F471987

General Info

Members Datasets Scaffolds Average Seq Length
643 385 536 180

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0248217|Ga0501032_0248217_511_1113
Length 200
Sequence MISVTRSIAETPMPRSAALKPEQVPADSKSTLDSFSKNIGFTPNMMAIFAQSPIAFNAWAALLGSLSKALDVKTRDSIGLAVSEVNGCDYCLTVHSFTAERMAKLPVDEIILARKGHASDVKRDAAVQFARKVIETRGQVGDADLKAVRDAGYTDANVMEIVALVAMYSLTNFFNNVFDPERDFPAVAPAGLDLNSVQPD

Samples

Sample ID Description Type Environment
1 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
2 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
3 2511231017 Pseudomonas sp. GM55 Isolate Nodule
4 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
5 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
6 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
7 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
8 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
9 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
10 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
11 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
12 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
13 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
14 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
15 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
16 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
17 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
18 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
19 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
20 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
21 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
22 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
23 2738543009 Luteibacter sp. OK325 Isolate Unclassified
24 2739367700 Dyella sp. YR388 Isolate Unclassified
25 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
26 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
27 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
28 2791355267 Rhizobium sp. L18 Isolate Nodule
29 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
30 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
31 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
32 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
33 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
34 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
35 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
36 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
37 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
38 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
39 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
40 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
41 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
42 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
43 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
44 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
45 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
46 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
47 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
48 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
49 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
50 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
51 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
52 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
53 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
54 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
55 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
56 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
57 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
58 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
59 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
60 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
61 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
62 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
63 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
64 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
65 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
66 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
67 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
68 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
69 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
70 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
71 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
72 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
73 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
74 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
75 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
76 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
77 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
78 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
79 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
81 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
82 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
83 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
84 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
85 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
86 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
87 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
88 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
89 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
90 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
91 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
92 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
93 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
94 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
95 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
96 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
97 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
98 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
99 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
100 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
101 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
102 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
103 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
104 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
105 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
106 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
107 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
108 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
109 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
110 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
111 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
112 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
113 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
114 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
115 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
116 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
117 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
118 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
119 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
120 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
121 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
122 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
130 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
133 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
134 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
135 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
136 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
137 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
140 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
141 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
144 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
145 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
146 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
148 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
149 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
150 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
151 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
157 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
159 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
162 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
164 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
166 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
194 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
196 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
197 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
211 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
212 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
213 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
214 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
215 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
216 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
217 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
218 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
219 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
220 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
221 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
222 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
223 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
224 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
225 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
226 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
227 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
228 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
229 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
230 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
231 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
234 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
235 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
236 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
239 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
240 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
241 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
244 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
245 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
248 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
249 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
250 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
251 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
252 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
253 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
254 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
255 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
258 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
259 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
260 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
261 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
262 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
263 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
264 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
265 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
266 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
267 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
268 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
269 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
270 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
271 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
272 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
273 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
274 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
275 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
276 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
277 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
278 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
279 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
280 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
281 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
282 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
283 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
284 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
285 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
286 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
287 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
288 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
289 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
290 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
291 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
299 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
300 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
301 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
302 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
303 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
304 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
305 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
306 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
307 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
316 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
317 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
318 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
319 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
320 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
321 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
322 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
323 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
324 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
325 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
326 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
327 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
328 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
329 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
330 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
331 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
332 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
342 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
343 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
344 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
345 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
346 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
347 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
348 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
349 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
351 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
352 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
353 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
354 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
355 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
356 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
357 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
358 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
359 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
360 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
361 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
362 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
363 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
364 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
366 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
367 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
368 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
369 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
370 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
371 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
372 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
373 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
374 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
375 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
376 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
377 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
378 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
379 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
380 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
381 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
382 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
383 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
384 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
385 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.71
Metatranscriptomes 0.47
Isolates 14.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.49
Nodule 11.98
Rhizoplane 6.22
Rhizosphere 60.34
Stem 0
Stem Tuber 0
Unclassified 11.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003570 3300001979 Bacteria 6804
2 JGI24735J21928_10060167 3300002067 Bacteria 1091
3 JGI24738J21930_10002132 3300002075 Bacteria 5278
4 JGI25156J39149_1000464 3300002705 Bacteria 24482
5 JGI25159J45721_1001450 3300002987 Bacteria 9786
6 JGI25159J45721_1008132 3300002987 Bacteria 2914
7 JGI25151J46595_10000338 3300003187 Bacteria 50270
8 JGI25153J46596_10000730 3300003215 Bacteria 20147
9 rootL2_10080064 3300003322 Bacteria 2850
10 JGI25160J50197_1000091 3300003354 Bacteria 90359
11 JGI25160J50197_1000177 3300003354 Bacteria 53972
12 JGI25161J50226_1000128 3300003374 Bacteria 53972
13 Ga0032354_1093922 3300003693 Bacteria 866
14 Ga0055533_1005848 3300003756 Bacteria 1909
15 Ga0055527_1000047 3300003760 Bacteria 109679
16 Ga0055535_1000040 3300003761 Bacteria 157988
17 Ga0055542_1000065 3300003762 Bacteria 157988
18 Ga0055529_1000094 3300003763 Bacteria 134217
19 Ga0055526_1001794 3300003771 Bacteria 14879
20 Ga0055536_1000103 3300003781 Bacteria 73706
21 Ga0055534_1000104 3300003784 Bacteria 64767
22 Ga0055534_1000158 3300003784 Bacteria 50846
23 Ga0055531_10031081 3300003794 Bacteria 1776
24 Ga0058692_1019790 3300003856 Bacteria 1428
25 Ga0055543_1000174 3300004625 Bacteria 54010
26 Ga0065165_1000317 3300005262 Bacteria 78478
27 Ga0065165_1000580 3300005262 Bacteria 54010
28 Ga0065165_1034621 3300005262 Bacteria 1560
29 Ga0070670_100410065 3300005331 Bacteria 1197
30 Ga0070680_100656373 3300005336 Bacteria 902
31 Ga0068868_100546111 3300005338 Bacteria 1021
32 Ga0070660_100452162 3300005339 Bacteria 1066
33 Ga0070671_100060653 3300005355 Bacteria 3149
34 Ga0070671_100398030 3300005355 Bacteria 1178
35 Ga0070714_100354246 3300005435 Bacteria 1379
36 Ga0070714_100809569 3300005435 Bacteria 907
37 Ga0070713_100206264 3300005436 Bacteria 1777
38 Ga0070710_10518296 3300005437 Bacteria 819
39 Ga0070708_100734556 3300005445 Bacteria 928
40 Ga0070663_101003365 3300005455 Bacteria 726
41 Ga0070681_10051963 3300005458 Bacteria 4087
42 Ga0070681_10085874 3300005458 Bacteria 3099
43 Ga0068867_100584687 3300005459 Bacteria 972
44 Ga0070707_100931443 3300005468 Bacteria 833
45 Ga0070679_100319290 3300005530 Bacteria 1502
46 Ga0068853_100878919 3300005539 Bacteria 860
47 Ga0070665_100003864 3300005548 Bacteria 15851
48 Ga0070665_100060216 3300005548 Bacteria 3806
49 Ga0068855_100591174 3300005563 Bacteria 1198
50 Ga0068857_100448670 3300005577 Bacteria 1206
51 Ga0068864_100164171 3300005618 Bacteria 2021
52 Ga0068864_100908058 3300005618 Bacteria 870
53 Ga0068863_100739579 3300005841 Bacteria 979
54 Ga0068858_101194683 3300005842 Bacteria 748
55 Ga0081455_10029138 3300005937 Bacteria 5035
56 Ga0081538_10089486 3300005981 Bacteria 1598
57 Ga0081540_1050917 3300005983 Bacteria 2052
58 Ga0075432_10006014 3300006058 Bacteria 4133
59 Ga0070715_10325034 3300006163 Bacteria 831
60 Ga0075362_10022226 3300006177 Bacteria 2670
61 Ga0099825_1031931 3300006941 Bacteria 2183
62 Ga0099824_1009101 3300006942 Bacteria 12377
63 Ga0099824_1015049 3300006942 Bacteria 7473
64 Ga0099824_1035917 3300006942 Bacteria 1475
65 Ga0099794_10225119 3300007265 Bacteria 964
66 Ga0099795_10018730 3300007788 Bacteria 2230
67 Ga0105240_10001105 3300009093 Bacteria 47527
68 Ga0105240_10003464 3300009093 Bacteria 24478
69 Ga0105240_10182556 3300009093 Bacteria 2475
70 Ga0105240_10275909 3300009093 Bacteria 1934
71 Ga0105240_10441003 3300009093 Bacteria 1459
72 Ga0111539_10005454 3300009094 Bacteria 16456
73 Ga0105247_10832385 3300009101 Bacteria 707
74 Ga0105248_11289283 3300009177 Bacteria 826
75 Ga0105248_11696120 3300009177 Bacteria 716
76 Ga0105237_10579633 3300009545 Bacteria 1129
