 167 | 1.20.1290.10 |
| 2gmyF00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.8872 | 39 | 173 | 1.20.1290.10 |
| af_P76222_42_172_1.20.1290.10 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.8711 | 46 | 167 | 1.20.1290.10 |
| 3lvyC01 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.8603 | 13 | 171 | 1.20.1290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5C7NAQ8-F1-model_v4 | deleted | 0.9862 | 1 | 154 |
|
| AF-A0A534CNV7-F1-model_v4 | Carboxymuconolactone decarboxylase family protein | 0.9745 | 93 | 178 |
|
| AF-A0A5C7NAQ8-F1-model_v4 | deleted | 0.9737 | 1 | 154 |
|
| AF-B8IVV6-F1-model_v4 | Alkylhydroperoxidase-like protein, AhpD family | 0.9729 | 1 | 171 |
GO:0051920
|
| AF-A0A2W6F7C0-F1-model_v4 | Peroxidase | 0.9713 | 34 | 176 |
GO:0051920
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar