F471969
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 643 | 305 | 640 | 567 |
Family's Representative Sequence
| Representative Sequence | 3300039438|Ga0436360_0711520|Ga0436360_0711520_768_2843 |
| Length | 669 |
| Sequence | MKWRRRPGPAGRTGSSPKRPSDGSYREESLASGVGTLDAMAHVRVAACQINTVVGDLEGNATRILDAAAGAARAGADLAIFPELAVTGYPPEDLLERPAFVADNRVVFERLAQATGECAVAFGYVGVDASGRLTNSAALCARGQVVADYAKRMLPNYGVFDERRWFAPGEAPAMPVVVAGVPIGLTICEDMWFAEGPMQEEARAGARLLVNLNASPYSRGRRLERLTVLRERAAETGCAIAYVNQVGGQDELVFDGASMVVGADGELLAEAPQFAEAMLLYDLEVADGRAESVVAEAGGAVDSPSLIAVVSHASRSSETGVRVGHDATVVRGRAEPLSECAEVYEALVLGTRDYVGKNGFTDVVVGLSGGIDSSLVVTVAVDALGPEHVHGVAMPSRYSSEGSIDDARLLGDNLGIDLAAVPIEPVHGAFASSLAPLLGADPAGLTDENLQSRIRGVLLMALSNARGWLVLTTGNKSEMATGYSTLYGDSAGGFAVIKDVPKTLVYELCRYRNARAGRPLIPDAVLVKAPSAELRPEQRDEDSLPPYSELDPIVAGYVEGDRSAADLVAEGFHPATVARVVALVDRAEYKRRQMPPGVRISGKAFGKDRRMPITNHYEGLSEGAGAPDGRSEAATADSHRPGLSADEGAIGVKGVSSLRAAEGEASAVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 2 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 3 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 65 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 66 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 67 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 166 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 167 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 168 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 173 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 175 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 176 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 178 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 181 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 184 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 186 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 187 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 188 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 189 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 190 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 191 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 194 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 195 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 196 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 198 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 199 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 200 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 201 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 202 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 203 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 204 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 205 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 206 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 207 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 208 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 209 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 210 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 211 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 229 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 230 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 231 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 232 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 233 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 234 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 237 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 238 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 239 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 240 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 241 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 242 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 243 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 244 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 245 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 246 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 247 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 248 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 282 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 283 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 284 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 285 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 286 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 287 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 288 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 298 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 301 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 302 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 303 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.53 |
| Metatranscriptomes | 0 |
| Isolates | 0.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.51 |
| Nodule | 0 |
| Rhizoplane | 5.6 |
| Rhizosphere | 87.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10021445 | 3300003203 | Bacteria | 2593 |
| 2 | Ga0070676_10006175 | 3300005328 | Bacteria | 6395 |
| 3 | Ga0070683_100033173 | 3300005329 | Bacteria | 4706 |
| 4 | Ga0070683_100070013 | 3300005329 | Bacteria | 3272 |
| 5 | Ga0070690_100000305 | 3300005330 | Bacteria | 25337 |
| 6 | Ga0070690_100002234 | 3300005330 | Bacteria | 10375 |
| 7 | Ga0070690_100002631 | 3300005330 | Bacteria | 9671 |
| 8 | Ga0070670_100005213 | 3300005331 | Bacteria | 10942 |
| 9 | Ga0070670_100006871 | 3300005331 | Bacteria | 9641 |
| 10 | Ga0070677_10003228 | 3300005333 | Bacteria | 5248 |
| 11 | Ga0070666_10003792 | 3300005335 | Bacteria | 9165 |
| 12 | Ga0070680_100001202 | 3300005336 | Bacteria | 18677 |
| 13 | Ga0070680_100008822 | 3300005336 | Bacteria | 7732 |
| 14 | Ga0070680_100100415 | 3300005336 | Bacteria | 2402 |
| 15 | Ga0068868_100011537 | 3300005338 | Bacteria | 6436 |
| 16 | Ga0068868_100020604 | 3300005338 | Bacteria | 4958 |
| 17 | Ga0068868_100088288 | 3300005338 | Bacteria | 2495 |
| 18 | Ga0070689_100000158 | 3300005340 | Bacteria | 39830 |
| 19 | Ga0070689_100013395 | 3300005340 | Bacteria | 5932 |
| 20 | Ga0070689_100082042 | 3300005340 | Bacteria | 2532 |
| 21 | Ga0070687_100002317 | 3300005343 | Bacteria | 7082 |
| 22 | Ga0070692_10010491 | 3300005345 | Bacteria | 4218 |
| 23 | Ga0070668_100005046 | 3300005347 | Bacteria | 9774 |
| 24 | Ga0070668_100142192 | 3300005347 | Bacteria | 1934 |
| 25 | Ga0070669_100016569 | 3300005353 | Bacteria | 5260 |
| 26 | Ga0070675_100000972 | 3300005354 | Bacteria | 20492 |
| 27 | Ga0070675_100002574 | 3300005354 | Bacteria | 13590 |
| 28 | Ga0070675_100004249 | 3300005354 | Bacteria | 10904 |
| 29 | Ga0070671_100003350 | 3300005355 | Bacteria | 12499 |
| 30 | Ga0070671_100009254 | 3300005355 | Bacteria | 7913 |
| 31 | Ga0070674_100000802 | 3300005356 | Bacteria | 16179 |
| 32 | Ga0070674_100000865 | 3300005356 | Bacteria | 15742 |
| 33 | Ga0070673_100000143 | 3300005364 | Bacteria | 33944 |
| 34 | Ga0070673_100019731 | 3300005364 | Bacteria | 4845 |
| 35 | Ga0070673_100138022 | 3300005364 | Bacteria | 2054 |
| 36 | Ga0070688_100003566 | 3300005365 | Bacteria | 8021 |
| 37 | Ga0070688_100006698 | 3300005365 | Bacteria | 6174 |
| 38 | Ga0070659_100034509 | 3300005366 | Bacteria | 3935 |
| 39 | Ga0070667_100003919 | 3300005367 | Bacteria | 12641 |
| 40 | Ga0070667_100006723 | 3300005367 | Bacteria | 9554 |
| 41 | Ga0070667_100008294 | 3300005367 | Bacteria | 8610 |
| 42 | Ga0070713_100002374 | 3300005436 | Bacteria | 12270 |
| 43 | Ga0070710_10020150 | 3300005437 | Bacteria | 3456 |
| 44 | Ga0070701_10000814 | 3300005438 | Bacteria | 11137 |
| 45 | Ga0070701_10001128 | 3300005438 | Bacteria | 9766 |
| 46 | Ga0070711_100059029 | 3300005439 | Bacteria | 2662 |
| 47 | Ga0070705_100020583 | 3300005440 | Bacteria | 3495 |
| 48 | Ga0070700_100004262 | 3300005441 | Bacteria | 7467 |
| 49 | Ga0070700_100007622 | 3300005441 | Bacteria | 5856 |
| 50 | Ga0070694_100000606 | 3300005444 | Bacteria | 19752 |
| 51 | Ga0070694_100033217 | 3300005444 | Bacteria | 3393 |
| 52 | Ga0070694_100050542 | 3300005444 | Bacteria | 2803 |
| 53 | Ga0070708_100000766 | 3300005445 | Bacteria | 24179 |
| 54 | Ga0070663_100003515 | 3300005455 | Bacteria | 9048 |
| 55 | Ga0070678_100000378 | 3300005456 | Bacteria | 20834 |
| 56 | Ga0070678_100144684 | 3300005456 | Bacteria | 1907 |
| 57 | Ga0070662_100027455 | 3300005457 | Bacteria | 3951 |
| 58 | Ga0070662_100102847 | 3300005457 | Bacteria | 2165 |
| 59 | Ga0070681_10021331 | 3300005458 | Bacteria | 6494 |