77 Ga0105237_11103672 3300009545 Bacteria 800
78 Ga0105238_10134349 3300009551 Bacteria 2452
79 Ga0105033_100546 3300009986 Bacteria 2904
80 Ga0099796_10118574 3300010159 Bacteria 1015
81 Ga0105239_10037089 3300010375 Bacteria 5347
82 Ga0105239_10135042 3300010375 Bacteria 2746
83 Ga0157327_1014753 3300012512 Bacteria 803
84 Ga0157373_10017829 3300013100 Bacteria 5170
85 Ga0157373_10205963 3300013100 Bacteria 1387
86 Ga0157371_10000678 3300013102 Bacteria 40299
87 Ga0157370_10025061 3300013104 Bacteria 5904
88 Ga0157370_10330765 3300013104 Bacteria 1405
89 Ga0157369_10084171 3300013105 Bacteria 3400
90 Ga0157369_10311577 3300013105 Bacteria 1637
91 Ga0157374_10613399 3300013296 Bacteria 1098
92 Ga0157372_10000243 3300013307 Bacteria 60266
93 Ga0157372_10389258 3300013307 Bacteria 1624
94 Ga0157372_10561943 3300013307 Bacteria 1330
95 Ga0163163_10276255 3300014325 Bacteria 1731
96 Ga0163163_11079395 3300014325 Bacteria 866
97 Ga0157380_10908730 3300014326 Bacteria 907
98 Ga0182008_10007556 3300014497 Bacteria 5994
99 Ga0182008_10140859 3300014497 Bacteria 1206
100 Ga0157379_10835232 3300014968 Bacteria 871
101 Ga0182006_1020772 3300015261 Bacteria 2747
102 Ga0182007_10011645 3300015262 Bacteria 3418
103 Ga0183368_1004 3300015687 Bacteria 1211761
104 Ga0154015_1502891 3300020610 Bacteria 965
105 Ga0213872_10000017 3300021361 Bacteria 178787
106 Ga0213872_10000429 3300021361 Bacteria 34403
107 Ga0213872_10001396 3300021361 Bacteria 15904
108 Ga0213872_10006714 3300021361 Bacteria 5735
109 Ga0213872_10011068 3300021361 Bacteria 4277
110 Ga0213876_10004063 3300021384 Bacteria 8231
111 Ga0209435_101001 3300025206 Bacteria 4042
112 Ga0209436_112204 3300025208 Bacteria 1469
113 Ga0209674_105225 3300025226 Bacteria 1961
114 Ga0209672_100017 3300025228 Bacteria 514236
115 Ga0209258_100038 3300025242 Bacteria 398959
116 Ga0209677_108617 3300025253 Bacteria 1946
117 Ga0209148_1000009 3300025254 Bacteria 1395625
118 Ga0209759_1000524 3300025256 Bacteria 40872
119 Ga0209455_1000032 3300025272 Bacteria 514243
120 Ga0209130_1000334 3300025284 Bacteria 54024
121 Ga0209130_1001098 3300025284 Bacteria 20094
122 Ga0209130_1001354 3300025284 Bacteria 16570
123 Ga0209130_1024457 3300025284 Bacteria 1318
124 Ga0209675_1000078 3300025291 Bacteria 156111
125 Ga0209676_1000121 3300025292 Bacteria 198920
126 Ga0209676_1010407 3300025292 Bacteria 3878
127 Ga0209025_1000051 3300025294 Bacteria 330080
128 Ga0209564_1000133 3300025295 Bacteria 189140
129 Ga0209564_1005057 3300025295 Bacteria 7704
130 Ga0209758_1002218 3300025297 Bacteria 20226
131 Ga0209050_1004036 3300025298 Bacteria 10311
132 Ga0207426_1000004 3300025302 Bacteria 1047900
133 Ga0207426_1000272 3300025302 Bacteria 107804
134 Ga0207426_1001300 3300025302 Bacteria 21462
135 Ga0209051_1000850 3300025303 Bacteria 31150
136 Ga0209257_1002935 3300025304 Bacteria 15709
137 Ga0207647_10011058 3300025904 Bacteria 6346
138 Ga0207685_10126951 3300025905 Bacteria 1127
139 Ga0207699_10502201 3300025906 Bacteria 875
140 Ga0207654_10291708 3300025911 Bacteria 1106
141 Ga0207707_10064964 3300025912 Bacteria 3178
142 Ga0207707_10154920 3300025912 Bacteria 2004
143 Ga0207707_10568240 3300025912 Bacteria 962
144 Ga0207695_10001233 3300025913 Bacteria 43793
145 Ga0207695_10002566 3300025913 Bacteria 26692
146 Ga0207695_10056312 3300025913 Bacteria 4092
147 Ga0207695_10075225 3300025913 Bacteria 3436
148 Ga0207695_10210106 3300025913 Bacteria 1857
149 Ga0207663_10763611 3300025916 Bacteria 768
150 Ga0207657_10113517 3300025919 Bacteria 2235
151 Ga0207646_10254256 3300025922 Bacteria 1588
152 Ga0207694_10356511 3300025924 Bacteria 1211
153 Ga0207700_10638201 3300025928 Bacteria 949
154 Ga0207664_10215544 3300025929 Bacteria 1663
155 Ga0207644_10060662 3300025931 Bacteria 2737
156 Ga0207644_10239071 3300025931 Bacteria 1445
157 Ga0207644_10317495 3300025931 Bacteria 1259
158 Ga0207644_10561374 3300025931 Bacteria 946
159 Ga0207665_10066241 3300025939 Bacteria 2458
160 Ga0207667_11058324 3300025949 Bacteria 796
161 Ga0207658_11229330 3300025986 Bacteria 685
162 Ga0207639_10372207 3300026041 Bacteria 1281
163 Ga0207678_10039852 3300026067 Bacteria 4075
164 Ga0207678_10229937 3300026067 Bacteria 1588
165 Ga0207702_11483126 3300026078 Bacteria 672
166 Ga0207641_10477228 3300026088 Bacteria 1208
167 Ga0207648_10199348 3300026089 Bacteria 1775
168 Ga0207676_10224021 3300026095 Bacteria 1677
169 Ga0207676_10876010 3300026095 Bacteria 879
170 Ga0207674_10070597 3300026116 Bacteria 3512
171 Ga0207674_10151106 3300026116 Bacteria 2279
172 Ga0207675_100665591 3300026118 Bacteria 1048
173 Ga0207698_10341387 3300026142 Bacteria 1411
174 Ga0209389_1000151 3300027296 Bacteria 59143
175 Ga0209389_1011383 3300027296 Bacteria 8052
176 Ga0209371_1000282 3300027312 Bacteria 58487
177 Ga0209589_1000002 3300027357 Bacteria 708598
178 Ga0209589_1000399 3300027357 Bacteria 59143
179 Ga0209489_100002 3300027361 Bacteria 708609
180 Ga0209489_100724 3300027361 Bacteria 64817
181 Ga0209489_116339 3300027361 Bacteria 4013
182 Ga0209700_100002 3300027363 Bacteria 708598
183 Ga0209700_100205 3300027363 Bacteria 97882
184 Ga0207428_10000358 3300027907 Bacteria 58945
185 Ga0207428_10001142 3300027907 Bacteria 28779
186 Ga0207428_10064907 3300027907 Bacteria 2882
187 Ga0268266_10001892 3300028379 Bacteria 23598
188 Ga0268266_10009564 3300028379 Bacteria 8529
189 Ga0268266_10030022 3300028379 Bacteria 4619
190 Ga0268266_10055593 3300028379 Bacteria 3403
191 Ga0268256_1000777 3300030500 Bacteria 23090
192 Ga0307408_100407491 3300031548 Bacteria 1169
193 Ga0307412_10000039 3300031911 Bacteria 182976
194 Ga0307409_101553206 3300031995 Bacteria 690
195 Ga0395899_0009133 3300037312 Bacteria 7616
196 Ga0395899_0033579 3300037312 Bacteria 3852
197 Ga0395899_0039417 3300037312 Bacteria 3536
198 Ga0395899_0097093 3300037312 Bacteria 2130
199 Ga0395900_0002731 3300037418 Bacteria 19279
200 Ga0395900_0004671 3300037418 Bacteria 14441
201 Ga0395900_0060795 3300037418 Bacteria 3886
202 Ga0395900_0083185 3300037418 Bacteria 3288
203 Ga0395900_0173190 3300037418 Bacteria 2196
204 Ga0395900_0307716 3300037418 Bacteria 1569
205 Ga0395900_0735380 3300037418 Bacteria 918
206 Ga0395900_1015858 3300037418 Bacteria 749
207 Ga0395900_1525543 3300037418 Bacteria 580
208 Ga0395898_0003975 3300037466 Bacteria 16274
209 Ga0395898_0014406 3300037466 Bacteria 8125
210 Ga0395898_0016976 3300037466 Bacteria 7434
211 Ga0395898_0058179 3300037466 Bacteria 3764
212 Ga0395898_0091061 3300037466 Bacteria 2934
213 Ga0395898_0294955 3300037466 Bacteria 1547
214 Ga0395898_0992808 3300037466 Bacteria 775
215 Ga0395905_0001244 3300037471 Bacteria 31543
216 Ga0395905_0002694 3300037471 Bacteria 19467
217 Ga0395905_0029193 3300037471 Bacteria 5198
218 Ga0395905_0068163 3300037471 Bacteria 3333
219 Ga0395905_0087345 3300037471 Bacteria 2924
220 Ga0395905_0093780 3300037471 Bacteria 2815
221 Ga0395905_0294689 3300037471 Bacteria 1509
222 Ga0395905_0467129 3300037471 Bacteria 1160
223 Ga0395905_0645298 3300037471 Bacteria 960
224 Ga0395905_1696346 3300037471 Bacteria 537
225 Ga0395901_0010766 3300038443 Bacteria 9273
226 Ga0395901_0165443 3300038443 Bacteria 2322
227 Ga0395901_0173739 3300038443 Bacteria 2260
228 Ga0395901_0195539 3300038443 Bacteria 2121
229 Ga0395901_0399548 3300038443 Bacteria 1412
230 Ga0395901_0674449 3300038443 Bacteria 1034
231 Ga0395901_0735864 3300038443 Bacteria 980
232 Ga0395901_0805400 3300038443 Bacteria 928
233 Ga0436365_0241183 3300039437 Bacteria 7989
234 Ga0436360_0258205 3300039438 Bacteria 3746
235 Ga0436360_0631847 3300039438 Bacteria 1729
236 Ga0436360_0798062 3300039438 Bacteria 1475
237 Ga0436361_0267501 3300039447 Bacteria 17700
238 Ga0436361_0408050 3300039447 Bacteria 13949
239 Ga0436361_0409682 3300039447 Bacteria 12676
240 Ga0436361_0597211 3300039447 Bacteria 957
241 Ga0436361_0868243 3300039447 Bacteria 3696
242 Ga0436361_0960211 3300039447 Bacteria 4327
243 Ga0436361_1114381 3300039447 Bacteria 8844
244 Ga0436361_1141074 3300039447 Bacteria 2195
245 Ga0439465_0273170 3300041413 Bacteria 629
246 Ga0451802_0277294 3300041460 Bacteria 1208
247 Ga0451833_0196066 3300041491 Bacteria 4946
248 Ga0451835_1065705 3300041492 Bacteria 5982
249 Ga0451837_0366658 3300041494 Bacteria 2775
250 Ga0451839_0280360 3300041496 Bacteria 1262
251 Ga0451841_0177268 3300041498 Bacteria 744
252 Ga0451845_0283541 3300041501 Bacteria 8233
253 Ga0451847_0223415 3300041503 Bacteria 3343
254 Ga0451849_0327025 3300041505 Bacteria 4536
255 Ga0451851_0481357 3300041507 Bacteria 1237
256 Ga0451843_0291851 3300041509 Bacteria 4485
257 Ga0451855_1502518 3300041511 Bacteria 6426
258 Ga0451853_1825010 3300041512 Bacteria 1238
259 Ga0439431_0005985 3300041997 Bacteria 2684
260 Ga0439431_0030665 3300041997 Bacteria 1333
261 Ga0439458_0085028 3300042157 Bacteria 810
262 Ga0439459_0050802 3300042438 Bacteria 910
263 Ga0439460_0024779 3300042461 Bacteria 1665
264 Ga0466982_0000055 3300044672 Bacteria 30959
265 Ga0466965_0228400 3300044683 Bacteria 993
266 Ga0466966_0024812 3300044684 Bacteria 3921
267 Ga0466961_0003402 3300044693 Bacteria 9925
268 Ga0466961_0010597 3300044693 Bacteria 5882
269 Ga0466971_0086068 3300044719 Bacteria 1436
270 Ga0466968_0012950 3300044735 Bacteria 3273
271 Ga0466970_0142359 3300044765 Bacteria 1321
272 Ga0466957_0032520 3300044842 Bacteria 3124
273 Ga0466957_0257711 3300044842 Bacteria 1161
274 Ga0466959_0054003 3300045049 Bacteria 2936
275 Ga0466959_0083545 3300045049 Bacteria 2299
276 Ga0466967_0120270 3300045976 Bacteria 2425
277 Ga0495617_002517 3300046452 Bacteria 7252
278 Ga0495603_0003485 3300046455 Bacteria 9357
279 Ga0495629_0000115 3300046459 Bacteria 72648
280 Ga0495629_0037386 3300046459 Bacteria 3422
281 Ga0495629_0131538 3300046459 Bacteria 1743
282 Ga0495638_0028430 3300046460 Bacteria 3611
283 Ga0495653_0167803 3300046463 Bacteria 1518
284 Ga0495650_0100680 3300046471 Bacteria 1085
285 Ga0495580_0005083 3300046472 Bacteria 10959
286 Ga0495580_0007481 3300046472 Bacteria 8777
287 Ga0495580_0007991 3300046472 Bacteria 8453
288 Ga0495580_0017866 3300046472 Bacteria 5290
289 Ga0495580_0300156 3300046472 Bacteria 1094
290 Ga0495582_0041300 3300046473 Bacteria 2541
291 Ga0495582_0043056 3300046473 Bacteria 2486
292 Ga0495582_0335159 3300046473 Bacteria 871
293 Ga0495605_0012210 3300046474 Bacteria 4770