| 60 | Ga0068867_100002418 | 3300005459 | Bacteria | 13127 |
| 61 | Ga0068867_100043609 | 3300005459 | Bacteria | 3284 |
| 62 | Ga0070685_10000304 | 3300005466 | Bacteria | 30868 |
| 63 | Ga0070706_100053398 | 3300005467 | Bacteria | 3730 |
| 64 | Ga0070706_100069209 | 3300005467 | Bacteria | 3264 |
| 65 | Ga0070706_100110745 | 3300005467 | Bacteria | 2555 |
| 66 | Ga0070707_100004903 | 3300005468 | Bacteria | 12542 |
| 67 | Ga0070707_100036153 | 3300005468 | Bacteria | 4713 |
| 68 | Ga0070698_100023799 | 3300005471 | Bacteria | 6396 |
| 69 | Ga0070698_100101129 | 3300005471 | Bacteria | 2854 |
| 70 | Ga0070699_100015977 | 3300005518 | Bacteria | 6445 |
| 71 | Ga0070699_100070280 | 3300005518 | Bacteria | 3043 |
| 72 | Ga0070679_100013601 | 3300005530 | Bacteria | 7796 |
| 73 | Ga0070679_100062244 | 3300005530 | Bacteria | 3720 |
| 74 | Ga0070697_100019654 | 3300005536 | Bacteria | 5335 |
| 75 | Ga0070672_100000197 | 3300005543 | Bacteria | 33442 |
| 76 | Ga0070672_100093007 | 3300005543 | Bacteria | 2435 |
| 77 | Ga0070686_100001064 | 3300005544 | Bacteria | 15834 |
| 78 | Ga0070686_100005443 | 3300005544 | Bacteria | 7048 |
| 79 | Ga0070695_100011036 | 3300005545 | Bacteria | 5401 |
| 80 | Ga0070695_100024880 | 3300005545 | Bacteria | 3692 |
| 81 | Ga0070695_100029601 | 3300005545 | Bacteria | 3402 |
| 82 | Ga0070696_100024483 | 3300005546 | Bacteria | 4104 |
| 83 | Ga0070693_100041862 | 3300005547 | Bacteria | 2579 |
| 84 | Ga0070665_100001080 | 3300005548 | Bacteria | 33916 |
| 85 | Ga0070665_100010272 | 3300005548 | Bacteria | 9472 |
| 86 | Ga0070665_100023373 | 3300005548 | Bacteria | 6223 |
| 87 | Ga0070665_100098839 | 3300005548 | Bacteria | 2923 |
| 88 | Ga0068855_100002418 | 3300005563 | Bacteria | 23041 |
| 89 | Ga0068855_100025043 | 3300005563 | Bacteria | 7142 |
| 90 | Ga0068855_100025777 | 3300005563 | Bacteria | 7031 |
| 91 | Ga0068855_100086919 | 3300005563 | Bacteria | 3614 |
| 92 | Ga0068855_100091367 | 3300005563 | Bacteria | 3511 |
| 93 | Ga0068855_100216079 | 3300005563 | Bacteria | 2152 |
| 94 | Ga0070664_100028557 | 3300005564 | Bacteria | 4642 |
| 95 | Ga0068857_100026351 | 3300005577 | Bacteria | 5124 |
| 96 | Ga0068859_100076500 | 3300005617 | Bacteria | 3388 |
| 97 | Ga0068864_100011866 | 3300005618 | Bacteria | 7196 |
| 98 | Ga0068861_100061520 | 3300005719 | Bacteria | 2882 |
| 99 | Ga0068861_100062254 | 3300005719 | Bacteria | 2866 |
| 100 | Ga0068851_10036920 | 3300005834 | Bacteria | 2449 |
| 101 | Ga0068860_100053803 | 3300005843 | Bacteria | 3827 |
| 102 | Ga0068862_100123964 | 3300005844 | Bacteria | 2280 |
| 103 | Ga0081455_10018220 | 3300005937 | Bacteria | 6701 |
| 104 | Ga0081538_10000006 | 3300005981 | Bacteria | 181056 |
| 105 | Ga0081538_10000185 | 3300005981 | Bacteria | 68366 |
| 106 | Ga0081538_10000800 | 3300005981 | Bacteria | 34115 |
| 107 | Ga0081538_10001125 | 3300005981 | Bacteria | 28308 |
| 108 | Ga0081538_10007201 | 3300005981 | Bacteria | 9656 |
| 109 | Ga0081538_10013275 | 3300005981 | Bacteria | 6532 |
| 110 | Ga0081538_10058015 | 3300005981 | Bacteria | 2249 |
| 111 | Ga0081540_1000159 | 3300005983 | Bacteria | 69507 |
| 112 | Ga0081539_10003739 | 3300005985 | Bacteria | 18101 |
| 113 | Ga0081539_10006735 | 3300005985 | Bacteria | 10812 |
| 114 | Ga0075365_10000424 | 3300006038 | Bacteria | 15614 |
| 115 | Ga0075363_100014971 | 3300006048 | Unclassified | 3803 |
| 116 | Ga0075364_10000724 | 3300006051 | Bacteria | 17261 |
| 117 | Ga0075364_10000955 | 3300006051 | Bacteria | 15254 |
| 118 | Ga0075364_10002607 | 3300006051 | Bacteria | 10119 |
| 119 | Ga0075364_10012861 | 3300006051 | Bacteria | 5133 |
| 120 | Ga0075364_10017851 | 3300006051 | Bacteria | 4437 |
| 121 | Ga0075364_10019874 | 3300006051 | Bacteria | 4222 |
| 122 | Ga0075364_10039651 | 3300006051 | Unclassified | 3054 |
| 123 | Ga0075432_10001488 | 3300006058 | Bacteria | 7647 |
| 124 | Ga0070712_100001607 | 3300006175 | Bacteria | 13809 |
| 125 | Ga0075362_10006533 | 3300006177 | Bacteria | 4354 |
| 126 | Ga0075367_10007323 | 3300006178 | Bacteria | 5643 |
| 127 | Ga0075369_10004307 | 3300006186 | Bacteria | 5244 |
| 128 | Ga0097621_100006479 | 3300006237 | Bacteria | 8314 |
| 129 | Ga0075370_10000205 | 3300006353 | Bacteria | 20906 |
| 130 | Ga0068871_100003744 | 3300006358 | Bacteria | 10468 |
| 131 | Ga0068871_100098676 | 3300006358 | Bacteria | 2444 |
| 132 | Ga0075428_100000538 | 3300006844 | Bacteria | 38617 |
| 133 | Ga0075428_100003176 | 3300006844 | Bacteria | 17959 |
| 134 | Ga0075428_100004141 | 3300006844 | Bacteria | 15964 |
| 135 | Ga0075428_100007682 | 3300006844 | Bacteria | 11953 |
| 136 | Ga0075430_100000022 | 3300006846 | Bacteria | 81752 |
| 137 | Ga0075430_100000126 | 3300006846 | Bacteria | 48056 |
| 138 | Ga0075430_100014570 | 3300006846 | Bacteria | 6698 |
| 139 | Ga0075430_100033898 | 3300006846 | Bacteria | 4334 |
| 140 | Ga0075430_100043207 | 3300006846 | Bacteria | 3809 |
| 141 | Ga0075431_100000203 | 3300006847 | Bacteria | 43754 |
| 142 | Ga0075431_100017262 | 3300006847 | Bacteria | 7334 |
| 143 | Ga0075431_100027664 | 3300006847 | Bacteria | 5819 |
| 144 | Ga0075431_100037642 | 3300006847 | Unclassified | 4982 |
| 145 | Ga0075431_100062606 | 3300006847 | Bacteria | 3838 |
| 146 | Ga0075431_100070259 | 3300006847 | Bacteria | 3612 |
| 147 | Ga0075431_100112489 | 3300006847 | Bacteria | 2810 |
| 148 | Ga0075431_100118930 | 3300006847 | Bacteria | 2726 |
| 149 | Ga0075433_10000055 | 3300006852 | Bacteria | 48950 |
| 150 | Ga0075433_10000868 | 3300006852 | Bacteria | 21168 |
| 151 | Ga0075433_10022968 | 3300006852 | Bacteria | 5244 |
| 152 | Ga0075433_10024377 | 3300006852 | Bacteria | 5104 |
| 153 | Ga0075434_100006129 | 3300006871 | Bacteria | 11010 |
| 154 | Ga0075434_100019970 | 3300006871 | Bacteria | 6489 |
| 155 | Ga0075434_100036459 | 3300006871 | Bacteria | 4865 |
| 156 | Ga0075429_100000069 | 3300006880 | Bacteria | 51472 |
| 157 | Ga0075429_100002699 | 3300006880 | Bacteria | 14957 |
| 158 | Ga0075429_100019577 | 3300006880 | Bacteria | 5866 |
| 159 | Ga0075429_100021045 | 3300006880 | Bacteria | 5660 |
| 160 | Ga0068865_100023984 | 3300006881 | Bacteria | 3999 |
| 161 | Ga0068865_100126864 | 3300006881 | Bacteria | 1906 |
| 162 | Ga0097620_100076502 | 3300006931 | Bacteria | 3388 |
| 163 | Ga0075435_100013974 | 3300007076 | Bacteria | 5987 |
| 164 | Ga0075435_100026214 | 3300007076 | Bacteria | 4545 |
| 165 | Ga0099794_10001536 | 3300007265 | Bacteria | 8126 |
| 166 | Ga0105240_10001845 | 3300009093 | Bacteria | 35484 |
| 167 | Ga0105240_10062437 | 3300009093 | Bacteria | 4638 |
| 168 | Ga0105240_10090674 | 3300009093 | Bacteria | 3735 |
| 169 | Ga0111539_10000081 | 3300009094 | Bacteria | 97006 |
| 170 | Ga0111539_10000274 | 3300009094 | Bacteria | 61652 |
| 171 | Ga0111539_10016794 | 3300009094 | Bacteria | 9067 |
| 172 | Ga0111539_10018478 | 3300009094 | Bacteria | 8635 |
| 173 | Ga0111539_10032707 | 3300009094 | Bacteria | 6316 |
| 174 | Ga0111539_10136005 | 3300009094 | Bacteria | 2878 |
| 175 | Ga0105245_10004403 | 3300009098 | Bacteria | 12457 |
| 176 | Ga0105247_10000278 | 3300009101 | Bacteria | 47180 |
| 177 | Ga0114129_10000830 | 3300009147 | Bacteria | 39917 |
| 178 | Ga0114129_10044693 | 3300009147 | Bacteria | 6231 |
| 179 | Ga0114129_10065170 | 3300009147 | Bacteria | 5085 |
| 180 | Ga0114129_10065834 | 3300009147 | Bacteria | 5056 |
| 181 | Ga0105243_10002135 | 3300009148 | Bacteria | 16720 |
| 182 | Ga0105242_10000479 | 3300009176 | Bacteria | 31794 |
| 183 | Ga0105242_10000921 | 3300009176 | Bacteria | 22877 |
| 184 | Ga0105242_10048633 | 3300009176 | Bacteria | 3447 |
| 185 | Ga0105248_10005285 | 3300009177 | Bacteria | 14208 |
| 186 | Ga0105237_10004164 | 3300009545 | Bacteria | 16839 |
| 187 | Ga0105238_10144229 | 3300009551 | Bacteria | 2358 |
| 188 | Ga0105249_10019551 | 3300009553 | Bacteria | 6044 |
| 189 | Ga0105249_10023725 | 3300009553 | Bacteria | 5508 |
| 190 | Ga0105249_10025298 | 3300009553 | Bacteria | 5343 |
| 191 | Ga0105239_10017132 | 3300010375 | Bacteria | 8010 |
| 192 | Ga0105239_10100730 | 3300010375 | Bacteria | 3195 |
| 193 | Ga0105239_10114714 | 3300010375 | Bacteria | 2988 |
| 194 | Ga0105239_10185349 | 3300010375 | Bacteria | 2329 |
| 195 | Ga0105246_10000806 | 3300011119 | Bacteria | 17816 |
| 196 | Ga0157369_10002658 | 3300013105 | Bacteria | 21335 |
| 197 | Ga0157374_10076801 | 3300013296 | Bacteria | 3158 |
| 198 | Ga0157378_10000610 | 3300013297 | Bacteria | 33628 |
| 199 | Ga0157378_10003105 | 3300013297 | Bacteria | 14767 |
| 200 | Ga0163162_10010688 | 3300013306 | Bacteria | 8928 |
| 201 | Ga0157375_10028173 | 3300013308 | Bacteria | 5261 |
| 202 | Ga0163163_10004489 | 3300014325 | Bacteria | 11909 |
| 203 | Ga0163163_10064218 | 3300014325 | Bacteria | 3642 |
| 204 | Ga0163163_10225399 | 3300014325 | Bacteria | 1923 |
| 205 | Ga0157380_10007013 | 3300014326 | Bacteria | 7975 |
| 206 | Ga0157377_10013662 | 3300014745 | Bacteria | 4115 |
| 207 | Ga0157377_10013792 | 3300014745 | Bacteria | 4097 |
| 208 | Ga0157376_10011158 | 3300014969 | Bacteria | 6610 |
| 209 | Ga0157376_10013961 | 3300014969 | Bacteria | 6009 |
| 210 | Ga0207710_10000502 | 3300025900 | Bacteria | 24324 |
| 211 | Ga0207688_10005394 | 3300025901 | Bacteria | 6950 |
| 212 | Ga0207680_10041826 | 3300025903 | Bacteria | 2677 |
| 213 | Ga0207647_10006961 | 3300025904 | Bacteria | 8195 |
| 214 | Ga0207645_10000134 | 3300025907 | Bacteria | 56602 |
| 215 | Ga0207645_10033284 | 3300025907 | Bacteria | 3313 |
| 216 | Ga0207643_10029813 | 3300025908 | Bacteria | 3035 |
| 217 | Ga0207684_10001278 | 3300025910 | Bacteria | 27767 |
| 218 | Ga0207684_10011397 | 3300025910 | Bacteria | 7779 |
| 219 | Ga0207707_10053735 | 3300025912 | Bacteria | 3507 |
| 220 | Ga0207695_10012561 | 3300025913 | Bacteria | 10151 |
| 221 | Ga0207695_10018267 | 3300025913 | Bacteria | 8115 |
| 222 | Ga0207695_10019085 | 3300025913 | Bacteria | 7908 |
| 223 | Ga0207695_10029271 | 3300025913 | Bacteria | 6091 |
| 224 | Ga0207695_10127629 | 3300025913 | Bacteria | 2504 |
| 225 | Ga0207671_10002923 | 3300025914 | Bacteria | 17607 |
| 226 | Ga0207662_10002099 | 3300025918 | Bacteria | 9900 |
| 227 | Ga0207657_10012644 | 3300025919 | Bacteria | 8320 |
| 228 | Ga0207652_10000867 | 3300025921 | Bacteria | 28615 |
| 229 | Ga0207652_10146131 | 3300025921 | Bacteria | 2116 |
| 230 | Ga0207646_10000311 | 3300025922 | Bacteria | 66146 |
| 231 | Ga0207646_10165281 | 3300025922 | Bacteria | 1998 |
| 232 | Ga0207681_10004762 | 3300025923 | Bacteria | 8352 |
| 233 | Ga0207681_10010335 | 3300025923 | Bacteria | 5710 |
| 234 | Ga0207681_10104363 | 3300025923 | Bacteria | 2050 |
| 235 | Ga0207650_10031455 | 3300025925 | Bacteria | 3832 |
| 236 | Ga0207659_10002985 | 3300025926 | Bacteria | 10084 |
| 237 | Ga0207687_10009645 | 3300025927 | Bacteria | 6312 |
| 238 | Ga0207690_10070541 | 3300025932 | Bacteria | 2407 |
| 239 | Ga0207706_10000433 | 3300025933 | Bacteria | 44824 |
| 240 | Ga0207706_10014061 | 3300025933 | Bacteria | 7258 |
| 241 | Ga0207706_10030789 | 3300025933 | Bacteria | 4785 |
| 242 | Ga0207706_10090275 | 3300025933 | Bacteria | 2694 |
| 243 | Ga0207686_10002267 | 3300025934 | Bacteria | 10553 |
| 244 | Ga0207686_10016114 | 3300025934 | Bacteria | 4189 |
| 245 | Ga0207670_10000797 | 3300025936 | Bacteria | 16479 |
| 246 | Ga0207670_10034436 | 3300025936 | Bacteria | 3273 |
| 247 | Ga0207669_10005346 | 3300025937 | Bacteria | 5751 |
| 248 | Ga0207669_10017005 | 3300025937 | Bacteria | 3716 |
| 249 | Ga0207704_10011927 | 3300025938 | Bacteria | 4297 |
| 250 | Ga0207665_10018688 | 3300025939 | Bacteria | 4555 |
| 251 | Ga0207691_10000080 | 3300025940 | Bacteria | 82234 |
| 252 | Ga0207691_10002262 | 3300025940 | Bacteria | 18854 |
| 253 | Ga0207691_10154562 | 3300025940 | Bacteria | 2016 |
| 254 | Ga0207711_10023212 | 3300025941 | Bacteria | 5191 |
| 255 | Ga0207711_10033760 | 3300025941 | Bacteria | 4331 |
| 256 | Ga0207689_10004452 | 3300025942 | Bacteria | 12701 |
| 257 | Ga0207661_10062896 | 3300025944 | Bacteria | 3004 |
| 258 | Ga0207679_10000816 | 3300025945 | Bacteria | 20095 |
| 259 | Ga0207679_10003763 | 3300025945 | Bacteria | 9403 |
| 260 | Ga0207667_10008748 | 3300025949 | Bacteria | 12002 |
| 261 | Ga0207651_10000078 | 3300025960 | Bacteria | 44168 |
| 262 | Ga0207651_10015139 | 3300025960 | Bacteria | 4473 |
| 263 | Ga0207712_10010069 | 3300025961 | Bacteria | 5994 |
| 264 | Ga0207668_10101913 | 3300025972 | Bacteria | 2135 |
| 265 | Ga0207658_10007664 | 3300025986 | Bacteria | 7351 |
| 266 | Ga0207658_10018850 | 3300025986 | Bacteria | 4772 |
| 267 | Ga0207677_10025766 | 3300026023 | Bacteria | 3674 |
| 268 | Ga0207703_10016836 | 3300026035 | Bacteria | 5702 |
| 269 | Ga0207678_10001469 | 3300026067 | Bacteria | 21623 |
| 270 | Ga0207708_10000394 | 3300026075 | Bacteria | 34403 |
| 271 | Ga0207708_10002710 | 3300026075 | Bacteria | 13017 |
| 272 | Ga0207648_10000557 | 3300026089 | Bacteria | 41682 |
| 273 | Ga0207648_10011733 | 3300026089 | Bacteria | 8240 |
| 274 | Ga0207648_10067184 | 3300026089 | Bacteria | 3126 |
| 275 | Ga0207674_10037265 | 3300026116 | Bacteria | 5059 |
| 276 | Ga0207675_100126594 | 3300026118 | Bacteria | 2420 |
| 277 | Ga0207683_10000361 | 3300026121 | Bacteria | 41745 |
| 278 | Ga0207683_10047464 | 3300026121 | Bacteria | 3761 |
| 279 | Ga0209969_1000272 | 3300027360 | Bacteria | 6900 |
| 280 | Ga0209967_1000170 | 3300027364 | Bacteria | 9005 |
| 281 | Ga0209981_1000162 | 3300027378 | Bacteria | 8239 |
| 282 | Ga0209984_1000274 | 3300027424 | Bacteria | 5866 |
| 283 | Ga0210000_1000280 | 3300027462 | Bacteria | 7285 |
| 284 | Ga0209995_1000103 | 3300027471 | Bacteria | 13417 |
| 285 | Ga0209982_1000036 | 3300027552 | Bacteria | 12172 |
| 286 | Ga0210002_1000089 | 3300027617 | Bacteria | 14269 |
| 287 | Ga0209983_1000237 | 3300027665 | Bacteria | 11176 |
| 288 | Ga0209966_1000553 | 3300027695 | Bacteria | 9414 |
| 289 | Ga0209998_10000014 | 3300027717 | Bacteria | 91397 |
| 290 | Ga0207428_10000426 | 3300027907 | Bacteria | 52198 |
| 291 | Ga0207428_10002909 | 3300027907 | Bacteria | 16966 |
| 292 | Ga0207428_10010288 | 3300027907 | Bacteria | 8361 |
| 293 | Ga0207428_10021185 | 3300027907 | Bacteria | 5506 |
| 294 | Ga0207428_10053680 | 3300027907 | Bacteria | 3213 |
| 295 | Ga0268266_10000264 | 3300028379 | Bacteria | 88067 |
| 296 | Ga0268266_10004961 | 3300028379 | Bacteria | 12594 |
| 297 | Ga0268266_10037493 | 3300028379 | Bacteria | 4129 |
| 298 | Ga0268266_10038686 | 3300028379 | Bacteria | 4060 |
| 299 | Ga0268266_10092741 | 3300028379 | Bacteria | 2650 |
| 300 | Ga0268266_10094745 | 3300028379 | Bacteria | 2621 |
| 301 | Ga0268264_10110890 | 3300028381 | Bacteria | 2403 |
| 302 | Ga0268264_10161779 | 3300028381 | Bacteria | 2017 |
| 303 | Ga0265337_1000240 | 3300028556 | Bacteria | 29757 |
| 304 | Ga0265326_10000393 | 3300028558 | Bacteria | 17549 |
| 305 | Ga0265326_10000621 | 3300028558 | Bacteria | 13262 |
| 306 | Ga0265319_1005656 | 3300028563 | Bacteria | 5944 |
| 307 | Ga0265322_10000029 | 3300028654 | Bacteria | 82867 |
| 308 | Ga0265336_10000005 | 3300028666 | Bacteria | 399349 |
| 309 | Ga0265338_10000001 | 3300028800 | Bacteria | 1177449 |
| 310 | Ga0265324_10000423 | 3300029957 | Bacteria | 30311 |
| 311 | Ga0265324_10021184 | 3300029957 | Bacteria | 2332 |
| 312 | Ga0265332_10021232 | 3300031238 | Bacteria | 2869 |
| 313 | Ga0265328_10003911 | 3300031239 | Bacteria | 6552 |
| 314 | Ga0265320_10000011 | 3300031240 | Bacteria | 249534 |
| 315 | Ga0265325_10034845 | 3300031241 | Bacteria | 2676 |
| 316 | Ga0265340_10000001 | 3300031247 | Bacteria | 1647668 |
| 317 | Ga0265331_10001215 | 3300031250 | Bacteria | 19370 |
| 318 | Ga0265327_10000015 | 3300031251 | Bacteria | 496677 |
| 319 | Ga0265327_10001841 | 3300031251 | Bacteria | 24614 |
| 320 | Ga0265327_10002681 | 3300031251 | Bacteria | 18268 |
| 321 | Ga0265316_10000536 | 3300031344 | Bacteria | 42732 |
| 322 | Ga0265316_10005336 | 3300031344 | Bacteria | 12523 |
| 323 | Ga0307408_100059961 | 3300031548 | Bacteria | 2772 |
| 324 | Ga0316579_10003307 | 3300031691 | Bacteria | 6260 |
| 325 | Ga0316579_10017057 | 3300031691 | Bacteria | 3181 |
| 326 | Ga0265314_10000361 | 3300031711 | Bacteria | 63269 |
| 327 | Ga0265342_10055996 | 3300031712 | Bacteria | 2339 |
| 328 | Ga0316576_10024737 | 3300031727 | Bacteria | 4196 |
| 329 | Ga0307405_10020736 | 3300031731 | Bacteria | 3679 |
| 330 | Ga0316577_10006313 | 3300031733 | Bacteria | 6255 |
| 331 | Ga0307413_10109394 | 3300031824 | Bacteria | 1847 |
| 332 | Ga0307409_100014418 | 3300031995 | Bacteria | 5142 |
| 333 | Ga0307409_100014889 | 3300031995 | Bacteria | 5080 |
| 334 | Ga0307409_100040359 | 3300031995 | Bacteria | 3474 |
| 335 | Ga0307409_100092838 | 3300031995 | Bacteria | 2478 |
| 336 | Ga0307416_100011881 | 3300032002 | Bacteria | 5839 |
| 337 | Ga0307415_100001589 | 3300032126 | Bacteria | 10960 |
| 338 | Ga0307415_100054497 | 3300032126 | Bacteria | 2730 |
| 339 | Ga0307415_100101116 | 3300032126 | Bacteria | 2115 |
| 340 | Ga0373929_0006848 | 3300035085 | Bacteria | 2070 |