294 Ga0495605_0021218 3300046474 Bacteria 3443
295 Ga0495662_0023296 3300046476 Bacteria 2989
296 Ga0495664_0003646 3300046477 Bacteria 8392
297 Ga0495664_0031579 3300046477 Bacteria 3106
298 Ga0495584_0000044 3300046491 Bacteria 89613
299 Ga0495584_0374165 3300046491 Bacteria 723
300 Ga0495585_0053649 3300046492 Bacteria 2231
301 Ga0495585_0195685 3300046492 Bacteria 1032
302 Ga0495585_0341107 3300046492 Bacteria 729
303 Ga0495594_0156693 3300046499 Bacteria 1293
304 Ga0495596_0005728 3300046500 Bacteria 5832
305 Ga0495596_0031390 3300046500 Bacteria 2122
306 Ga0495583_0000078 3300046506 Bacteria 171719
307 Ga0495583_0004535 3300046506 Bacteria 9889
308 Ga0495583_0009898 3300046506 Bacteria 5638
309 Ga0495583_0166409 3300046506 Bacteria 907
310 Ga0495606_0012747 3300046507 Bacteria 6702
311 Ga0495606_0029483 3300046507 Bacteria 3851
312 Ga0495606_0031841 3300046507 Bacteria 3661
313 Ga0495606_0101834 3300046507 Bacteria 1747
314 Ga0495610_0000817 3300046512 Bacteria 29198
315 Ga0495610_0005757 3300046512 Bacteria 8724
316 Ga0495616_0025438 3300046513 Bacteria 3163
317 Ga0495618_0029626 3300046514 Bacteria 3415
318 Ga0495620_0243148 3300046515 Bacteria 687
319 Ga0495628_0004561 3300046516 Bacteria 12265
320 Ga0495628_0039365 3300046516 Bacteria 3781
321 Ga0495628_0122219 3300046516 Bacteria 1996
322 Ga0495628_0126087 3300046516 Bacteria 1961
323 Ga0495630_0037973 3300046517 Bacteria 3601
324 Ga0495630_0120724 3300046517 Bacteria 1988
325 Ga0495643_0128984 3300046522 Bacteria 1271
326 Ga0495648_0007550 3300046524 Bacteria 8691
327 Ga0495648_0038936 3300046524 Bacteria 3032
328 Ga0495648_0065131 3300046524 Bacteria 2144
329 Ga0495648_0081605 3300046524 Bacteria 1838
330 Ga0495648_0103768 3300046524 Bacteria 1562
331 Ga0495666_0072511 3300046526 Bacteria 1635
332 Ga0495666_0095592 3300046526 Bacteria 1401
333 Ga0495666_0141488 3300046526 Bacteria 1121
334 Ga0495652_0312438 3300046529 Bacteria 1138
335 Ga0495665_0094787 3300046531 Bacteria 1567
336 Ga0495665_0218922 3300046531 Bacteria 984
337 Ga0495586_0585549 3300046535 Bacteria 644
338 Ga0495598_0122468 3300046537 Bacteria 883
339 Ga0495609_0007383 3300046538 Bacteria 5494
340 Ga0495597_0046937 3300046542 Bacteria 1913
341 Ga0495645_0060195 3300046543 Bacteria 2753
342 Ga0495645_0106697 3300046543 Bacteria 1986
343 Ga0495622_0032041 3300046557 Bacteria 2455
344 Ga0495622_0060832 3300046557 Bacteria 1749
345 Ga0495622_0133632 3300046557 Bacteria 1129
346 Ga0495633_0044642 3300046558 Bacteria 2100
347 Ga0495656_0249118 3300046615 Bacteria 897
348 Ga0495668_0010203 3300046616 Bacteria 5707
349 Ga0495668_0029860 3300046616 Bacteria 3080
350 Ga0495634_0223937 3300046642 Bacteria 1160
351 Ga0495611_0136681 3300046648 Bacteria 1144
352 Ga0495625_0042718 3300046660 Bacteria 3292
353 Ga0495625_0070500 3300046660 Bacteria 2454
354 Ga0495625_0096783 3300046660 Bacteria 2033
355 Ga0495625_0172748 3300046660 Bacteria 1442
356 Ga0495635_0147920 3300046663 Bacteria 1599
357 Ga0495635_0402918 3300046663 Bacteria 909
358 Ga0495659_0008738 3300046664 Bacteria 3226
359 Ga0495661_0002353 3300046665 Bacteria 14589
360 Ga0495661_0243404 3300046665 Bacteria 921
361 Ga0495588_0162257 3300046674 Bacteria 1182
362 Ga0495623_0045465 3300046679 Bacteria 2789
363 Ga0495623_0060007 3300046679 Bacteria 2388
364 Ga0495623_0211647 3300046679 Bacteria 1109
365 Ga0495646_0023672 3300046680 Bacteria 3865
366 Ga0495646_0296433 3300046680 Bacteria 856
367 Ga0495613_0717453 3300046689 Bacteria 657
368 Ga0495624_0000978 3300046690 Bacteria 22572
369 Ga0495624_0011981 3300046690 Bacteria 5942
370 Ga0495624_0092045 3300046690 Bacteria 1870
371 Ga0495624_0186190 3300046690 Bacteria 1263
372 Ga0495671_0005615 3300046692 Bacteria 7318
373 Ga0495671_0076163 3300046692 Bacteria 1645
374 Ga0495671_0390541 3300046692 Bacteria 666
375 Ga0495649_0010113 3300046694 Bacteria 5574
376 Ga0495649_0354946 3300046694 Bacteria 740
377 Ga0495589_0121557 3300046794 Bacteria 1257
378 Ga0495660_0124384 3300046810 Bacteria 1301
379 Ga0495604_0141989 3300047317 Bacteria 1715
380 Ga0495604_0165120 3300047317 Bacteria 1561
381 Ga0495636_0331509 3300047318 Bacteria 716
382 Ga0495674_0004450 3300047319 Bacteria 13484
383 Ga0495674_0007013 3300047319 Bacteria 10781
384 Ga0495674_0012300 3300047319 Bacteria 8067
385 Ga0495674_0016409 3300047319 Bacteria 6906
386 Ga0495674_0027469 3300047319 Bacteria 5201
387 Ga0495674_0037502 3300047319 Bacteria 4355
388 Ga0495674_0063791 3300047319 Bacteria 3204
389 Ga0495674_0081827 3300047319 Bacteria 2769
390 Ga0495674_0379936 3300047319 Bacteria 1143
391 Ga0495672_0010500 3300047320 Bacteria 6594
392 Ga0495672_0079207 3300047320 Bacteria 1835
393 Ga0495672_0089869 3300047320 Bacteria 1689
394 Ga0495676_0025546 3300047321 Bacteria 5098
395 Ga0495676_0026568 3300047321 Bacteria 4982
396 Ga0495676_0038841 3300047321 Bacteria 3950
397 Ga0495676_0088730 3300047321 Bacteria 2318
398 Ga0495676_0104440 3300047321 Bacteria 2090
399 Ga0495676_0124251 3300047321 Bacteria 1872
400 Ga0495680_0131891 3300047322 Bacteria 1835
401 Ga0495683_0001084 3300047323 Bacteria 18805
402 Ga0495683_0005347 3300047323 Bacteria 7131
403 Ga0495683_0023141 3300047323 Bacteria 3194
404 Ga0495687_005866 3300047443 Bacteria 7687
405 Ga0495687_012669 3300047443 Bacteria 4445
406 Ga0495687_022679 3300047443 Bacteria 3010
407 Ga0495679_000641 3300047446 Bacteria 23464
408 Ga0495673_0009886 3300047469 Bacteria 5233
409 Ga0495673_0019803 3300047469 Bacteria 3365
410 Ga0495684_0646667 3300047471 Bacteria 708
411 Ga0495686_0214228 3300047472 Bacteria 1099
412 Ga0495593_0038558 3300047673 Bacteria 2580
413 Ga0495593_0183539 3300047673 Bacteria 1053
414 Ga0495593_0449942 3300047673 Bacteria 644
415 Ga0495602_0008361 3300048088 Bacteria 10814
416 Ga0495602_0046703 3300048088 Bacteria 3909
417 Ga0495602_0065291 3300048088 Bacteria 3142
418 Ga0495602_0190994 3300048088 Bacteria 1570
419 Ga0495614_0048179 3300048089 Bacteria 1827
420 Ga0495614_0052367 3300048089 Bacteria 1749
421 Ga0495626_0003399 3300048091 Bacteria 10240
422 Ga0495626_0029777 3300048091 Bacteria 2638
423 Ga0495626_0051845 3300048091 Bacteria 1892
424 Ga0495626_0313084 3300048091 Bacteria 618
425 Ga0496100_0000408 3300048903 Bacteria 20729
426 Ga0496101_0000741 3300048904 Bacteria 19422
427 Ga0496101_0025872 3300048904 Bacteria 4075
428 Ga0496102_0000675 3300048905 Bacteria 34171
429 Ga0496102_0134510 3300048905 Bacteria 2316
430 Ga0496102_0451998 3300048905 Bacteria 1205
431 Ga0496102_0532990 3300048905 Bacteria 1097
432 Ga0496102_1507259 3300048905 Bacteria 591
433 Ga0496103_0001501 3300048906 Bacteria 15620
434 Ga0496103_0216957 3300048906 Bacteria 1230
435 Ga0496104_0006567 3300048907 Bacteria 10231
436 Ga0496104_0201526 3300048907 Bacteria 1902
437 Ga0496104_1018406 3300048907 Bacteria 732
438 Ga0496104_1314280 3300048907 Bacteria 626
439 Ga0496105_0021121 3300048908 Bacteria 5266
440 Ga0496105_0032526 3300048908 Bacteria 4281
441 Ga0496105_0187145 3300048908 Bacteria 1694
442 Ga0496106_0000079 3300048909 Bacteria 77180
443 Ga0496106_0031611 3300048909 Bacteria 3945
444 Ga0496107_0077442 3300048910 Bacteria 2422
445 Ga0496107_0574682 3300048910 Bacteria 834
446 Ga0496108_0536459 3300048911 Bacteria 1021
447 Ga0496108_0728525 3300048911 Bacteria 859
448 Ga0496109_0157851 3300048912 Bacteria 2125
449 Ga0496109_0273698 3300048912 Bacteria 1591
450 Ga0496109_1358039 3300048912 Bacteria 646
451 Ga0496111_0147815 3300048914 Bacteria 1743
452 Ga0496112_0107647 3300048915 Bacteria 2758
453 Ga0496112_0118854 3300048915 Bacteria 2613
454 Ga0496112_0138942 3300048915 Bacteria 2399
455 Ga0496112_0771072 3300048915 Bacteria 887
456 Ga0496112_0966378 3300048915 Bacteria 772
457 Ga0496113_0044934 3300048916 Bacteria 3274
458 Ga0496113_0150045 3300048916 Bacteria 1838
459 Ga0496114_0529773 3300048917 Bacteria 1041
460 Ga0496115_0261851 3300048918 Bacteria 1422
461 Ga0496116_0031713 3300048919 Bacteria 3778
462 Ga0496117_0001301 3300048920 Bacteria 36722
463 Ga0496117_0045486 3300048920 Bacteria 3169
464 Ga0496117_0133549 3300048920 Bacteria 1499
465 Ga0496117_0237154 3300048920 Bacteria 1004
466 Ga0496118_0001539 3300048921 Bacteria 34281
467 Ga0496118_0037057 3300048921 Bacteria 3931
468 Ga0496118_0041020 3300048921 Bacteria 3671
469 Ga0496118_0393329 3300048921 Bacteria 723
470 Ga0496119_0061947 3300048922 Bacteria 2231
471 Ga0496120_0121050 3300048923 Bacteria 1353
472 Ga0496120_0159337 3300048923 Bacteria 1127
473 Ga0496120_0183212 3300048923 Bacteria 1026
474 Ga0496121_0000993 3300048924 Bacteria 50722
475 Ga0496121_0019038 3300048924 Bacteria 6888
476 Ga0496121_0028768 3300048924 Bacteria 5164
477 Ga0496121_0050303 3300048924 Bacteria 3522
478 Ga0496121_0175450 3300048924 Bacteria 1552
479 Ga0496121_0190062 3300048924 Bacteria 1473
480 Ga0496121_0449448 3300048924 Bacteria 831
481 Ga0496124_0129939 3300048927 Bacteria 2002
482 Ga0496124_0385582 3300048927 Bacteria 978
483 Ga0496124_0566637 3300048927 Bacteria 746
484 Ga0496126_0000271 3300048929 Bacteria 110289
485 Ga0496126_0006836 3300048929 Bacteria 12650
486 Ga0495682_0000114 3300049460 Bacteria 69788
487 Ga0495682_0007721 3300049460 Bacteria 4263
488 Ga0501032_0248217 3300049569 Bacteria 1156
489 Ga0501033_0039676 3300049570 Bacteria 3517
490 Ga0501033_0075737 3300049570 Bacteria 2470
491 Ga0501034_0929655 3300049571 Unclassified 756
492 Ga0501036_0478272 3300049572 Bacteria 1037
493 Ga0501037_0056658 3300049573 Bacteria 2862
494 Ga0501038_0047009 3300049574 Bacteria 3740
495 Ga0501043_0128792 3300049579 Bacteria 1984
496 Ga0501043_0217263 3300049579 Bacteria 1480
497 Ga0501046_0363554 3300049580 Bacteria 1049
498 Ga0501047_0012459 3300049581 Bacteria 8052
499 Ga0501047_0015628 3300049581 Bacteria 7233
500 Ga0501047_1278239 3300049581 Unclassified 548
501 Ga0501068_0082913 3300049584 Bacteria 1970
502 Ga0501069_0087893 3300049585 Bacteria 1756
503 Ga0501070_0322270 3300049586 Bacteria 1257
504 Ga0501072_0903838 3300049588 Bacteria 690
505 Ga0501073_0029768 3300049589 Bacteria 3902
506 Ga0501079_0457929 3300049741 Bacteria 1002
507 Ga0501080_0013131 3300049742 Bacteria 7608
508 Ga0501080_0548281 3300049742 Bacteria 1030
509 Ga0501083_0025446 3300049744 Bacteria 4098
510 Ga0501083_0496189 3300049744 Bacteria 795
511 Ga0501035_0004139 3300049822 Bacteria 13782
512 Ga0501044_0015752 3300049823 Bacteria 8143
513 Ga0501044_0021527 3300049823 Bacteria 6877
514 Ga0501044_0057444 3300049823 Bacteria 3993
515 Ga0501044_0123376 3300049823 Bacteria 2589
516 Ga0501044_0126146 3300049823 Bacteria 2557
517 Ga0501044_0370964 3300049823 Bacteria 1348
518 nmdc:mga08y16_1559_c1 3300050511 Bacteria 23103
519 nmdc:mga0sz30_10285_c1 3300050516 Bacteria 3583
520 Ga0495612_0060077 3300053078 Bacteria 1573
521 Ga0500643_000028 3300053087 Bacteria 245672
522 Ga0500566_0000206 3300053094 Bacteria 31132
523 Ga0500566_0002818 3300053094 Bacteria 10354
524 Ga0500555_012708 3300053103 Bacteria 2424
525 Ga0500594_0119107 3300053118 Bacteria 827
526 Ga0500614_139634 3300053123 Bacteria 724
527 Ga0500652_125140 3300053131 Bacteria 1074
528 Ga0500568_0000447 3300053139 Bacteria 31023
529 Ga0500616_0000231 3300053153 Bacteria 87444
530 Ga0500616_0098180 3300053153 Bacteria 1437
531 Ga0500616_0106466 3300053153 Bacteria 1362
532 Ga0500633_0000284 3300053160 Bacteria 7411
533 Ga0500587_012891 3300053739 Bacteria 1054
534 Ga0587082_039186 3300059504 Bacteria 861
535 Ga0501082_0154969 3300060353 Bacteria 1990
536 Ga0466962_0271276 3300061719 Bacteria 836

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_1278239 Ga0501047_1278239_92_538 148
2 3300027907 Ga0207428_10000358 Ga0207428_1000035810 160
3 3300037471 Ga0395905_1696346 Ga0395905_1696346_42_524 160
4 3300039447 Ga0436361_0597211 Ga0436361_0597211_36_518 160
5 3300041997 Ga0439431_0005985 Ga0439431_0005985_2144_2626 160
6 3300045049 Ga0466959_0083545 Ga0466959_0083545_1803_2285 160
7 3300046499 Ga0495594_0156693 Ga0495594_0156693_769_1251 160
8 3300046500 Ga0495596_0005728 Ga0495596_0005728_3286_3768 160
9 3300046694 Ga0495649_0354946 Ga0495649_0354946_226_708 160
10 3300048910 Ga0496107_0574682 Ga0496107_0574682_219_701 160
11 3300048914 Ga0496111_0147815 Ga0496111_0147815_1229_1711 160
12 3300049823 Ga0501044_0126146 Ga0501044_0126146_1302_1859 160
13 3300061719 Ga0466962_0271276 Ga0466962_0271276_318_800 160
14 iso_pu_bacteria 2824704595 2824705141 160
15 3300053131 Ga0500652_125140 Ga0500652_125140_336_827 163
16 3300048923 Ga0496120_0159337 Ga0496120_0159337_99_599 165
17 iso_pu_bacteria 2903768456 2903774174 166
18 iso_pu_bacteria 2904615490 2904624351 166
19 iso_pu_bacteria 2906643746 2906651806 166
20 3300014968 Ga0157379_10835232 Ga0157379_108352321 170
21 3300037418 Ga0395900_0083185 Ga0395900_0083185_1206_1754 170
22 3300037418 Ga0395900_0307716 Ga0395900_0307716_226_738 170
23 3300037418 Ga0395900_1525543 Ga0395900_1525543_14_526 170
24 3300037466 Ga0395898_0992808 Ga0395898_0992808_213_761 170
25 3300037471 Ga0395905_0645298 Ga0395905_0645298_30_578 170
26 3300038443 Ga0395901_0165443 Ga0395901_0165443_1076_1624 170
27 3300041413 Ga0439465_0273170 Ga0439465_0273170_12_524 170
28 3300044735 Ga0466968_0012950 Ga0466968_0012950_2014_2526 170
29 3300046459 Ga0495629_0000115 Ga0495629_0000115_30559_31071 170
30 3300046472 Ga0495580_0007481 Ga0495580_0007481_904_1416 170
31 3300046476 Ga0495662_0023296 Ga0495662_0023296_646_1158 170
32 3300046506 Ga0495583_0166409 Ga0495583_0166409_11_523 170
33 3300046516 Ga0495628_0004561 Ga0495628_0004561_1550_2062 170
34 3300046516 Ga0495628_0039365 Ga0495628_0039365_448_960 170
35 3300046524 Ga0495648_0081605 Ga0495648_0081605_518_1030 170
36 3300046529 Ga0495652_0312438 Ga0495652_0312438_584_1096 170
37 3300046531 Ga0495665_0218922 Ga0495665_0218922_445_957 170
38 3300046535 Ga0495586_0585549 Ga0495586_0585549_119_631 170
39 3300046616 Ga0495668_0029860 Ga0495668_0029860_1609_2121 170
40 3300046642 Ga0495634_0223937 Ga0495634_0223937_339_851 170
41 3300046663 Ga0495635_0402918 Ga0495635_0402918_319_879 170
42 3300046680 Ga0495646_0023672 Ga0495646_0023672_3319_3831 170
43 3300046680 Ga0495646_0296433 Ga0495646_0296433_21_533 170
44 3300046690 Ga0495624_0000978 Ga0495624_0000978_455_967 170
45 3300047320 Ga0495672_0010500 Ga0495672_0010500_1318_1830 170
46 3300047443 Ga0495687_022679 Ga0495687_022679_1338_1850 170
47 3300048088 Ga0495602_0046703 Ga0495602_0046703_573_1085 170
48 3300048905 Ga0496102_0532990 Ga0496102_0532990_89_601 170
49 3300048905 Ga0496102_1507259 Ga0496102_1507259_67_579 170
50 3300048924 Ga0496121_0028768 Ga0496121_0028768_3823_4335 170
51 3300048929 Ga0496126_0006836 Ga0496126_0006836_7187_7699 170
52 3300049586 Ga0501070_0322270 Ga0501070_0322270_497_1084 170
53 3300049588 Ga0501072_0903838 Ga0501072_0903838_80_592 170
54 3300049822 Ga0501035_0004139 Ga0501035_0004139_2711_3223 170
55 iso_pu_bacteria 3005409236 3005415336 170
56 3300006941 Ga0099825_1031931 Ga0099825_10319313 171
57 3300027296 Ga0209389_1011383 Ga0209389_101138312 171
58 3300027361 Ga0209489_116339 Ga0209489_1163392 171
59 3300027363 Ga0209700_100205 Ga0209700_100205103 171
60 3300046492 Ga0495585_0053649 Ga0495585_0053649_1481_1999 172
61 3300009094 Ga0111539_10005454 Ga0111539_100054547 173
62 3300050511 nmdc:mga08y16_1559_c1 nmdc:mga08y16_1559_c1_18975_19496 173
63 3300013100 Ga0157373_10205963 Ga0157373_102059632 174
64 3300013104 Ga0157370_10025061 Ga0157370_100250613 174
65 3300013105 Ga0157369_10084171 Ga0157369_100841712 174
66 3300014497 Ga0182008_10007556 Ga0182008_100075565 174
67 3300015261 Ga0182006_1020772 Ga0182006_10207722 174
68 3300015262 Ga0182007_10011645 Ga0182007_100116454 174
69 3300045976 Ga0466967_0120270 Ga0466967_0120270_50_595 174
70 3300046524 Ga0495648_0065131 Ga0495648_0065131_836_1360 174
71 3300049823 Ga0501044_0370964 Ga0501044_0370964_556_1083 175
72 3300048909 Ga0496106_0000079 Ga0496106_0000079_4310_4840 176
73 iso_pu_bacteria 2508501042 2508690525 177
74 iso_pu_bacteria 2509276021 2509385988 177
75 iso_pu_bacteria 2511231017 2511335531 177
76 iso_pu_bacteria 2513237096 2513660398 177
77 iso_pu_bacteria 2513237098 2513677386 177
78 iso_pu_bacteria 2513237137 2513860737 177
79 iso_pu_bacteria 2513237137 2513863334 177
80 iso_pu_bacteria 2513237139 2513876121 177
81 iso_pu_bacteria 2513237145 2513916916 177
82 iso_pu_bacteria 2513237151 2513961383 177
83 iso_pu_bacteria 2513237166 2514053923 177
84 iso_pu_bacteria 2515075009 2515109739 177
85 iso_pu_bacteria 2515154189 2516022070 177
86 iso_pu_bacteria 2524023205 2524441330 177
87 iso_pu_bacteria 2524023210 2524469642 177
88 iso_pu_bacteria 2582581316 2585336316 177
89 iso_pu_bacteria 2667528175 2671123674 177
90 iso_pu_bacteria 2728368998 2728748093 177
91 iso_pu_bacteria 2738541296 2738819296 177
92 iso_pu_bacteria 2738541298 2738831775 177
93 iso_pu_bacteria 2738541306 2738873303 177
94 iso_pu_bacteria 2738543002 2739184933 177
95 iso_pu_bacteria 2738543008 2739219902 177
96 iso_pu_bacteria 2738543009 2739226806 177
97 iso_pu_bacteria 2739367700 2739731142 177
98 iso_pu_bacteria 2739367874 2740058635 177
99 iso_pu_bacteria 2765235942 2766067080 177
100 iso_pu_bacteria 2791355137 2792837538 177
101 iso_pu_bacteria 2791355199 2793079095 177
102 iso_pu_bacteria 2791355267 2793371196 177
103 iso_pu_bacteria 2821443989 2821449144 177
104 iso_pu_bacteria 2824773399 2824774465 177
105 iso_pu_bacteria 2838074704 2838079194 177
106 iso_pu_bacteria 2841941048 2841942974 177
107 iso_pu_bacteria 2841974524 2841980918 177
108 iso_pu_bacteria 2852387548 2852393746 177
109 iso_pu_bacteria 2852387548 2852393753 177
110 iso_pu_bacteria 2879099564 2879102520 177
111 iso_pu_bacteria 2881665667 2881667118 177
112 iso_pu_bacteria 2885270888 2885277603 177
113 iso_pu_bacteria 2885383462 2885385823 177
114 iso_pu_bacteria 2904615490 2904623008 177
115 iso_pu_bacteria 2904690495 2904698488 177
116 iso_pu_bacteria 2906635258 2906641358 177
117 iso_pu_bacteria 2906635258 2906643301 177
118 iso_pu_bacteria 2906660503 2906661114 177
119 iso_pu_bacteria 2906660503 2906662569 177
120 iso_pu_bacteria 2906660503 2906668763 177
121 iso_pu_bacteria 2908756301 2908762500 177
122 iso_pu_bacteria 2921643360 2921652247 177
123 iso_pu_bacteria 2922368715 2922371553 177
124 iso_pu_bacteria 2933577622 2933577708 177
125 iso_pu_bacteria 2935648319 2935653112 177
126 iso_pu_bacteria 2935656913 2935661695 177
127 iso_pu_bacteria 2935675223 2935681010 177
128 iso_pu_bacteria 2935760218 2935769296 177
129 iso_pu_bacteria 2935837841 2935845925 177
130 iso_pu_bacteria 2935883170 2935886342 177
131 iso_pu_bacteria 2935992306 2935993665 177
132 iso_pu_bacteria 2936011229 2936015948 177
133 iso_pu_bacteria 2936019824 2936024616 177
134 iso_pu_bacteria 2936028420 2936033846 177
135 iso_pu_bacteria 2936046547 2936051691 177
136 iso_pu_bacteria 2936055302 2936061649 177
137 iso_pu_bacteria 2936055302 2936062453 177
138 iso_pu_bacteria 2941538514 2941546040 177
139 iso_pu_bacteria 2945934425 2945940311 177
140 iso_pu_bacteria 2960617483 2960618589 177
141 iso_pu_bacteria 2967735183 2967737053 177
142 iso_pu_bacteria 2990703756 2990707440 177
143 iso_pu_bacteria 3005474847 3005481691 177
144 iso_pu_bacteria 641736151 642423880 177
145 iso_pu_bacteria 643348564 643597468 177
146 iso_pu_bacteria 8005301065 8005301727 177
147 iso_pu_bacteria 8005301065 8005301735 177
148 iso_pu_bacteria 8005460587 8005465779 177
149 iso_pu_bacteria 8005682033 8005686724 177
150 iso_pu_bacteria 8016522445 8016525332 177
151 iso_pu_bacteria 8016530956 8016538915 177
152 iso_pu_bacteria 8016539877 8016543200 177
153 iso_pu_bacteria 8016548790 8016550092 177
154 iso_pu_bacteria 8016557553 8016558506 177
155 iso_pu_bacteria 8016566248 8016568610 177
156 iso_pu_bacteria 8016575299 8016581256 177
157 iso_pu_bacteria 8016595262 8016596489 177
158 iso_pu_bacteria 8019530166 8019538583 177
159 iso_pu_bacteria 8019619141 8019621512 177
160 iso_pu_bacteria 8046767195 8046769120 177
161 iso_pu_bacteria 8055301274 8055306889 177
162 iso_pu_bacteria 8055742211 8055748656 177
163 3300013307 Ga0157372_10389258 Ga0157372_103892582 178
164 iso_pu_bacteria 8055266321 8055273061 178
165 3300014326 Ga0157380_10908730 Ga0157380_109087301 180
166 3300026116 Ga0207674_10070597 Ga0207674_100705974 180
167 3300037312 Ga0395899_0097093 Ga0395899_0097093_1107_1649 180
168 3300037418 Ga0395900_0004671 Ga0395900_0004671_12751_13293 180
169 3300037466 Ga0395898_0091061 Ga0395898_0091061_2345_2887 180
170 3300037471 Ga0395905_0093780 Ga0395905_0093780_568_1110 180
171 3300049571 Ga0501034_0929655 Ga0501034_0929655_53_595 180
172 3300049823 Ga0501044_0021527 Ga0501044_0021527_1771_2313 180
173 3300001979 JGI24740J21852_10003570 JGI24740J21852_100035703 181