| 341 | Ga0373961_0031534 | 3300035241 | Bacteria | 1481 |
| 342 | Ga0373931_0002440 | 3300035691 | Bacteria | 8235 |
| 343 | Ga0373927_0003744 | 3300035695 | Bacteria | 10797 |
| 344 | Ga0373947_0088568 | 3300035725 | Bacteria | 1927 |
| 345 | Ga0316584_0000757 | 3300036712 | Bacteria | 18034 |
| 346 | Ga0316584_0022454 | 3300036712 | Bacteria | 4602 |
| 347 | Ga0373925_0003041 | 3300037068 | Bacteria | 13196 |
| 348 | Ga0395899_0071121 | 3300037312 | Bacteria | 2546 |
| 349 | Ga0395900_0005975 | 3300037418 | Bacteria | 12709 |
| 350 | Ga0395898_0012550 | 3300037466 | Bacteria | 8763 |
| 351 | Ga0395898_0145767 | 3300037466 | Bacteria | 2266 |
| 352 | Ga0395898_0179344 | 3300037466 | Bacteria | 2024 |
| 353 | Ga0395905_0021240 | 3300037471 | Bacteria | 6143 |
| 354 | Ga0436364_0154387 | 3300037853 | Bacteria | 2460 |
| 355 | Ga0395901_0009290 | 3300038443 | Bacteria | 9966 |
| 356 | Ga0395901_0010764 | 3300038443 | Bacteria | 9273 |
| 357 | Ga0395901_0102890 | 3300038443 | Bacteria | 2997 |
| 358 | Ga0395901_0197065 | 3300038443 | Bacteria | 2112 |
| 359 | Ga0436360_0711520 | 3300039438 | Bacteria | 2920 |
| 360 | Ga0439460_0011819 | 3300042461 | Bacteria | 2256 |
| 361 | Ga0451577_0001787 | 3300042876 | Bacteria | 27578 |
| 362 | Ga0451577_0002216 | 3300042876 | Bacteria | 23670 |
| 363 | Ga0451577_0005547 | 3300042876 | Bacteria | 12856 |
| 364 | Ga0451577_0013714 | 3300042876 | Bacteria | 7573 |
| 365 | Ga0451577_0023154 | 3300042876 | Bacteria | 5668 |
| 366 | Ga0451577_0026266 | 3300042876 | Bacteria | 5275 |
| 367 | Ga0439440_0001118 | 3300042993 | Bacteria | 4790 |
| 368 | Ga0466963_0032574 | 3300044694 | Bacteria | 3377 |
| 369 | Ga0453684_0000010 | 3300044712 | Bacteria | 1133422 |
| 370 | Ga0453684_0000072 | 3300044712 | Bacteria | 442457 |
| 371 | Ga0453684_0000177 | 3300044712 | Bacteria | 282969 |
| 372 | Ga0453684_0004180 | 3300044712 | Bacteria | 31097 |
| 373 | Ga0453684_0012309 | 3300044712 | Bacteria | 14156 |
| 374 | Ga0453684_0037153 | 3300044712 | Bacteria | 6690 |
| 375 | Ga0453684_0052448 | 3300044712 | Bacteria | 5333 |
| 376 | Ga0453684_0068036 | 3300044712 | Bacteria | 4525 |
| 377 | Ga0453684_0079171 | 3300044712 | Bacteria | 4109 |
| 378 | Ga0451576_0007659 | 3300045051 | Bacteria | 12837 |
| 379 | Ga0451576_0089859 | 3300045051 | Bacteria | 3194 |
| 380 | Ga0466967_0141287 | 3300045976 | Bacteria | 2243 |
| 381 | Ga0495603_0000596 | 3300046455 | Bacteria | 20312 |
| 382 | Ga0495629_0039398 | 3300046459 | Bacteria | 3326 |
| 383 | Ga0495638_0013818 | 3300046460 | Bacteria | 5481 |
| 384 | Ga0495641_0001114 | 3300046461 | Bacteria | 23115 |
| 385 | Ga0495580_0016116 | 3300046472 | Bacteria | 5618 |
| 386 | Ga0495580_0022002 | 3300046472 | Bacteria | 4699 |
| 387 | Ga0495582_0005093 | 3300046473 | Bacteria | 7361 |
| 388 | Ga0495664_0000012 | 3300046477 | Bacteria | 226118 |
| 389 | Ga0495630_0000891 | 3300046517 | Bacteria | 20921 |
| 390 | Ga0495667_0000020 | 3300046559 | Bacteria | 180876 |
| 391 | Ga0495634_0085438 | 3300046642 | Bacteria | 2056 |
| 392 | Ga0495657_0000007 | 3300046675 | Bacteria | 222471 |
| 393 | Ga0495657_0076028 | 3300046675 | Bacteria | 2182 |
| 394 | Ga0495604_0000190 | 3300047317 | Bacteria | 55090 |
| 395 | Ga0495604_0103329 | 3300047317 | Bacteria | 2091 |
| 396 | Ga0495676_0000805 | 3300047321 | Bacteria | 26189 |
| 397 | Ga0495676_0045786 | 3300047321 | Bacteria | 3557 |
| 398 | Ga0495680_0002123 | 3300047322 | Bacteria | 20590 |
| 399 | Ga0495680_0108170 | 3300047322 | Bacteria | 2064 |
| 400 | Ga0495686_0024455 | 3300047472 | Bacteria | 3968 |
| 401 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 402 | Ga0496100_0020234 | 3300048903 | Bacteria | 3987 |
| 403 | Ga0496100_0020337 | 3300048903 | Bacteria | 3978 |
| 404 | Ga0496101_0000004 | 3300048904 | Bacteria | 331599 |
| 405 | Ga0496102_0000027 | 3300048905 | Bacteria | 225466 |
| 406 | Ga0496102_0212050 | 3300048905 | Bacteria | 1826 |
| 407 | Ga0496103_0000155 | 3300048906 | Bacteria | 72091 |
| 408 | Ga0496103_0023229 | 3300048906 | Bacteria | 3738 |
| 409 | Ga0496104_0000015 | 3300048907 | Bacteria | 374530 |
| 410 | Ga0496104_0016788 | 3300048907 | Bacteria | 6654 |
| 411 | Ga0496104_0025988 | 3300048907 | Bacteria | 5400 |
| 412 | Ga0496104_0055926 | 3300048907 | Bacteria | 3731 |
| 413 | Ga0496104_0058523 | 3300048907 | Bacteria | 3648 |
| 414 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 415 | Ga0496105_0002253 | 3300048908 | Bacteria | 13976 |
| 416 | Ga0496105_0018671 | 3300048908 | Bacteria | 5583 |
| 417 | Ga0496106_0001278 | 3300048909 | Bacteria | 18871 |
| 418 | Ga0496106_0035676 | 3300048909 | Bacteria | 3719 |
| 419 | Ga0496106_0046899 | 3300048909 | Bacteria | 3250 |
| 420 | Ga0496106_0076105 | 3300048909 | Bacteria | 2572 |
| 421 | Ga0496106_0086688 | 3300048909 | Bacteria | 2412 |
| 422 | Ga0496107_0000005 | 3300048910 | Bacteria | 281747 |
| 423 | Ga0496107_0033457 | 3300048910 | Bacteria | 3678 |
| 424 | Ga0496107_0035024 | 3300048910 | Bacteria | 3599 |
| 425 | Ga0496108_0011493 | 3300048911 | Bacteria | 7195 |
| 426 | Ga0496109_0013371 | 3300048912 | Bacteria | 7117 |
| 427 | Ga0496109_0173032 | 3300048912 | Bacteria | 2026 |
| 428 | Ga0496110_0082585 | 3300048913 | Bacteria | 2866 |
| 429 | Ga0496112_0053022 | 3300048915 | Bacteria | 3982 |
| 430 | Ga0496113_0088786 | 3300048916 | Bacteria | 2378 |
| 431 | Ga0496114_0008997 | 3300048917 | Bacteria | 7915 |
| 432 | Ga0496114_0015247 | 3300048917 | Bacteria | 6178 |
| 433 | Ga0496115_0000035 | 3300048918 | Bacteria | 134475 |
| 434 | Ga0496115_0000143 | 3300048918 | Bacteria | 65909 |
| 435 | Ga0496115_0002639 | 3300048918 | Bacteria | 12880 |
| 436 | Ga0496115_0086374 | 3300048918 | Bacteria | 2559 |
| 437 | Ga0496116_0000176 | 3300048919 | Bacteria | 128426 |
| 438 | Ga0496117_0002967 | 3300048920 | Bacteria | 20476 |
| 439 | Ga0496119_0001444 | 3300048922 | Bacteria | 28583 |
| 440 | Ga0496119_0006106 | 3300048922 | Bacteria | 11282 |
| 441 | Ga0496119_0038824 | 3300048922 | Bacteria | 3070 |
| 442 | Ga0496120_0003250 | 3300048923 | Bacteria | 15033 |
| 443 | Ga0496121_0003484 | 3300048924 | Bacteria | 22403 |
| 444 | Ga0496121_0004005 | 3300048924 | Bacteria | 20303 |
| 445 | Ga0496121_0014377 | 3300048924 | Bacteria | 8404 |
| 446 | Ga0496121_0014861 | 3300048924 | Bacteria | 8213 |
| 447 | Ga0496121_0055701 | 3300048924 | Bacteria | 3291 |
| 448 | Ga0496125_0028123 | 3300048928 | Bacteria | 5084 |
| 449 | Ga0496126_0003514 | 3300048929 | Bacteria | 19727 |
| 450 | Ga0496126_0023298 | 3300048929 | Bacteria | 6000 |
| 451 | Ga0501031_0019266 | 3300049568 | Bacteria | 4443 |
| 452 | Ga0501031_0024011 | 3300049568 | Bacteria | 3975 |
| 453 | Ga0501032_0017545 | 3300049569 | Bacteria | 5024 |
| 454 | Ga0501032_0025482 | 3300049569 | Bacteria | 4076 |
| 455 | Ga0501032_0037486 | 3300049569 | Bacteria | 3306 |
| 456 | Ga0501033_0005704 | 3300049570 | Bacteria | 9815 |
| 457 | Ga0501033_0013165 | 3300049570 | Bacteria | 6301 |
| 458 | Ga0501033_0040723 | 3300049570 | Bacteria | 3468 |
| 459 | Ga0501033_0082766 | 3300049570 | Bacteria | 2353 |
| 460 | Ga0501034_0016464 | 3300049571 | Bacteria | 7587 |
| 461 | Ga0501034_0030467 | 3300049571 | Bacteria | 5485 |
| 462 | Ga0501034_0082005 | 3300049571 | Bacteria | 3227 |
| 463 | Ga0501034_0140020 | 3300049571 | Bacteria | 2399 |
| 464 | Ga0501034_0163229 | 3300049571 | Bacteria | 2198 |
| 465 | Ga0501036_0002059 | 3300049572 | Bacteria | 15663 |
| 466 | Ga0501036_0006253 | 3300049572 | Bacteria | 9658 |
| 467 | Ga0501036_0031963 | 3300049572 | Bacteria | 4447 |
| 468 | Ga0501037_0000901 | 3300049573 | Bacteria | 22167 |
| 469 | Ga0501037_0124783 | 3300049573 | Bacteria | 1849 |
| 470 | Ga0501038_0017202 | 3300049574 | Bacteria | 6537 |
| 471 | Ga0501038_0039586 | 3300049574 | Bacteria | 4123 |
| 472 | Ga0501038_0053041 | 3300049574 | Bacteria | 3493 |
| 473 | Ga0501038_0076358 | 3300049574 | Bacteria | 2830 |
| 474 | Ga0501038_0088147 | 3300049574 | Bacteria | 2605 |
| 475 | Ga0501039_0014387 | 3300049575 | Bacteria | 6059 |
| 476 | Ga0501039_0019777 | 3300049575 | Bacteria | 5162 |
| 477 | Ga0501039_0034932 | 3300049575 | Bacteria | 3880 |
| 478 | Ga0501039_0035324 | 3300049575 | Bacteria | 3857 |
| 479 | Ga0501039_0056957 | 3300049575 | Bacteria | 3028 |
| 480 | Ga0501039_0106997 | 3300049575 | Bacteria | 2184 |
| 481 | Ga0501039_0118994 | 3300049575 | Bacteria | 2069 |
| 482 | Ga0501040_0001522 | 3300049576 | Bacteria | 14713 |
| 483 | Ga0501040_0006557 | 3300049576 | Bacteria | 7557 |