174 3300002067 JGI24735J21928_10060167 JGI24735J21928_100601671 181
175 3300002075 JGI24738J21930_10002132 JGI24738J21930_100021328 181
176 3300002705 JGI25156J39149_1000464 JGI25156J39149_100046422 181
177 3300002987 JGI25159J45721_1001450 JGI25159J45721_100145012 181
178 3300002987 JGI25159J45721_1008132 JGI25159J45721_10081324 181
179 3300003187 JGI25151J46595_10000338 JGI25151J46595_1000033846 181
180 3300003215 JGI25153J46596_10000730 JGI25153J46596_100007304 181
181 3300003322 rootL2_10080064 rootL2_100800641 181
182 3300003354 JGI25160J50197_1000091 JGI25160J50197_100009121 181
183 3300003354 JGI25160J50197_1000177 JGI25160J50197_100017766 181
184 3300003374 JGI25161J50226_1000128 JGI25161J50226_100012867 181
185 3300003693 Ga0032354_1093922 Ga0032354_10939221 181
186 3300003756 Ga0055533_1005848 Ga0055533_10058482 181
187 3300003760 Ga0055527_1000047 Ga0055527_100004772 181
188 3300003761 Ga0055535_1000040 Ga0055535_1000040117 181
189 3300003762 Ga0055542_1000065 Ga0055542_10000652 181
190 3300003763 Ga0055529_1000094 Ga0055529_100009497 181
191 3300003771 Ga0055526_1001794 Ga0055526_10017944 181
192 3300003781 Ga0055536_1000103 Ga0055536_100010318 181
193 3300003784 Ga0055534_1000104 Ga0055534_100010462 181
194 3300003784 Ga0055534_1000158 Ga0055534_100015829 181
195 3300003794 Ga0055531_10031081 Ga0055531_100310812 181
196 3300003856 Ga0058692_1019790 Ga0058692_10197902 181
197 3300004625 Ga0055543_1000174 Ga0055543_100017470 181
198 3300005262 Ga0065165_1000317 Ga0065165_10003178 181
199 3300005262 Ga0065165_1000580 Ga0065165_100058070 181
200 3300005262 Ga0065165_1034621 Ga0065165_10346211 181
201 3300005331 Ga0070670_100410065 Ga0070670_1004100652 181
202 3300005336 Ga0070680_100656373 Ga0070680_1006563732 181
203 3300005338 Ga0068868_100546111 Ga0068868_1005461112 181
204 3300005339 Ga0070660_100452162 Ga0070660_1004521622 181
205 3300005355 Ga0070671_100060653 Ga0070671_1000606533 181
206 3300005355 Ga0070671_100398030 Ga0070671_1003980302 181
207 3300005435 Ga0070714_100354246 Ga0070714_1003542461 181
208 3300005435 Ga0070714_100809569 Ga0070714_1008095692 181
209 3300005436 Ga0070713_100206264 Ga0070713_1002062642 181
210 3300005437 Ga0070710_10518296 Ga0070710_105182961 181
211 3300005445 Ga0070708_100734556 Ga0070708_1007345562 181
212 3300005455 Ga0070663_101003365 Ga0070663_1010033651 181
213 3300005458 Ga0070681_10051963 Ga0070681_100519636 181
214 3300005458 Ga0070681_10085874 Ga0070681_100858745 181
215 3300005459 Ga0068867_100584687 Ga0068867_1005846872 181
216 3300005468 Ga0070707_100931443 Ga0070707_1009314431 181
217 3300005530 Ga0070679_100319290 Ga0070679_1003192902 181
218 3300005539 Ga0068853_100878919 Ga0068853_1008789192 181
219 3300005548 Ga0070665_100003864 Ga0070665_10000386413 181
220 3300005548 Ga0070665_100060216 Ga0070665_1000602162 181
221 3300005563 Ga0068855_100591174 Ga0068855_1005911741 181
222 3300005577 Ga0068857_100448670 Ga0068857_1004486702 181
223 3300005618 Ga0068864_100164171 Ga0068864_1001641713 181
224 3300005618 Ga0068864_100908058 Ga0068864_1009080582 181
225 3300005841 Ga0068863_100739579 Ga0068863_1007395792 181
226 3300005842 Ga0068858_101194683 Ga0068858_1011946831 181
227 3300005937 Ga0081455_10029138 Ga0081455_100291384 181
228 3300005981 Ga0081538_10089486 Ga0081538_100894863 181
229 3300005983 Ga0081540_1050917 Ga0081540_10509172 181
230 3300006058 Ga0075432_10006014 Ga0075432_100060144 181
231 3300006163 Ga0070715_10325034 Ga0070715_103250341 181
232 3300006177 Ga0075362_10022226 Ga0075362_100222263 181
233 3300006942 Ga0099824_1009101 Ga0099824_10091013 181
234 3300006942 Ga0099824_1015049 Ga0099824_101504912 181
235 3300006942 Ga0099824_1035917 Ga0099824_10359172 181
236 3300007265 Ga0099794_10225119 Ga0099794_102251191 181
237 3300007788 Ga0099795_10018730 Ga0099795_100187302 181
238 3300009093 Ga0105240_10001105 Ga0105240_1000110518 181
239 3300009093 Ga0105240_10003464 Ga0105240_100034649 181
240 3300009093 Ga0105240_10182556 Ga0105240_101825562 181
241 3300009093 Ga0105240_10275909 Ga0105240_102759093 181
242 3300009093 Ga0105240_10441003 Ga0105240_104410032 181
243 3300009101 Ga0105247_10832385 Ga0105247_108323851 181
244 3300009177 Ga0105248_11289283 Ga0105248_112892831 181
245 3300009177 Ga0105248_11696120 Ga0105248_116961201 181
246 3300009545 Ga0105237_10579633 Ga0105237_105796332 181
247 3300009545 Ga0105237_11103672 Ga0105237_111036721 181
248 3300009551 Ga0105238_10134349 Ga0105238_101343492 181
249 3300009986 Ga0105033_100546 Ga0105033_1005463 181
250 3300010159 Ga0099796_10118574 Ga0099796_101185741 181
251 3300010375 Ga0105239_10037089 Ga0105239_100370894 181
252 3300010375 Ga0105239_10135042 Ga0105239_101350423 181
253 3300012512 Ga0157327_1014753 Ga0157327_10147531 181
254 3300013100 Ga0157373_10017829 Ga0157373_100178293 181
255 3300013102 Ga0157371_10000678 Ga0157371_1000067826 181
256 3300013104 Ga0157370_10330765 Ga0157370_103307652 181
257 3300013105 Ga0157369_10311577 Ga0157369_103115771 181
258 3300013296 Ga0157374_10613399 Ga0157374_106133992 181
259 3300013307 Ga0157372_10000243 Ga0157372_1000024325 181
260 3300013307 Ga0157372_10561943 Ga0157372_105619432 181
261 3300014325 Ga0163163_10276255 Ga0163163_102762552 181
262 3300014325 Ga0163163_11079395 Ga0163163_110793952 181
263 3300014497 Ga0182008_10140859 Ga0182008_101408592 181
264 3300015687 Ga0183368_1004 Ga0183368_1004473 181
265 3300020610 Ga0154015_1502891 Ga0154015_15028912 181
266 3300021361 Ga0213872_10000017 Ga0213872_1000001723 181
267 3300021361 Ga0213872_10000429 Ga0213872_100004294 181
268 3300021361 Ga0213872_10001396 Ga0213872_100013969 181
269 3300021361 Ga0213872_10006714 Ga0213872_100067145 181
270 3300021361 Ga0213872_10011068 Ga0213872_100110684 181
271 3300021384 Ga0213876_10004063 Ga0213876_100040633 181
272 3300025206 Ga0209435_101001 Ga0209435_1010015 181
273 3300025208 Ga0209436_112204 Ga0209436_1122042 181
274 3300025226 Ga0209674_105225 Ga0209674_1052252 181
275 3300025228 Ga0209672_100017 Ga0209672_1000172 181
276 3300025242 Ga0209258_100038 Ga0209258_100038310 181
277 3300025253 Ga0209677_108617 Ga0209677_1086172 181
278 3300025254 Ga0209148_1000009 Ga0209148_10000091210 181
279 3300025256 Ga0209759_1000524 Ga0209759_100052433 181
280 3300025272 Ga0209455_1000032 Ga0209455_10000322 181
281 3300025284 Ga0209130_1000334 Ga0209130_10003342 181
282 3300025284 Ga0209130_1001098 Ga0209130_100109820 181
283 3300025284 Ga0209130_1001354 Ga0209130_10013543 181
284 3300025284 Ga0209130_1024457 Ga0209130_10244571 181
285 3300025291 Ga0209675_1000078 Ga0209675_100007848 181
286 3300025292 Ga0209676_1000121 Ga0209676_1000121139 181
287 3300025292 Ga0209676_1010407 Ga0209676_10104074 181
288 3300025294 Ga0209025_1000051 Ga0209025_100005149 181
289 3300025295 Ga0209564_1000133 Ga0209564_1000133131 181
290 3300025295 Ga0209564_1005057 Ga0209564_10050572 181
291 3300025297 Ga0209758_1002218 Ga0209758_10022185 181
292 3300025298 Ga0209050_1004036 Ga0209050_10040366 181
293 3300025302 Ga0207426_1000004 Ga0207426_100000487 181
294 3300025302 Ga0207426_1000272 Ga0207426_10002723 181
295 3300025302 Ga0207426_1000272 Ga0207426_100027257 181
296 3300025302 Ga0207426_1001300 Ga0207426_100130020 181
297 3300025303 Ga0209051_1000850 Ga0209051_100085019 181
298 3300025304 Ga0209257_1002935 Ga0209257_100293512 181
299 3300025904 Ga0207647_10011058 Ga0207647_100110586 181
300 3300025905 Ga0207685_10126951 Ga0207685_101269512 181
301 3300025906 Ga0207699_10502201 Ga0207699_105022011 181
302 3300025911 Ga0207654_10291708 Ga0207654_102917082 181
303 3300025912 Ga0207707_10064964 Ga0207707_100649642 181
304 3300025912 Ga0207707_10154920 Ga0207707_101549202 181
305 3300025912 Ga0207707_10568240 Ga0207707_105682402 181
306 3300025913 Ga0207695_10001233 Ga0207695_1000123326 181
307 3300025913 Ga0207695_10002566 Ga0207695_100025666 181
308 3300025913 Ga0207695_10056312 Ga0207695_100563125 181
309 3300025913 Ga0207695_10075225 Ga0207695_100752253 181
310 3300025913 Ga0207695_10210106 Ga0207695_102101063 181
311 3300025916 Ga0207663_10763611 Ga0207663_107636112 181
312 3300025919 Ga0207657_10113517 Ga0207657_101135173 181
313 3300025922 Ga0207646_10254256 Ga0207646_102542562 181
314 3300025924 Ga0207694_10356511 Ga0207694_103565112 181
315 3300025928 Ga0207700_10638201 Ga0207700_106382012 181
316 3300025929 Ga0207664_10215544 Ga0207664_102155442 181
317 3300025931 Ga0207644_10060662 Ga0207644_100606623 181
318 3300025931 Ga0207644_10239071 Ga0207644_102390712 181
319 3300025931 Ga0207644_10317495 Ga0207644_103174952 181
320 3300025931 Ga0207644_10561374 Ga0207644_105613742 181
321 3300025939 Ga0207665_10066241 Ga0207665_100662412 181
322 3300025949 Ga0207667_11058324 Ga0207667_110583241 181
323 3300025986 Ga0207658_11229330 Ga0207658_112293301 181
324 3300026041 Ga0207639_10372207 Ga0207639_103722072 181
325 3300026067 Ga0207678_10039852 Ga0207678_100398526 181
326 3300026067 Ga0207678_10229937 Ga0207678_102299372 181
327 3300026078 Ga0207702_11483126 Ga0207702_114831261 181
328 3300026088 Ga0207641_10477228 Ga0207641_104772282 181
329 3300026089 Ga0207648_10199348 Ga0207648_101993481 181
330 3300026095 Ga0207676_10224021 Ga0207676_102240213 181
331 3300026095 Ga0207676_10876010 Ga0207676_108760101 181
332 3300026116 Ga0207674_10151106 Ga0207674_101511062 181
333 3300026118 Ga0207675_100665591 Ga0207675_1006655911 181
334 3300026142 Ga0207698_10341387 Ga0207698_103413872 181
335 3300027296 Ga0209389_1000151 Ga0209389_100015122 181
336 3300027296 Ga0209389_1000151 Ga0209389_100015134 181
337 3300027312 Ga0209371_1000282 Ga0209371_100028223 181
338 3300027357 Ga0209589_1000002 Ga0209589_1000002535 181
339 3300027357 Ga0209589_1000002 Ga0209589_1000002542 181
340 3300027357 Ga0209589_1000399 Ga0209589_100039922 181
341 3300027357 Ga0209589_1000399 Ga0209589_100039934 181
342 3300027361 Ga0209489_100002 Ga0209489_100002535 181
343 3300027361 Ga0209489_100002 Ga0209489_100002542 181
344 3300027361 Ga0209489_100724 Ga0209489_10072428 181
345 3300027361 Ga0209489_100724 Ga0209489_10072440 181
346 3300027363 Ga0209700_100002 Ga0209700_100002535 181
347 3300027363 Ga0209700_100002 Ga0209700_100002542 181
348 3300027907 Ga0207428_10001142 Ga0207428_1000114217 181
349 3300027907 Ga0207428_10064907 Ga0207428_100649072 181