| 484 | Ga0501040_0023647 | 3300049576 | Bacteria | 4121 |
| 485 | Ga0501040_0025428 | 3300049576 | Bacteria | 3981 |
| 486 | Ga0501040_0043555 | 3300049576 | Bacteria | 3060 |
| 487 | Ga0501040_0072628 | 3300049576 | Bacteria | 2376 |
| 488 | Ga0501040_0098330 | 3300049576 | Bacteria | 2039 |
| 489 | Ga0501041_0007553 | 3300049577 | Bacteria | 6382 |
| 490 | Ga0501041_0016982 | 3300049577 | Bacteria | 4331 |
| 491 | Ga0501041_0028787 | 3300049577 | Bacteria | 3351 |
| 492 | Ga0501041_0034230 | 3300049577 | Bacteria | 3075 |
| 493 | Ga0501041_0041266 | 3300049577 | Bacteria | 2802 |
| 494 | Ga0501042_0001724 | 3300049578 | Bacteria | 13073 |
| 495 | Ga0501042_0011854 | 3300049578 | Bacteria | 5887 |
| 496 | Ga0501042_0018290 | 3300049578 | Bacteria | 4850 |
| 497 | Ga0501042_0020204 | 3300049578 | Bacteria | 4634 |
| 498 | Ga0501042_0029580 | 3300049578 | Bacteria | 3864 |
| 499 | Ga0501042_0065925 | 3300049578 | Bacteria | 2588 |
| 500 | Ga0501043_0002515 | 3300049579 | Bacteria | 15490 |
| 501 | Ga0501043_0045244 | 3300049579 | Bacteria | 3461 |
| 502 | Ga0501046_0005055 | 3300049580 | Bacteria | 11824 |
| 503 | Ga0501046_0007307 | 3300049580 | Bacteria | 9717 |
| 504 | Ga0501046_0056469 | 3300049580 | Bacteria | 3082 |
| 505 | Ga0501046_0062494 | 3300049580 | Bacteria | 2909 |
| 506 | Ga0501046_0063196 | 3300049580 | Bacteria | 2891 |
| 507 | Ga0501047_0002109 | 3300049581 | Bacteria | 19029 |
| 508 | Ga0501047_0006504 | 3300049581 | Bacteria | 10998 |
| 509 | Ga0501047_0020607 | 3300049581 | Bacteria | 6331 |
| 510 | Ga0501047_0143821 | 3300049581 | Bacteria | 2262 |
| 511 | Ga0501048_0004425 | 3300049582 | Bacteria | 10700 |
| 512 | Ga0501048_0005976 | 3300049582 | Bacteria | 9270 |
| 513 | Ga0501048_0026309 | 3300049582 | Bacteria | 4236 |
| 514 | Ga0501048_0028092 | 3300049582 | Bacteria | 4084 |
| 515 | Ga0501048_0049052 | 3300049582 | Bacteria | 3010 |
| 516 | Ga0501048_0072099 | 3300049582 | Bacteria | 2438 |
| 517 | Ga0501067_0008416 | 3300049583 | Bacteria | 5726 |
| 518 | Ga0501068_0026246 | 3300049584 | Bacteria | 3431 |
| 519 | Ga0501068_0039269 | 3300049584 | Bacteria | 2838 |
| 520 | Ga0501069_0007255 | 3300049585 | Bacteria | 5813 |
| 521 | Ga0501069_0021301 | 3300049585 | Bacteria | 3517 |
| 522 | Ga0501070_0000592 | 3300049586 | Bacteria | 33029 |
| 523 | Ga0501070_0017472 | 3300049586 | Bacteria | 6022 |
| 524 | Ga0501071_0000146 | 3300049587 | Bacteria | 29418 |
| 525 | Ga0501071_0048581 | 3300049587 | Bacteria | 3053 |
| 526 | Ga0501071_0084832 | 3300049587 | Bacteria | 2322 |
| 527 | Ga0501072_0001102 | 3300049588 | Bacteria | 20088 |
| 528 | Ga0501072_0003271 | 3300049588 | Bacteria | 12171 |
| 529 | Ga0501072_0004269 | 3300049588 | Bacteria | 10840 |
| 530 | Ga0501072_0078213 | 3300049588 | Bacteria | 2619 |
| 531 | Ga0501073_0006491 | 3300049589 | Bacteria | 8703 |
| 532 | Ga0501073_0099530 | 3300049589 | Bacteria | 2019 |
| 533 | Ga0501074_0004840 | 3300049590 | Bacteria | 9651 |
| 534 | Ga0501074_0009485 | 3300049590 | Bacteria | 7068 |
| 535 | Ga0501074_0062018 | 3300049590 | Bacteria | 2694 |
| 536 | Ga0501075_0000052 | 3300049591 | Bacteria | 49149 |
| 537 | Ga0501075_0000387 | 3300049591 | Bacteria | 25430 |
| 538 | Ga0501075_0013557 | 3300049591 | Bacteria | 5821 |
| 539 | Ga0501076_0000744 | 3300049592 | Bacteria | 21082 |
| 540 | Ga0501076_0000935 | 3300049592 | Bacteria | 19029 |
| 541 | Ga0501076_0007345 | 3300049592 | Bacteria | 8019 |
| 542 | Ga0501076_0014867 | 3300049592 | Bacteria | 5874 |
| 543 | Ga0501076_0015737 | 3300049592 | Bacteria | 5721 |
| 544 | Ga0501076_0028117 | 3300049592 | Bacteria | 4364 |
| 545 | Ga0501077_0026890 | 3300049593 | Bacteria | 3653 |
| 546 | Ga0501077_0035180 | 3300049593 | Bacteria | 3189 |
| 547 | Ga0501077_0073771 | 3300049593 | Bacteria | 2162 |
| 548 | Ga0501079_0000292 | 3300049741 | Bacteria | 30851 |
| 549 | Ga0501079_0013780 | 3300049741 | Bacteria | 6164 |
| 550 | Ga0501079_0024567 | 3300049741 | Bacteria | 4624 |
| 551 | Ga0501079_0026522 | 3300049741 | Bacteria | 4441 |
| 552 | Ga0501079_0074484 | 3300049741 | Bacteria | 2624 |
| 553 | Ga0501079_0081859 | 3300049741 | Bacteria | 2496 |
| 554 | Ga0501080_0000228 | 3300049742 | Bacteria | 42084 |
| 555 | Ga0501080_0122185 | 3300049742 | Bacteria | 2412 |
| 556 | Ga0501081_0000416 | 3300049743 | Bacteria | 23512 |
| 557 | Ga0501081_0050144 | 3300049743 | Bacteria | 2876 |
| 558 | Ga0501081_0054175 | 3300049743 | Bacteria | 2771 |
| 559 | Ga0501081_0073865 | 3300049743 | Bacteria | 2378 |
| 560 | Ga0501081_0094566 | 3300049743 | Bacteria | 2106 |
| 561 | Ga0501083_0004753 | 3300049744 | Bacteria | 9592 |
| 562 | Ga0501083_0035911 | 3300049744 | Bacteria | 3384 |
| 563 | Ga0501083_0053085 | 3300049744 | Bacteria | 2721 |
| 564 | Ga0501035_0000368 | 3300049822 | Bacteria | 51908 |
| 565 | Ga0501035_0012623 | 3300049822 | Bacteria | 7806 |
| 566 | Ga0501035_0033741 | 3300049822 | Bacteria | 4652 |
| 567 | Ga0501035_0093010 | 3300049822 | Bacteria | 2653 |
| 568 | Ga0501044_0000684 | 3300049823 | Bacteria | 40967 |
| 569 | Ga0501044_0006739 | 3300049823 | Bacteria | 12663 |
| 570 | Ga0501044_0039906 | 3300049823 | Bacteria | 4894 |
| 571 | Ga0501045_0003796 | 3300049824 | Bacteria | 10391 |
| 572 | Ga0501045_0089350 | 3300049824 | Bacteria | 2276 |
| 573 | nmdc:mga03683_3645_c1 | 3300050489 | Bacteria | 5006 |
| 574 | nmdc:mga03n38_143_c1 | 3300050490 | Bacteria | 15695 |
| 575 | nmdc:mga03n38_24429_c1 | 3300050490 | Bacteria | 2471 |
| 576 | nmdc:mga00v17_2264_c1 | 3300050491 | Bacteria | 9863 |
| 577 | nmdc:mga00v17_34182_c1 | 3300050491 | Bacteria | 3017 |
| 578 | nmdc:mga00v17_5517_c1 | 3300050491 | Bacteria | 6666 |
| 579 | nmdc:mga0yw44_18945_c1 | 3300050492 | Bacteria | 3784 |
| 580 | nmdc:mga0yw44_7343_c1 | 3300050492 | Bacteria | 5413 |
| 581 | nmdc:mga0yw44_88_c1 | 3300050492 | Bacteria | 32594 |
| 582 | nmdc:mga0k408_33228_c1 | 3300050493 | Bacteria | 2950 |
| 583 | nmdc:mga06z11_2325_c1 | 3300050494 | Bacteria | 7235 |
| 584 | nmdc:mga07m45_69_c1 | 3300050496 | Bacteria | 38695 |
| 585 | nmdc:mga05p37_117857_c1 | 3300050507 | Bacteria | 3262 |
| 586 | nmdc:mga05p37_1820_c1 | 3300050507 | Bacteria | 24856 |
| 587 | nmdc:mga05p37_19885_c1 | 3300050507 | Bacteria | 8122 |
| 588 | nmdc:mga05p37_21210_c1 | 3300050507 | Bacteria | 7866 |
| 589 | nmdc:mga05p37_44861_c1 | 3300050507 | Bacteria | 5438 |
| 590 | nmdc:mga09592_405_c1 | 3300050508 | Bacteria | 31613 |
| 591 | nmdc:mga09592_410_c1 | 3300050508 | Bacteria | 31410 |
| 592 | nmdc:mga0qj67_16683_c1 | 3300050509 | Bacteria | 5574 |
| 593 | nmdc:mga0qj67_2445_c1 | 3300050509 | Bacteria | 13228 |
| 594 | nmdc:mga0qj67_302_c1 | 3300050509 | Bacteria | 34246 |
| 595 | nmdc:mga0qj67_32926_c1 | 3300050509 | Bacteria | 4043 |
| 596 | nmdc:mga06r32_108492_c1 | 3300050510 | Bacteria | 2729 |
| 597 | nmdc:mga06r32_21166_c1 | 3300050510 | Bacteria | 6002 |
| 598 | nmdc:mga06r32_5740_c1 | 3300050510 | Bacteria | 11176 |
| 599 | nmdc:mga06r32_6387_c1 | 3300050510 | Bacteria | 10591 |
| 600 | nmdc:mga08y16_17331_c1 | 3300050511 | Bacteria | 7582 |
| 601 | nmdc:mga08y16_196_c1 | 3300050511 | Bacteria | 54632 |
| 602 | nmdc:mga08y16_2827_c1 | 3300050511 | Bacteria | 17838 |
| 603 | nmdc:mga0n895_138179_c1 | 3300050512 | Unclassified | 2464 |
| 604 | nmdc:mga0n895_25905_c1 | 3300050512 | Bacteria | 5546 |
| 605 | nmdc:mga0n895_26597_c1 | 3300050512 | Bacteria | 5483 |
| 606 | nmdc:mga0n895_28653_c1 | 3300050512 | Bacteria | 5300 |
| 607 | nmdc:mga0n895_5164_c1 | 3300050512 | Bacteria | 10861 |
| 608 | nmdc:mga0rr50_3934_c1 | 3300050513 | Bacteria | 4422 |
| 609 | nmdc:mga0rr50_55433_c1 | 3300050513 | Bacteria | 2957 |
| 610 | nmdc:mga08x19_51140_c1 | 3300050514 | Bacteria | 2654 |
| 611 | nmdc:mga08x19_61390_c1 | 3300050514 | Bacteria | 2436 |
| 612 | nmdc:mga08x19_7279_c1 | 3300050514 | Bacteria | 6571 |
| 613 | nmdc:mga0a205_127515_c1 | 3300050515 | Bacteria | 2445 |
| 614 | nmdc:mga0a205_2674_c1 | 3300050515 | Bacteria | 15763 |
| 615 | nmdc:mga0a205_366_c1 | 3300050515 | Bacteria | 34091 |
| 616 | nmdc:mga0a205_4128_c1 | 3300050515 | Bacteria | 12998 |
| 617 | nmdc:mga0a205_4535_c1 | 3300050515 | Bacteria | 12467 |
| 618 | nmdc:mga0a205_6077_c1 | 3300050515 | Bacteria | 10889 |
| 619 | nmdc:mga0sz30_25_c2 | 3300050516 | Bacteria | 27265 |
| 620 | Ga0495601_0008867 | 3300053077 | Bacteria | 5936 |
| 621 | Ga0495601_0019043 | 3300053077 | Bacteria | 4183 |
| 622 | Ga0495601_0041304 | 3300053077 | Bacteria | 2890 |
| 623 | Ga0495619_0053584 | 3300053085 | Bacteria | 2669 |