350 3300028379 Ga0268266_10001892 Ga0268266_100018928 181
351 3300028379 Ga0268266_10009564 Ga0268266_100095645 181
352 3300028379 Ga0268266_10030022 Ga0268266_100300226 181
353 3300028379 Ga0268266_10055593 Ga0268266_100555934 181
354 3300030500 Ga0268256_1000777 Ga0268256_100077723 181
355 3300031548 Ga0307408_100407491 Ga0307408_1004074911 181
356 3300031911 Ga0307412_10000039 Ga0307412_1000003979 181
357 3300031995 Ga0307409_101553206 Ga0307409_1015532061 181
358 3300037312 Ga0395899_0009133 Ga0395899_0009133_6254_6802 181
359 3300037312 Ga0395899_0033579 Ga0395899_0033579_449_997 181
360 3300037312 Ga0395899_0039417 Ga0395899_0039417_2631_3176 181
361 3300037418 Ga0395900_0002731 Ga0395900_0002731_5535_6083 181
362 3300037418 Ga0395900_0060795 Ga0395900_0060795_3014_3559 181
363 3300037418 Ga0395900_0173190 Ga0395900_0173190_511_1056 181
364 3300037418 Ga0395900_0735380 Ga0395900_0735380_87_632 181
365 3300037418 Ga0395900_1015858 Ga0395900_1015858_153_701 181
366 3300037466 Ga0395898_0003975 Ga0395898_0003975_9933_10481 181
367 3300037466 Ga0395898_0014406 Ga0395898_0014406_5491_6036 181
368 3300037466 Ga0395898_0016976 Ga0395898_0016976_957_1529 181
369 3300037466 Ga0395898_0058179 Ga0395898_0058179_1204_1761 181
370 3300037466 Ga0395898_0294955 Ga0395898_0294955_581_1126 181
371 3300037471 Ga0395905_0001244 Ga0395905_0001244_28735_29283 181
372 3300037471 Ga0395905_0002694 Ga0395905_0002694_5465_6010 181
373 3300037471 Ga0395905_0029193 Ga0395905_0029193_362_907 181
374 3300037471 Ga0395905_0068163 Ga0395905_0068163_1755_2300 181
375 3300037471 Ga0395905_0087345 Ga0395905_0087345_1668_2213 181
376 3300037471 Ga0395905_0294689 Ga0395905_0294689_220_765 181
377 3300037471 Ga0395905_0467129 Ga0395905_0467129_411_956 181
378 3300038443 Ga0395901_0010766 Ga0395901_0010766_7626_8183 181
379 3300038443 Ga0395901_0173739 Ga0395901_0173739_1350_1922 181
380 3300038443 Ga0395901_0195539 Ga0395901_0195539_786_1334 181
381 3300038443 Ga0395901_0399548 Ga0395901_0399548_388_933 181
382 3300038443 Ga0395901_0674449 Ga0395901_0674449_320_865 181
383 3300038443 Ga0395901_0735864 Ga0395901_0735864_129_674 181
384 3300038443 Ga0395901_0805400 Ga0395901_0805400_271_816 181
385 3300039437 Ga0436365_0241183 Ga0436365_0241183_784_1368 181
386 3300039438 Ga0436360_0258205 Ga0436360_0258205_1852_2397 181
387 3300039438 Ga0436360_0631847 Ga0436360_0631847_303_848 181
388 3300039438 Ga0436360_0798062 Ga0436360_0798062_126_671 181
389 3300039447 Ga0436361_0267501 Ga0436361_0267501_16724_17269 181
390 3300039447 Ga0436361_0408050 Ga0436361_0408050_2951_3499 181
391 3300039447 Ga0436361_0409682 Ga0436361_0409682_9393_9938 181
392 3300039447 Ga0436361_0868243 Ga0436361_0868243_288_833 181
393 3300039447 Ga0436361_0960211 Ga0436361_0960211_2666_3211 181
394 3300039447 Ga0436361_1114381 Ga0436361_1114381_2757_3302 181
395 3300039447 Ga0436361_1141074 Ga0436361_1141074_1518_2063 181
396 3300041460 Ga0451802_0277294 Ga0451802_0277294_259_804 181
397 3300041491 Ga0451833_0196066 Ga0451833_0196066_138_683 181
398 3300041492 Ga0451835_1065705 Ga0451835_1065705_857_1402 181
399 3300041494 Ga0451837_0366658 Ga0451837_0366658_873_1418 181
400 3300041496 Ga0451839_0280360 Ga0451839_0280360_273_818 181
401 3300041498 Ga0451841_0177268 Ga0451841_0177268_92_637 181
402 3300041501 Ga0451845_0283541 Ga0451845_0283541_6411_6956 181
403 3300041503 Ga0451847_0223415 Ga0451847_0223415_1404_1949 181
404 3300041505 Ga0451849_0327025 Ga0451849_0327025_2600_3145 181
405 3300041507 Ga0451851_0481357 Ga0451851_0481357_390_935 181
406 3300041509 Ga0451843_0291851 Ga0451843_0291851_1472_2017 181
407 3300041511 Ga0451855_1502518 Ga0451855_1502518_3571_4116 181
408 3300041512 Ga0451853_1825010 Ga0451853_1825010_219_764 181
409 3300041997 Ga0439431_0030665 Ga0439431_0030665_770_1315 181
410 3300042157 Ga0439458_0085028 Ga0439458_0085028_29_574 181
411 3300042438 Ga0439459_0050802 Ga0439459_0050802_85_630 181
412 3300042461 Ga0439460_0024779 Ga0439460_0024779_46_591 181
413 3300044672 Ga0466982_0000055 Ga0466982_0000055_15699_16244 181
414 3300044683 Ga0466965_0228400 Ga0466965_0228400_144_689 181
415 3300044684 Ga0466966_0024812 Ga0466966_0024812_3020_3571 181
416 3300044693 Ga0466961_0003402 Ga0466961_0003402_470_1015 181
417 3300044693 Ga0466961_0010597 Ga0466961_0010597_569_1114 181
418 3300044719 Ga0466971_0086068 Ga0466971_0086068_227_772 181
419 3300044765 Ga0466970_0142359 Ga0466970_0142359_195_746 181
420 3300044842 Ga0466957_0032520 Ga0466957_0032520_159_704 181
421 3300044842 Ga0466957_0257711 Ga0466957_0257711_16_561 181
422 3300045049 Ga0466959_0054003 Ga0466959_0054003_1202_1747 181
423 3300046452 Ga0495617_002517 Ga0495617_002517_5889_6434 181
424 3300046455 Ga0495603_0003485 Ga0495603_0003485_2209_2754 181
425 3300046459 Ga0495629_0000115 Ga0495629_0000115_25175_25720 181
426 3300046459 Ga0495629_0037386 Ga0495629_0037386_2863_3408 181
427 3300046459 Ga0495629_0131538 Ga0495629_0131538_401_946 181
428 3300046460 Ga0495638_0028430 Ga0495638_0028430_2816_3361 181
429 3300046463 Ga0495653_0167803 Ga0495653_0167803_91_636 181
430 3300046471 Ga0495650_0100680 Ga0495650_0100680_273_818 181
431 3300046472 Ga0495580_0005083 Ga0495580_0005083_3412_3957 181
432 3300046472 Ga0495580_0007991 Ga0495580_0007991_4063_4608 181
433 3300046472 Ga0495580_0017866 Ga0495580_0017866_3948_4493 181
434 3300046472 Ga0495580_0300156 Ga0495580_0300156_489_1034 181
435 3300046473 Ga0495582_0041300 Ga0495582_0041300_373_918 181
436 3300046473 Ga0495582_0043056 Ga0495582_0043056_213_758 181
437 3300046473 Ga0495582_0335159 Ga0495582_0335159_282_827 181
438 3300046474 Ga0495605_0012210 Ga0495605_0012210_2448_2993 181
439 3300046474 Ga0495605_0021218 Ga0495605_0021218_273_818 181
440 3300046477 Ga0495664_0003646 Ga0495664_0003646_3562_4107 181
441 3300046477 Ga0495664_0031579 Ga0495664_0031579_2186_2731 181
442 3300046491 Ga0495584_0000044 Ga0495584_0000044_80314_80862 181
443 3300046491 Ga0495584_0374165 Ga0495584_0374165_14_559 181
444 3300046492 Ga0495585_0195685 Ga0495585_0195685_212_757 181
445 3300046492 Ga0495585_0341107 Ga0495585_0341107_51_626 181
446 3300046500 Ga0495596_0031390 Ga0495596_0031390_236_781 181
447 3300046506 Ga0495583_0000078 Ga0495583_0000078_167742_168287 181
448 3300046506 Ga0495583_0004535 Ga0495583_0004535_8551_9096 181
449 3300046506 Ga0495583_0009898 Ga0495583_0009898_4982_5527 181
450 3300046507 Ga0495606_0012747 Ga0495606_0012747_5773_6321 181
451 3300046507 Ga0495606_0029483 Ga0495606_0029483_949_1503 181
452 3300046507 Ga0495606_0031841 Ga0495606_0031841_3005_3580 181
453 3300046507 Ga0495606_0101834 Ga0495606_0101834_171_719 181
454 3300046512 Ga0495610_0000817 Ga0495610_0000817_3699_4244 181
455 3300046512 Ga0495610_0005757 Ga0495610_0005757_3977_4522 181
456 3300046513 Ga0495616_0025438 Ga0495616_0025438_731_1276 181
457 3300046514 Ga0495618_0029626 Ga0495618_0029626_1756_2301 181
458 3300046515 Ga0495620_0243148 Ga0495620_0243148_102_647 181
459 3300046516 Ga0495628_0122219 Ga0495628_0122219_255_800 181
460 3300046516 Ga0495628_0126087 Ga0495628_0126087_544_1089 181
461 3300046517 Ga0495630_0037973 Ga0495630_0037973_2089_2634 181
462 3300046517 Ga0495630_0120724 Ga0495630_0120724_1262_1807 181
463 3300046522 Ga0495643_0128984 Ga0495643_0128984_179_733 181
464 3300046524 Ga0495648_0007550 Ga0495648_0007550_6433_6981 181
465 3300046524 Ga0495648_0038936 Ga0495648_0038936_971_1516 181
466 3300046524 Ga0495648_0103768 Ga0495648_0103768_924_1469 181
467 3300046526 Ga0495666_0072511 Ga0495666_0072511_21_566 181
468 3300046526 Ga0495666_0095592 Ga0495666_0095592_257_802 181
469 3300046526 Ga0495666_0141488 Ga0495666_0141488_519_1064 181
470 3300046531 Ga0495665_0094787 Ga0495665_0094787_648_1193 181
471 3300046537 Ga0495598_0122468 Ga0495598_0122468_175_723 181
472 3300046538 Ga0495609_0007383 Ga0495609_0007383_3607_4164 181
473 3300046542 Ga0495597_0046937 Ga0495597_0046937_1002_1556 181
474 3300046543 Ga0495645_0060195 Ga0495645_0060195_1824_2369 181
475 3300046543 Ga0495645_0106697 Ga0495645_0106697_867_1412 181
476 3300046557 Ga0495622_0032041 Ga0495622_0032041_769_1314 181
477 3300046557 Ga0495622_0060832 Ga0495622_0060832_1152_1697 181
478 3300046557 Ga0495622_0133632 Ga0495622_0133632_268_816 181
479 3300046558 Ga0495633_0044642 Ga0495633_0044642_1166_1714 181
480 3300046615 Ga0495656_0249118 Ga0495656_0249118_235_780 181
481 3300046616 Ga0495668_0010203 Ga0495668_0010203_2440_2988 181
482 3300046648 Ga0495611_0136681 Ga0495611_0136681_479_1024 181
483 3300046660 Ga0495625_0042718 Ga0495625_0042718_877_1425 181
484 3300046660 Ga0495625_0070500 Ga0495625_0070500_686_1231 181
485 3300046660 Ga0495625_0096783 Ga0495625_0096783_596_1144 181
486 3300046660 Ga0495625_0172748 Ga0495625_0172748_333_878 181
487 3300046663 Ga0495635_0147920 Ga0495635_0147920_761_1306 181
488 3300046664 Ga0495659_0008738 Ga0495659_0008738_2105_2653 181
489 3300046665 Ga0495661_0002353 Ga0495661_0002353_210_758 181
490 3300046665 Ga0495661_0243404 Ga0495661_0243404_38_583 181
491 3300046674 Ga0495588_0162257 Ga0495588_0162257_424_969 181
492 3300046679 Ga0495623_0045465 Ga0495623_0045465_1888_2433 181
493 3300046679 Ga0495623_0060007 Ga0495623_0060007_1309_1854 181
494 3300046679 Ga0495623_0211647 Ga0495623_0211647_271_816 181
495 3300046689 Ga0495613_0717453 Ga0495613_0717453_62_607 181
496 3300046690 Ga0495624_0011981 Ga0495624_0011981_1263_1808 181
497 3300046690 Ga0495624_0092045 Ga0495624_0092045_824_1369 181
498 3300046690 Ga0495624_0186190 Ga0495624_0186190_530_1075 181
499 3300046692 Ga0495671_0005615 Ga0495671_0005615_6530_7105 181
500 3300046692 Ga0495671_0076163 Ga0495671_0076163_605_1150 181
501 3300046692 Ga0495671_0390541 Ga0495671_0390541_33_578 181
502 3300046694 Ga0495649_0010113 Ga0495649_0010113_4068_4613 181
503 3300046794 Ga0495589_0121557 Ga0495589_0121557_320_865 181
504 3300046810 Ga0495660_0124384 Ga0495660_0124384_64_609 181
505 3300047317 Ga0495604_0141989 Ga0495604_0141989_216_761 181
506 3300047317 Ga0495604_0165120 Ga0495604_0165120_400_945 181
507 3300047318 Ga0495636_0331509 Ga0495636_0331509_121_669 181
508 3300047319 Ga0495674_0004450 Ga0495674_0004450_1877_2422 181
509 3300047319 Ga0495674_0007013 Ga0495674_0007013_6767_7312 181
510 3300047319 Ga0495674_0012300 Ga0495674_0012300_2268_2816 181
511 3300047319 Ga0495674_0016409 Ga0495674_0016409_4391_4936 181
512 3300047319 Ga0495674_0027469 Ga0495674_0027469_713_1258 181
513 3300047319 Ga0495674_0037502 Ga0495674_0037502_485_1030 181
514 3300047319 Ga0495674_0063791 Ga0495674_0063791_1727_2272 181
515 3300047319 Ga0495674_0081827 Ga0495674_0081827_1991_2536 181
516 3300047319 Ga0495674_0379936 Ga0495674_0379936_385_930 181
517 3300047320 Ga0495672_0079207 Ga0495672_0079207_39_584 181
518 3300047320 Ga0495672_0089869 Ga0495672_0089869_750_1295 181
519 3300047321 Ga0495676_0025546 Ga0495676_0025546_952_1497 181
520 3300047321 Ga0495676_0026568 Ga0495676_0026568_1044_1589 181
521 3300047321 Ga0495676_0038841 Ga0495676_0038841_3172_3717 181
522 3300047321 Ga0495676_0088730 Ga0495676_0088730_1165_1713 181
523 3300047321 Ga0495676_0104440 Ga0495676_0104440_843_1388 181
524 3300047321 Ga0495676_0124251 Ga0495676_0124251_761_1306 181
525 3300047322 Ga0495680_0131891 Ga0495680_0131891_1251_1796 181
526 3300047323 Ga0495683_0001084 Ga0495683_0001084_1404_1958 181
527 3300047323 Ga0495683_0005347 Ga0495683_0005347_1090_1635 181
528 3300047323 Ga0495683_0023141 Ga0495683_0023141_1708_2253 181
529 3300047443 Ga0495687_005866 Ga0495687_005866_1659_2204 181
530 3300047443 Ga0495687_012669 Ga0495687_012669_2039_2584 181
531 3300047446 Ga0495679_000641 Ga0495679_000641_3989_4534 181
532 3300047446 Ga0495679_000641 Ga0495679_000641_9367_9912 181
533 3300047469 Ga0495673_0009886 Ga0495673_0009886_3287_3832 181
534 3300047469 Ga0495673_0019803 Ga0495673_0019803_1878_2423 181
535 3300047471 Ga0495684_0646667 Ga0495684_0646667_54_653 181
536 3300047472 Ga0495686_0214228 Ga0495686_0214228_72_617 181
537 3300047673 Ga0495593_0038558 Ga0495593_0038558_1920_2465 181
538 3300047673 Ga0495593_0183539 Ga0495593_0183539_52_597 181
539 3300047673 Ga0495593_0449942 Ga0495593_0449942_53_598 181
540 3300048088 Ga0495602_0008361 Ga0495602_0008361_6580_7125 181
541 3300048088 Ga0495602_0065291 Ga0495602_0065291_1028_1573 181
542 3300048088 Ga0495602_0190994 Ga0495602_0190994_74_619 181
543 3300048089 Ga0495614_0048179 Ga0495614_0048179_62_607 181
544 3300048089 Ga0495614_0052367 Ga0495614_0052367_749_1294 181
545 3300048091 Ga0495626_0003399 Ga0495626_0003399_7197_7742 181
546 3300048091 Ga0495626_0029777 Ga0495626_0029777_233_778 181
547 3300048091 Ga0495626_0051845 Ga0495626_0051845_1250_1795 181
548 3300048091 Ga0495626_0313084 Ga0495626_0313084_38_592 181
549 3300048903 Ga0496100_0000408 Ga0496100_0000408_16095_16643 181
550 3300048904 Ga0496101_0000741 Ga0496101_0000741_14542_15090 181
551 3300048904 Ga0496101_0025872 Ga0496101_0025872_1018_1563 181
552 3300048905 Ga0496102_0000675 Ga0496102_0000675_19078_19626 181
553 3300048905 Ga0496102_0134510 Ga0496102_0134510_138_686 181
554 3300048905 Ga0496102_0451998 Ga0496102_0451998_161_706 181
555 3300048906 Ga0496103_0001501 Ga0496103_0001501_14449_14997 181
556 3300048906 Ga0496103_0216957 Ga0496103_0216957_303_848 181
557 3300048907 Ga0496104_0006567 Ga0496104_0006567_3806_4354 181
558 3300048907 Ga0496104_0201526 Ga0496104_0201526_779_1324 181
559 3300048907 Ga0496104_1018406 Ga0496104_1018406_51_596 181
560 3300048907 Ga0496104_1314280 Ga0496104_1314280_70_615 181
561 3300048908 Ga0496105_0021121 Ga0496105_0021121_3347_3892 181
562 3300048908 Ga0496105_0032526 Ga0496105_0032526_696_1244 181
563 3300048908 Ga0496105_0187145 Ga0496105_0187145_307_852 181
564 3300048909 Ga0496106_0000079 Ga0496106_0000079_18519_19067 181
565 3300048909 Ga0496106_0031611 Ga0496106_0031611_3242_3790 181
566 3300048910 Ga0496107_0077442 Ga0496107_0077442_1739_2287 181
567 3300048911 Ga0496108_0536459 Ga0496108_0536459_417_962 181
568 3300048911 Ga0496108_0728525 Ga0496108_0728525_35_592 181
569 3300048912 Ga0496109_0157851 Ga0496109_0157851_130_675 181
570 3300048912 Ga0496109_0273698 Ga0496109_0273698_251_796 181
571 3300048912 Ga0496109_1358039 Ga0496109_1358039_30_587 181
572 3300048915 Ga0496112_0107647 Ga0496112_0107647_2117_2662 181
573 3300048915 Ga0496112_0118854 Ga0496112_0118854_1584_2129 181
574 3300048915 Ga0496112_0138942 Ga0496112_0138942_431_976 181
575 3300048915 Ga0496112_0771072 Ga0496112_0771072_60_608 181
576 3300048915 Ga0496112_0966378 Ga0496112_0966378_87_632 181
577 3300048916 Ga0496113_0044934 Ga0496113_0044934_2159_2704 181
578 3300048916 Ga0496113_0150045 Ga0496113_0150045_671_1216 181
579 3300048917 Ga0496114_0529773 Ga0496114_0529773_458_1006 181
580 3300048918 Ga0496115_0261851 Ga0496115_0261851_99_644 181
581 3300048919 Ga0496116_0031713 Ga0496116_0031713_154_702 181
582 3300048920 Ga0496117_0001301 Ga0496117_0001301_21638_22186 181
583 3300048920 Ga0496117_0045486 Ga0496117_0045486_908_1453 181
584 3300048920 Ga0496117_0133549 Ga0496117_0133549_907_1452 181
585 3300048920 Ga0496117_0237154 Ga0496117_0237154_56_601 181
586 3300048921 Ga0496118_0001539 Ga0496118_0001539_19063_19611 181
587 3300048921 Ga0496118_0037057 Ga0496118_0037057_1681_2226 181
588 3300048921 Ga0496118_0041020 Ga0496118_0041020_1437_1982 181
589 3300048921 Ga0496118_0393329 Ga0496118_0393329_99_647 181
590 3300048922 Ga0496119_0061947 Ga0496119_0061947_1384_1941 181
591 3300048923 Ga0496120_0121050 Ga0496120_0121050_693_1250 181
592 3300048923 Ga0496120_0183212 Ga0496120_0183212_410_958 181
593 3300048924 Ga0496121_0000993 Ga0496121_0000993_48902_49450 181
594 3300048924 Ga0496121_0019038 Ga0496121_0019038_4183_4728 181
595 3300048924 Ga0496121_0050303 Ga0496121_0050303_1182_1727 181
596 3300048924 Ga0496121_0175450 Ga0496121_0175450_635_1180 181
597 3300048924 Ga0496121_0190062 Ga0496121_0190062_312_857 181
598 3300048924 Ga0496121_0449448 Ga0496121_0449448_184_729 181
599 3300048927 Ga0496124_0129939 Ga0496124_0129939_962_1510 181
600 3300048927 Ga0496124_0385582 Ga0496124_0385582_381_938 181
601 3300048927 Ga0496124_0566637 Ga0496124_0566637_171_719 181
602 3300048929 Ga0496126_0000271 Ga0496126_0000271_53537_54082 181
603 3300049460 Ga0495682_0000114 Ga0495682_0000114_64898_65443 181
604 3300049460 Ga0495682_0007721 Ga0495682_0007721_3490_4035 181
605 3300049569 Ga0501032_0248217 Ga0501032_0248217_511_1113 181
606 3300049570 Ga0501033_0039676 Ga0501033_0039676_157_702 181
607 3300049570 Ga0501033_0075737 Ga0501033_0075737_592_1164 181
608 3300049572 Ga0501036_0478272 Ga0501036_0478272_414_986 181
609 3300049573 Ga0501037_0056658 Ga0501037_0056658_1685_2257 181
610 3300049574 Ga0501038_0047009 Ga0501038_0047009_2088_2639 181
611 3300049579 Ga0501043_0128792 Ga0501043_0128792_336_908 181
612 3300049579 Ga0501043_0217263 Ga0501043_0217263_573_1154 181
613 3300049580 Ga0501046_0363554 Ga0501046_0363554_180_752 181
614 3300049581 Ga0501047_0012459 Ga0501047_0012459_1811_2383 181
615 3300049581 Ga0501047_0015628 Ga0501047_0015628_1734_2279 181
616 3300049584 Ga0501068_0082913 Ga0501068_0082913_874_1446 181
617 3300049585 Ga0501069_0087893 Ga0501069_0087893_1023_1595 181
618 3300049589 Ga0501073_0029768 Ga0501073_0029768_2522_3094 181
619 3300049741 Ga0501079_0457929 Ga0501079_0457929_373_954 181
620 3300049742 Ga0501080_0013131 Ga0501080_0013131_5121_5693 181
621 3300049742 Ga0501080_0548281 Ga0501080_0548281_57_638 181
622 3300049744 Ga0501083_0025446 Ga0501083_0025446_3226_3798 181
623 3300049744 Ga0501083_0496189 Ga0501083_0496189_200_745 181
624 3300049823 Ga0501044_0015752 Ga0501044_0015752_3288_3860 181
625 3300049823 Ga0501044_0057444 Ga0501044_0057444_1319_1900 181
626 3300049823 Ga0501044_0123376 Ga0501044_0123376_1883_2428 181
627 3300050516 nmdc:mga0sz30_10285_c1 nmdc:mga0sz30_10285_c1_324_869 181
628 3300053078 Ga0495612_0060077 Ga0495612_0060077_709_1254 181
629 3300053087 Ga0500643_000028 Ga0500643_000028_49626_50171 181
630 3300053094 Ga0500566_0000206 Ga0500566_0000206_10708_11256 181
631 3300053094 Ga0500566_0002818 Ga0500566_0002818_9666_10211 181
632 3300053103 Ga0500555_012708 Ga0500555_012708_1065_1610 181
633 3300053118 Ga0500594_0119107 Ga0500594_0119107_11_559 181
634 3300053123 Ga0500614_139634 Ga0500614_139634_149_694 181
635 3300053139 Ga0500568_0000447 Ga0500568_0000447_24005_24550 181
636 3300053153 Ga0500616_0000231 Ga0500616_0000231_22227_22772 181
637 3300053153 Ga0500616_0098180 Ga0500616_0098180_753_1298 181
638 3300053153 Ga0500616_0106466 Ga0500616_0106466_316_861 181
639 3300053160 Ga0500633_0000284 Ga0500633_0000284_1700_2245 181
640 3300053739 Ga0500587_012891 Ga0500587_012891_494_1039 181
641 3300059504 Ga0587082_039186 Ga0587082_039186_260_805 181
642 3300060353 Ga0501082_0154969 Ga0501082_0154969_874_1446 181
643 iso_pu_bacteria 2834641062 2834643615 181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

53

136

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6e8l-assembly3.cif.gz_F crystal structure of alkyl hydroperoxidase d (ahpd) from streptococcus pneumoniae (strain d39/ nctc 7466) 0.9276 1 171
3lvy-assembly3.cif.gz_E crystal structure of carboxymuconolactone decarboxylase family protein smu.961 from streptococcus mutans 0.9274 5 173
3lvy-assembly2.cif.gz_D crystal structure of carboxymuconolactone decarboxylase family protein smu.961 from streptococcus mutans 0.9266 2 171
3lvy-assembly3.cif.gz_F crystal structure of carboxymuconolactone decarboxylase family protein smu.961 from streptococcus mutans 0.8996 2 180
2prr-assembly1.cif.gz_E crystal structure of alkylhydroperoxidase ahpd core: uncharacterized peroxidase-related protein (yp_296737.1) from ralstonia eutropha jmp134 at 2.15 a resolution 0.8984 2 171
ID Description Score Start End Superfamily
3lvyC01 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9113 13 171 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9027 39 167 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8872 39 173 1.20.1290.10
af_P76222_42_172_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8711 46 167 1.20.1290.10
3lvyC01 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8603 13 171 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A5C7NAQ8-F1-model_v4 deleted 0.9862 1 154
AF-A0A534CNV7-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9745 93 178
AF-A0A5C7NAQ8-F1-model_v4 deleted 0.9737 1 154
AF-B8IVV6-F1-model_v4 Alkylhydroperoxidase-like protein, AhpD family 0.9729 1 171 GO:0051920
AF-A0A2W6F7C0-F1-model_v4 Peroxidase 0.9713 34 176 GO:0051920

Feature Viewer

pLDDT pTM Quality
93.2 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map