| 624 | Ga0500641_0005118 | 3300053096 | Bacteria | 4646 |
| 625 | Ga0500555_001423 | 3300053103 | Bacteria | 7362 |
| 626 | Ga0500559_0053041 | 3300053136 | Bacteria | 1794 |
| 627 | Ga0501084_0000912 | 3300054114 | Bacteria | 22846 |
| 628 | Ga0501084_0019806 | 3300054114 | Bacteria | 5607 |
| 629 | Ga0501084_0036170 | 3300054114 | Bacteria | 4125 |
| 630 | Ga0501082_0002443 | 3300060353 | Bacteria | 16310 |
| 631 | Ga0501082_0008754 | 3300060353 | Bacteria | 8725 |
| 632 | Ga0501082_0038968 | 3300060353 | Bacteria | 4099 |
| 633 | Ga0501082_0058718 | 3300060353 | Bacteria | 3315 |
| 634 | Ga0530510_0000017 | 3300061734 | Bacteria | 84530 |
| 635 | Ga0530510_0000168 | 3300061734 | Bacteria | 39753 |
| 636 | Ga0530510_0007392 | 3300061734 | Bacteria | 7647 |
| 637 | Ga0530510_0009273 | 3300061734 | Bacteria | 6904 |
| 638 | Ga0530510_0031753 | 3300061734 | Bacteria | 3797 |
| 639 | Ga0530510_0033345 | 3300061734 | Bacteria | 3708 |
| 640 | Ga0530510_0109831 | 3300061734 | Bacteria | 2019 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006881 | Ga0068865_100126864 | Ga0068865_1001268642 | 452 |
| 2 | 3300035241 | Ga0373961_0031534 | Ga0373961_0031534_19_1467 | 473 |
| 3 | 3300049743 | Ga0501081_0073865 | Ga0501081_0073865_107_1576 | 473 |
| 4 | 3300049822 | Ga0501035_0033741 | Ga0501035_0033741_64_1593 | 484 |
| 5 | 3300050493 | nmdc:mga0k408_33228_c1 | nmdc:mga0k408_33228_c1_17_1627 | 497 |
| 6 | 3300061734 | Ga0530510_0031753 | Ga0530510_0031753_2129_3751 | 511 |
| 7 | 3300006871 | Ga0075434_100006129 | Ga0075434_10000612911 | 513 |
| 8 | 3300007076 | Ga0075435_100026214 | Ga0075435_1000262143 | 513 |
| 9 | 3300050512 | nmdc:mga0n895_5164_c1 | nmdc:mga0n895_5164_c1_714_2354 | 513 |
| 10 | 3300050513 | nmdc:mga0rr50_3934_c1 | nmdc:mga0rr50_3934_c1_2034_3674 | 513 |
| 11 | 3300048909 | Ga0496106_0035676 | Ga0496106_0035676_323_1984 | 514 |
| 12 | 3300048918 | Ga0496115_0086374 | Ga0496115_0086374_417_2159 | 517 |
| 13 | 3300037312 | Ga0395899_0071121 | Ga0395899_0071121_882_2513 | 518 |
| 14 | 3300049581 | Ga0501047_0006504 | Ga0501047_0006504_6836_8506 | 518 |
| 15 | 3300005618 | Ga0068864_100011866 | Ga0068864_1000118665 | 520 |
| 16 | 3300035085 | Ga0373929_0006848 | Ga0373929_0006848_31_1782 | 520 |
| 17 | 3300048910 | Ga0496107_0033457 | Ga0496107_0033457_161_1939 | 520 |
| 18 | 3300048911 | Ga0496108_0011493 | Ga0496108_0011493_1713_3491 | 520 |
| 19 | 3300048917 | Ga0496114_0008997 | Ga0496114_0008997_4117_5895 | 520 |
| 20 | 3300049744 | Ga0501083_0053085 | Ga0501083_0053085_1053_2681 | 520 |
| 21 | 3300053077 | Ga0495601_0041304 | Ga0495601_0041304_815_2566 | 520 |
| 22 | 3300047321 | Ga0495676_0000805 | Ga0495676_0000805_2654_4291 | 521 |
| 23 | 3300048903 | Ga0496100_0000001 | Ga0496100_0000001_494607_496244 | 521 |
| 24 | 3300048904 | Ga0496101_0000004 | Ga0496101_0000004_295959_297596 | 521 |
| 25 | 3300048909 | Ga0496106_0001278 | Ga0496106_0001278_12687_14324 | 521 |
| 26 | 3300048910 | Ga0496107_0000005 | Ga0496107_0000005_34004_35641 | 521 |
| 27 | 3300006177 | Ga0075362_10006533 | Ga0075362_100065333 | 522 |
| 28 | 3300046459 | Ga0495629_0039398 | Ga0495629_0039398_1620_3281 | 522 |
| 29 | 3300046472 | Ga0495580_0016116 | Ga0495580_0016116_982_2643 | 522 |
| 30 | 3300046473 | Ga0495582_0005093 | Ga0495582_0005093_263_1924 | 522 |
| 31 | 3300049743 | Ga0501081_0094566 | Ga0501081_0094566_43_1656 | 522 |
| 32 | 3300005329 | Ga0070683_100070013 | Ga0070683_1000700132 | 523 |
| 33 | 3300005563 | Ga0068855_100025777 | Ga0068855_1000257772 | 523 |
| 34 | 3300013105 | Ga0157369_10002658 | Ga0157369_100026584 | 523 |
| 35 | 3300025944 | Ga0207661_10062896 | Ga0207661_100628962 | 523 |
| 36 | 3300048907 | Ga0496104_0055926 | Ga0496104_0055926_241_1926 | 523 |
| 37 | 3300005548 | Ga0070665_100098839 | Ga0070665_1000988392 | 524 |
| 38 | 3300005719 | Ga0068861_100061520 | Ga0068861_1000615202 | 524 |
| 39 | 3300009551 | Ga0105238_10144229 | Ga0105238_101442292 | 524 |
| 40 | 3300010375 | Ga0105239_10100730 | Ga0105239_101007302 | 524 |
| 41 | 3300010375 | Ga0105239_10114714 | Ga0105239_101147142 | 524 |
| 42 | 3300025904 | Ga0207647_10006961 | Ga0207647_100069615 | 524 |
| 43 | 3300028379 | Ga0268266_10092741 | Ga0268266_100927412 | 524 |
| 44 | 3300044712 | Ga0453684_0079171 | Ga0453684_0079171_32_1678 | 524 |
| 45 | 3300049568 | Ga0501031_0024011 | Ga0501031_0024011_1746_3359 | 524 |
| 46 | 3300049569 | Ga0501032_0025482 | Ga0501032_0025482_594_2207 | 524 |
| 47 | 3300049570 | Ga0501033_0005704 | Ga0501033_0005704_5002_6675 | 524 |
| 48 | 3300049570 | Ga0501033_0040723 | Ga0501033_0040723_1758_3371 | 524 |
| 49 | 3300049571 | Ga0501034_0016464 | Ga0501034_0016464_1790_3403 | 524 |
| 50 | 3300049571 | Ga0501034_0082005 | Ga0501034_0082005_772_2445 | 524 |
| 51 | 3300049571 | Ga0501034_0140020 | Ga0501034_0140020_696_2309 | 524 |
| 52 | 3300049572 | Ga0501036_0006253 | Ga0501036_0006253_599_2212 | 524 |
| 53 | 3300049573 | Ga0501037_0000901 | Ga0501037_0000901_1901_3514 | 524 |
| 54 | 3300049574 | Ga0501038_0039586 | Ga0501038_0039586_1938_3551 | 524 |
| 55 | 3300049574 | Ga0501038_0088147 | Ga0501038_0088147_84_1757 | 524 |
| 56 | 3300049575 | Ga0501039_0035324 | Ga0501039_0035324_1746_3359 | 524 |
| 57 | 3300049579 | Ga0501043_0045244 | Ga0501043_0045244_1734_3347 | 524 |
| 58 | 3300049580 | Ga0501046_0007307 | Ga0501046_0007307_596_2209 | 524 |
| 59 | 3300049581 | Ga0501047_0002109 | Ga0501047_0002109_15621_17234 | 524 |
| 60 | 3300049581 | Ga0501047_0020607 | Ga0501047_0020607_3650_5323 | 524 |
| 61 | 3300049582 | Ga0501048_0005976 | Ga0501048_0005976_117_1730 | 524 |
| 62 | 3300049586 | Ga0501070_0000592 | Ga0501070_0000592_7173_8786 | 524 |
| 63 | 3300049589 | Ga0501073_0006491 | Ga0501073_0006491_1641_3254 | 524 |
| 64 | 3300049744 | Ga0501083_0035911 | Ga0501083_0035911_1664_3277 | 524 |
| 65 | 3300049822 | Ga0501035_0000368 | Ga0501035_0000368_31190_32803 | 524 |
| 66 | 3300049823 | Ga0501044_0000684 | Ga0501044_0000684_5423_7036 | 524 |
| 67 | 3300049823 | Ga0501044_0039906 | Ga0501044_0039906_2566_4239 | 524 |
| 68 | 3300060353 | Ga0501082_0058718 | Ga0501082_0058718_1596_3209 | 524 |
| 69 | 3300005439 | Ga0070711_100059029 | Ga0070711_1000590292 | 525 |
| 70 | 3300049744 | Ga0501083_0004753 | Ga0501083_0004753_4110_5771 | 525 |
| 71 | 3300031241 | Ga0265325_10034845 | Ga0265325_100348451 | 527 |
| 72 | 3300031712 | Ga0265342_10055996 | Ga0265342_100559962 | 527 |
| 73 | 3300044712 | Ga0453684_0000010 | Ga0453684_0000010_49115_50824 | 527 |
| 74 | 3300006038 | Ga0075365_10000424 | Ga0075365_100004242 | 528 |
| 75 | 3300006051 | Ga0075364_10000955 | Ga0075364_1000095515 | 528 |
| 76 | 3300006051 | Ga0075364_10012861 | Ga0075364_100128615 | 528 |
| 77 | 3300025908 | Ga0207643_10029813 | Ga0207643_100298132 | 528 |
| 78 | 3300025933 | Ga0207706_10030789 | Ga0207706_100307894 | 528 |
| 79 | 3300031344 | Ga0265316_10005336 | Ga0265316_1000533612 | 528 |
| 80 | 3300050492 | nmdc:mga0yw44_88_c1 | nmdc:mga0yw44_88_c1_17768_19378 | 528 |
| 81 | 3300005355 | Ga0070671_100009254 | Ga0070671_1000092545 | 529 |
| 82 | 3300005364 | Ga0070673_100019731 | Ga0070673_1000197313 | 529 |
| 83 | 3300005455 | Ga0070663_100003515 | Ga0070663_1000035153 | 529 |
| 84 | 3300005530 | Ga0070679_100013601 | Ga0070679_1000136015 | 529 |
| 85 | 3300005548 | Ga0070665_100023373 | Ga0070665_1000233736 | 529 |
| 86 | 3300005563 | Ga0068855_100002418 | Ga0068855_10000241819 | 529 |
| 87 | 3300005834 | Ga0068851_10036920 | Ga0068851_100369202 | 529 |
| 88 | 3300006048 | Ga0075363_100014971 | Ga0075363_1000149714 | 529 |
| 89 | 3300006051 | Ga0075364_10039651 | Ga0075364_100396512 | 529 |
| 90 | 3300006186 | Ga0075369_10004307 | Ga0075369_100043076 | 529 |
| 91 | 3300006353 | Ga0075370_10000205 | Ga0075370_100002057 | 529 |
| 92 | 3300006871 | Ga0075434_100036459 | Ga0075434_1000364592 | 529 |
| 93 | 3300006880 | Ga0075429_100002699 | Ga0075429_1000026996 | 529 |
| 94 | 3300009093 | Ga0105240_10001845 | Ga0105240_100018456 | 529 |
| 95 | 3300009093 | Ga0105240_10090674 | Ga0105240_100906745 | 529 |
| 96 | 3300010375 | Ga0105239_10185349 | Ga0105239_101853493 | 529 |
| 97 | 3300013296 | Ga0157374_10076801 | Ga0157374_100768013 | 529 |
| 98 | 3300014325 | Ga0163163_10004489 | Ga0163163_1000448911 | 529 |
| 99 | 3300025913 | Ga0207695_10018267 | Ga0207695_100182676 | 529 |
| 100 | 3300025913 | Ga0207695_10127629 | Ga0207695_101276293 | 529 |
| 101 | 3300025921 | Ga0207652_10000867 | Ga0207652_1000086714 | 529 |
| 102 | 3300025941 | Ga0207711_10033760 | Ga0207711_100337602 | 529 |
| 103 | 3300025960 | Ga0207651_10015139 | Ga0207651_100151391 | 529 |
| 104 | 3300026035 | Ga0207703_10016836 | Ga0207703_100168362 | 529 |
| 105 | 3300026067 | Ga0207678_10001469 | Ga0207678_100014693 | 529 |
| 106 | 3300026121 | Ga0207683_10047464 | Ga0207683_100474643 | 529 |
| 107 | 3300028379 | Ga0268266_10094745 | Ga0268266_100947453 | 529 |
| 108 | 3300042876 | Ga0451577_0002216 | Ga0451577_0002216_17480_19123 | 529 |
| 109 | 3300044712 | Ga0453684_0000177 | Ga0453684_0000177_140502_142145 | 529 |
| 110 | 3300046642 | Ga0495634_0085438 | Ga0495634_0085438_284_1933 | 529 |
| 111 | 3300048918 | Ga0496115_0002639 | Ga0496115_0002639_4349_5974 | 529 |
| 112 | 3300049585 | Ga0501069_0007255 | Ga0501069_0007255_3717_5387 | 529 |
| 113 | 3300049741 | Ga0501079_0024567 | Ga0501079_0024567_1435_3105 | 529 |
| 114 | 3300050489 | nmdc:mga03683_3645_c1 | nmdc:mga03683_3645_c1_3244_4914 | 529 |
| 115 | 3300050490 | nmdc:mga03n38_143_c1 | nmdc:mga03n38_143_c1_3334_4947 | 529 |
| 116 | 3300050490 | nmdc:mga03n38_24429_c1 | nmdc:mga03n38_24429_c1_356_2026 | 529 |
| 117 | 3300050491 | nmdc:mga00v17_5517_c1 | nmdc:mga00v17_5517_c1_855_2468 | 529 |
| 118 | 3300050494 | nmdc:mga06z11_2325_c1 | nmdc:mga06z11_2325_c1_1434_3047 | 529 |
| 119 | 3300050496 | nmdc:mga07m45_69_c1 | nmdc:mga07m45_69_c1_26327_27940 | 529 |
| 120 | 3300050508 | nmdc:mga09592_410_c1 | nmdc:mga09592_410_c1_20328_21941 | 529 |
| 121 | 3300050512 | nmdc:mga0n895_138179_c1 | nmdc:mga0n895_138179_c1_578_2191 | 529 |
| 122 | 3300050516 | nmdc:mga0sz30_25_c2 | nmdc:mga0sz30_25_c2_3551_5164 | 529 |
| 123 | iso_pu_bacteria | 2919493220 | 2919497294 | 529 |
| 124 | iso_pu_bacteria | 2919543075 | 2919544549 | 529 |
| 125 | iso_pu_bacteria | 2923525760 | 2923527039 | 529 |
| 126 | 3300009101 | Ga0105247_10000278 | Ga0105247_1000027844 | 530 |
| 127 | 3300009176 | Ga0105242_10000921 | Ga0105242_100009214 | 530 |
| 128 | 3300025900 | Ga0207710_10000502 | Ga0207710_1000050216 | 530 |
| 129 | 3300025934 | Ga0207686_10002267 | Ga0207686_100022677 | 530 |
| 130 | 3300047472 | Ga0495686_0024455 | Ga0495686_0024455_453_2117 | 530 |
| 131 | 3300048907 | Ga0496104_0000015 | Ga0496104_0000015_336926_338584 | 530 |
| 132 | 3300048908 | Ga0496105_0000004 | Ga0496105_0000004_137215_138873 | 530 |
| 133 | 3300048922 | Ga0496119_0038824 | Ga0496119_0038824_350_2008 | 530 |
| 134 | 3300049587 | Ga0501071_0048581 | Ga0501071_0048581_1107_2813 | 530 |
| 135 | 3300053103 | Ga0500555_001423 | Ga0500555_001423_2752_4380 | 530 |
| 136 | 3300005436 | Ga0070713_100002374 | Ga0070713_10000237410 | 531 |
| 137 | 3300005563 | Ga0068855_100025043 | Ga0068855_1000250435 | 531 |
| 138 | 3300005563 | Ga0068855_100086919 | Ga0068855_1000869192 | 531 |
| 139 | 3300006051 | Ga0075364_10002607 | Ga0075364_100026077 | 531 |
| 140 | 3300006175 | Ga0070712_100001607 | Ga0070712_10000160710 | 531 |
| 141 | 3300006852 | Ga0075433_10000055 | Ga0075433_100000552 | 531 |
| 142 | 3300025913 | Ga0207695_10012561 | Ga0207695_100125618 | 531 |
| 143 | 3300025913 | Ga0207695_10019085 | Ga0207695_100190854 | 531 |
| 144 | 3300025949 | Ga0207667_10008748 | Ga0207667_100087483 | 531 |
| 145 | 3300028379 | Ga0268266_10037493 | Ga0268266_100374932 | 531 |
| 146 | 3300028379 | Ga0268266_10038686 | Ga0268266_100386862 | 531 |
| 147 | 3300037466 | Ga0395898_0179344 | Ga0395898_0179344_71_1726 | 531 |
| 148 | 3300038443 | Ga0395901_0102890 | Ga0395901_0102890_1105_2760 | 531 |
| 149 | 3300042876 | Ga0451577_0013714 | Ga0451577_0013714_2862_4544 | 531 |
| 150 | 3300044712 | Ga0453684_0004180 | Ga0453684_0004180_13931_15613 | 531 |
| 151 | 3300048905 | Ga0496102_0000027 | Ga0496102_0000027_188802_190532 | 531 |
| 152 | 3300048906 | Ga0496103_0000155 | Ga0496103_0000155_48265_49995 | 531 |
| 153 | 3300048924 | Ga0496121_0055701 | Ga0496121_0055701_962_2623 | 531 |
| 154 | 3300049568 | Ga0501031_0019266 | Ga0501031_0019266_13_1668 | 531 |
| 155 | 3300049570 | Ga0501033_0082766 | Ga0501033_0082766_81_1736 | 531 |
| 156 | 3300049571 | Ga0501034_0030467 | Ga0501034_0030467_334_1989 | 531 |
| 157 | 3300049574 | Ga0501038_0053041 | Ga0501038_0053041_994_2649 | 531 |
| 158 | 3300049575 | Ga0501039_0019777 | Ga0501039_0019777_3208_4863 | 531 |
| 159 | 3300049578 | Ga0501042_0018290 | Ga0501042_0018290_3005_4660 | 531 |
| 160 | 3300049579 | Ga0501043_0002515 | Ga0501043_0002515_13241_14896 | 531 |
| 161 | 3300049580 | Ga0501046_0063196 | Ga0501046_0063196_300_1955 | 531 |
| 162 | 3300049581 | Ga0501047_0143821 | Ga0501047_0143821_286_1941 | 531 |
| 163 | 3300049582 | Ga0501048_0028092 | Ga0501048_0028092_1797_3452 | 531 |
| 164 | 3300049583 | Ga0501067_0008416 | Ga0501067_0008416_87_1742 | 531 |
| 165 | 3300049584 | Ga0501068_0026246 | Ga0501068_0026246_405_2060 | 531 |
| 166 | 3300049586 | Ga0501070_0017472 | Ga0501070_0017472_485_2140 | 531 |
| 167 | 3300049590 | Ga0501074_0004840 | Ga0501074_0004840_218_1873 | 531 |
| 168 | 3300049741 | Ga0501079_0013780 | Ga0501079_0013780_2953_4608 | 531 |
| 169 | 3300049742 | Ga0501080_0122185 | Ga0501080_0122185_286_1941 | 531 |
| 170 | 3300049823 | Ga0501044_0006739 | Ga0501044_0006739_2717_4372 | 531 |
| 171 | 3300050491 | nmdc:mga00v17_2264_c1 | nmdc:mga00v17_2264_c1_3939_5558 | 531 |
| 172 | 3300050515 | nmdc:mga0a205_366_c1 | nmdc:mga0a205_366_c1_137_1801 | 531 |
| 173 | 3300054114 | Ga0501084_0019806 | Ga0501084_0019806_856_2511 | 531 |
| 174 | 3300005563 | Ga0068855_100091367 | Ga0068855_1000913673 | 532 |
| 175 | 3300028556 | Ga0265337_1000240 | Ga0265337_10002406 | 532 |
| 176 | 3300028558 | Ga0265326_10000393 | Ga0265326_100003932 | 532 |
| 177 | 3300028654 | Ga0265322_10000029 | Ga0265322_1000002953 | 532 |
| 178 | 3300029957 | Ga0265324_10000423 | Ga0265324_100004234 | 532 |
| 179 | 3300031238 | Ga0265332_10021232 | Ga0265332_100212323 | 532 |
| 180 | 3300031239 | Ga0265328_10003911 | Ga0265328_100039116 | 532 |
| 181 | 3300031240 | Ga0265320_10000011 | Ga0265320_10000011229 | 532 |
| 182 | 3300031250 | Ga0265331_10001215 | Ga0265331_1000121515 | 532 |
| 183 | 3300031251 | Ga0265327_10000015 | Ga0265327_10000015337 | 532 |
| 184 | 3300031711 | Ga0265314_10000361 | Ga0265314_1000036138 | 532 |
| 185 | 3300046455 | Ga0495603_0000596 | Ga0495603_0000596_18527_20197 | 532 |
| 186 | 3300046559 | Ga0495667_0000020 | Ga0495667_0000020_144130_145803 | 532 |
| 187 | 3300046675 | Ga0495657_0076028 | Ga0495657_0076028_401_2059 | 532 |
| 188 | 3300047322 | Ga0495680_0002123 | Ga0495680_0002123_9128_10801 | 532 |
| 189 | 3300053136 | Ga0500559_0053041 | Ga0500559_0053041_35_1693 | 532 |
| 190 | 3300005347 | Ga0070668_100142192 | Ga0070668_1001421922 | 533 |
| 191 | 3300005354 | Ga0070675_100002574 | Ga0070675_10000257412 | 533 |
| 192 | 3300005441 | Ga0070700_100004262 | Ga0070700_1000042621 | 533 |
| 193 | 3300005456 | Ga0070678_100144684 | Ga0070678_1001446842 | 533 |
| 194 | 3300005564 | Ga0070664_100028557 | Ga0070664_1000285574 | 533 |
| 195 | 3300005719 | Ga0068861_100062254 | Ga0068861_1000622543 | 533 |
| 196 | 3300014325 | Ga0163163_10225399 | Ga0163163_102253991 | 533 |
| 197 | 3300025907 | Ga0207645_10033284 | Ga0207645_100332843 | 533 |
| 198 | 3300025923 | Ga0207681_10104363 | Ga0207681_101043632 | 533 |
| 199 | 3300025934 | Ga0207686_10016114 | Ga0207686_100161142 | 533 |
| 200 | 3300025940 | Ga0207691_10154562 | Ga0207691_101545622 | 533 |
| 201 | 3300025942 | Ga0207689_10004452 | Ga0207689_100044523 | 533 |
| 202 | 3300025945 | Ga0207679_10003763 | Ga0207679_100037634 | 533 |
| 203 | 3300025972 | Ga0207668_10101913 | Ga0207668_101019132 | 533 |
| 204 | 3300026089 | Ga0207648_10067184 | Ga0207648_100671842 | 533 |
| 205 | 3300005354 | Ga0070675_100004249 | Ga0070675_1000042491 | 534 |
| 206 | 3300005367 | Ga0070667_100006723 | Ga0070667_1000067233 | 534 |
| 207 | 3300005444 | Ga0070694_100000606 | Ga0070694_10000060616 | 534 |
| 208 | 3300005548 | Ga0070665_100010272 | Ga0070665_1000102728 | 534 |
| 209 | 3300005981 | Ga0081538_10000006 | Ga0081538_1000000619 | 534 |
| 210 | 3300025986 | Ga0207658_10007664 | Ga0207658_100076644 | 534 |
| 211 | 3300028379 | Ga0268266_10000264 | Ga0268266_1000026430 | 534 |
| 212 | 3300028381 | Ga0268264_10110890 | Ga0268264_101108902 | 534 |
| 213 | 3300044712 | Ga0453684_0052448 | Ga0453684_0052448_2464_4113 | 534 |
| 214 | 3300046477 | Ga0495664_0000012 | Ga0495664_0000012_185812_187533 | 534 |
| 215 | 3300048906 | Ga0496103_0023229 | Ga0496103_0023229_1207_2892 | 534 |
| 216 | 3300048907 | Ga0496104_0016788 | Ga0496104_0016788_2895_4565 | 534 |
| 217 | 3300048908 | Ga0496105_0018671 | Ga0496105_0018671_1221_2891 | 534 |
| 218 | 3300048909 | Ga0496106_0076105 | Ga0496106_0076105_845_2515 | 534 |
| 219 | 3300048910 | Ga0496107_0035024 | Ga0496107_0035024_1341_3011 | 534 |
| 220 | 3300048919 | Ga0496116_0000176 | Ga0496116_0000176_58544_60214 | 534 |
| 221 | 3300048920 | Ga0496117_0002967 | Ga0496117_0002967_17238_18923 | 534 |
| 222 | 3300048922 | Ga0496119_0001444 | Ga0496119_0001444_4086_5756 | 534 |
| 223 | 3300048922 | Ga0496119_0006106 | Ga0496119_0006106_26_1696 | 534 |
| 224 | 3300048924 | Ga0496121_0014377 | Ga0496121_0014377_1885_3555 | 534 |
| 225 | 3300053077 | Ga0495601_0008867 | Ga0495601_0008867_3194_4915 | 534 |
| 226 | 3300005338 | Ga0068868_100088288 | Ga0068868_1000882882 | 535 |
| 227 | 3300037853 | Ga0436364_0154387 | Ga0436364_0154387_348_2072 | 535 |
| 228 | 3300047317 | Ga0495604_0103329 | Ga0495604_0103329_88_1812 | 535 |
| 229 | 3300006847 | Ga0075431_100070259 | Ga0075431_1000702593 | 536 |
| 230 | 3300035725 | Ga0373947_0088568 | Ga0373947_0088568_38_1867 | 537 |
| 231 | 3300047317 | Ga0495604_0000190 | Ga0495604_0000190_3772_5544 | 537 |
| 232 | 3300048924 | Ga0496121_0004005 | Ga0496121_0004005_15876_17630 | 537 |
| 233 | 3300006178 | Ga0075367_10007323 | Ga0075367_100073233 | 538 |
| 234 | 3300048903 | Ga0496100_0020337 | Ga0496100_0020337_748_2484 | 538 |
| 235 | 3300048929 | Ga0496126_0003514 | Ga0496126_0003514_2035_3726 | 538 |
| 236 | 3300050492 | nmdc:mga0yw44_18945_c1 | nmdc:mga0yw44_18945_c1_972_2714 | 538 |
| 237 | 3300053096 | Ga0500641_0005118 | Ga0500641_0005118_1173_2915 | 538 |
| 238 | 3300046460 | Ga0495638_0013818 | Ga0495638_0013818_3499_5241 | 539 |
| 239 | 3300005518 | Ga0070699_100015977 | Ga0070699_1000159774 | 540 |
| 240 | 3300006051 | Ga0075364_10000724 | Ga0075364_100007249 | 540 |
| 241 | 3300006051 | Ga0075364_10019874 | Ga0075364_100198743 | 540 |
| 242 | 3300050491 | nmdc:mga00v17_34182_c1 | nmdc:mga00v17_34182_c1_343_1998 | 540 |
| 243 | 3300048923 | Ga0496120_0003250 | Ga0496120_0003250_4004_5710 | 541 |
| 244 | 3300048924 | Ga0496121_0014861 | Ga0496121_0014861_1648_3354 | 541 |
| 245 | 3300048928 | Ga0496125_0028123 | Ga0496125_0028123_2450_4156 | 541 |
| 246 | 3300042876 | Ga0451577_0023154 | Ga0451577_0023154_593_2257 | 542 |
| 247 | 3300042876 | Ga0451577_0026266 | Ga0451577_0026266_150_1844 | 542 |
| 248 | 3300044712 | Ga0453684_0012309 | Ga0453684_0012309_11535_13349 | 542 |
| 249 | 3300053077 | Ga0495601_0019043 | Ga0495601_0019043_1144_2904 | 542 |
| 250 | 3300048929 | Ga0496126_0023298 | Ga0496126_0023298_101_1831 | 543 |
| 251 | 3300049593 | Ga0501077_0026890 | Ga0501077_0026890_595_2367 | 543 |
| 252 | 3300005545 | Ga0070695_100011036 | Ga0070695_1000110363 | 544 |
| 253 | 3300009093 | Ga0105240_10062437 | Ga0105240_100624372 | 544 |
| 254 | 3300014325 | Ga0163163_10064218 | Ga0163163_100642183 | 544 |
| 255 | 3300031251 | Ga0265327_10001841 | Ga0265327_1000184114 | 544 |
| 256 | 3300006844 | Ga0075428_100000538 | Ga0075428_10000053835 | 545 |
| 257 | 3300006846 | Ga0075430_100000022 | Ga0075430_10000002269 | 545 |
| 258 | 3300006847 | Ga0075431_100027664 | Ga0075431_1000276644 | 545 |
| 259 | 3300006880 | Ga0075429_100000069 | Ga0075429_10000006942 | 545 |
| 260 | 3300046472 | Ga0495580_0022002 | Ga0495580_0022002_1052_2761 | 545 |
| 261 | 3300047321 | Ga0495676_0045786 | Ga0495676_0045786_1055_2764 | 545 |
| 262 | 3300047322 | Ga0495680_0108170 | Ga0495680_0108170_354_2054 | 545 |
| 263 | 3300050508 | nmdc:mga09592_405_c1 | nmdc:mga09592_405_c1_1696_3417 | 545 |
| 264 | 3300050509 | nmdc:mga0qj67_302_c1 | nmdc:mga0qj67_302_c1_7026_8747 | 545 |
| 265 | 3300050510 | nmdc:mga06r32_21166_c1 | nmdc:mga06r32_21166_c1_2713_4434 | 545 |
| 266 | 3300045976 | Ga0466967_0141287 | Ga0466967_0141287_21_1736 | 546 |
| 267 | 3300053085 | Ga0495619_0053584 | Ga0495619_0053584_903_2642 | 546 |
| 268 | 3300005353 | Ga0070669_100016569 | Ga0070669_1000165694 | 547 |
| 269 | 3300005441 | Ga0070700_100007622 | Ga0070700_1000076224 | 547 |
| 270 | 3300005457 | Ga0070662_100027455 | Ga0070662_1000274552 | 547 |
| 271 | 3300025913 | Ga0207695_10029271 | Ga0207695_100292716 | 547 |
| 272 | 3300025923 | Ga0207681_10004762 | Ga0207681_100047625 | 547 |
| 273 | 3300025927 | Ga0207687_10009645 | Ga0207687_100096455 | 547 |
| 274 | 3300027378 | Ga0209981_1000162 | Ga0209981_10001621 | 547 |
| 275 | 3300031251 | Ga0265327_10002681 | Ga0265327_100026812 | 547 |
| 276 | 3300032126 | Ga0307415_100054497 | Ga0307415_1000544972 | 547 |
| 277 | 3300005330 | Ga0070690_100002234 | Ga0070690_1000022343 | 548 |
| 278 | 3300005331 | Ga0070670_100006871 | Ga0070670_1000068713 | 548 |
| 279 | 3300005333 | Ga0070677_10003228 | Ga0070677_100032284 | 548 |
| 280 | 3300005336 | Ga0070680_100001202 | Ga0070680_1000012023 | 548 |
| 281 | 3300005338 | Ga0068868_100011537 | Ga0068868_1000115374 | 548 |
| 282 | 3300005340 | Ga0070689_100013395 | Ga0070689_1000133954 | 548 |
| 283 | 3300005347 | Ga0070668_100005046 | Ga0070668_1000050467 | 548 |
| 284 | 3300005356 | Ga0070674_100000865 | Ga0070674_1000008655 | 548 |
| 285 | 3300005366 | Ga0070659_100034509 | Ga0070659_1000345092 | 548 |
| 286 | 3300005367 | Ga0070667_100003919 | Ga0070667_1000039199 | 548 |
| 287 | 3300005440 | Ga0070705_100020583 | Ga0070705_1000205832 | 548 |
| 288 | 3300005458 | Ga0070681_10021331 | Ga0070681_100213314 | 548 |
| 289 | 3300005459 | Ga0068867_100002418 | Ga0068867_1000024187 | 548 |
| 290 | 3300005530 | Ga0070679_100062244 | Ga0070679_1000622442 | 548 |
| 291 | 3300005543 | Ga0070672_100093007 | Ga0070672_1000930072 | 548 |
| 292 | 3300005545 | Ga0070695_100024880 | Ga0070695_1000248803 | 548 |
| 293 | 3300005547 | Ga0070693_100041862 | Ga0070693_1000418621 | 548 |
| 294 | 3300005563 | Ga0068855_100216079 | Ga0068855_1002160792 | 548 |
| 295 | 3300005577 | Ga0068857_100026351 | Ga0068857_1000263512 | 548 |
| 296 | 3300005843 | Ga0068860_100053803 | Ga0068860_1000538032 | 548 |
| 297 | 3300006058 | Ga0075432_10001488 | Ga0075432_100014882 | 548 |
| 298 | 3300006237 | Ga0097621_100006479 | Ga0097621_1000064792 | 548 |
| 299 | 3300006358 | Ga0068871_100098676 | Ga0068871_1000986762 | 548 |
| 300 | 3300006846 | Ga0075430_100043207 | Ga0075430_1000432073 | 548 |
| 301 | 3300006880 | Ga0075429_100019577 | Ga0075429_1000195774 | 548 |
| 302 | 3300006881 | Ga0068865_100023984 | Ga0068865_1000239842 | 548 |
| 303 | 3300007076 | Ga0075435_100013974 | Ga0075435_1000139744 | 548 |
| 304 | 3300007265 | Ga0099794_10001536 | Ga0099794_100015365 | 548 |
| 305 | 3300009098 | Ga0105245_10004403 | Ga0105245_1000440311 | 548 |
| 306 | 3300009148 | Ga0105243_10002135 | Ga0105243_100021352 | 548 |
| 307 | 3300009176 | Ga0105242_10000479 | Ga0105242_1000047918 | 548 |
| 308 | 3300009553 | Ga0105249_10019551 | Ga0105249_100195512 | 548 |
| 309 | 3300010375 | Ga0105239_10017132 | Ga0105239_100171322 | 548 |
| 310 | 3300011119 | Ga0105246_10000806 | Ga0105246_100008063 | 548 |
| 311 | 3300013297 | Ga0157378_10003105 | Ga0157378_1000310510 | 548 |
| 312 | 3300014326 | Ga0157380_10007013 | Ga0157380_100070135 | 548 |
| 313 | 3300014745 | Ga0157377_10013792 | Ga0157377_100137922 | 548 |
| 314 | 3300014969 | Ga0157376_10011158 | Ga0157376_100111582 | 548 |
| 315 | 3300025901 | Ga0207688_10005394 | Ga0207688_100053947 | 548 |
| 316 | 3300025907 | Ga0207645_10000134 | Ga0207645_1000013427 | 548 |
| 317 | 3300025912 | Ga0207707_10053735 | Ga0207707_100537351 | 548 |
| 318 | 3300025918 | Ga0207662_10002099 | Ga0207662_100020994 | 548 |
| 319 | 3300025919 | Ga0207657_10012644 | Ga0207657_100126449 | 548 |
| 320 | 3300025921 | Ga0207652_10146131 | Ga0207652_101461311 | 548 |
| 321 | 3300025932 | Ga0207690_10070541 | Ga0207690_100705412 | 548 |
| 322 | 3300025933 | Ga0207706_10000433 | Ga0207706_1000043325 | 548 |
| 323 | 3300025937 | Ga0207669_10017005 | Ga0207669_100170053 | 548 |
| 324 | 3300025938 | Ga0207704_10011927 | Ga0207704_100119273 | 548 |
| 325 | 3300025939 | Ga0207665_10018688 | Ga0207665_100186884 | 548 |
| 326 | 3300025940 | Ga0207691_10002262 | Ga0207691_100022624 | 548 |
| 327 | 3300025961 | Ga0207712_10010069 | Ga0207712_100100694 | 548 |
| 328 | 3300026023 | Ga0207677_10025766 | Ga0207677_100257663 | 548 |
| 329 | 3300026075 | Ga0207708_10000394 | Ga0207708_1000039420 | 548 |
| 330 | 3300026089 | Ga0207648_10000557 | Ga0207648_1000055715 | 548 |
| 331 | 3300026116 | Ga0207674_10037265 | Ga0207674_100372655 | 548 |
| 332 | 3300026121 | Ga0207683_10000361 | Ga0207683_1000036128 | 548 |
| 333 | 3300027360 | Ga0209969_1000272 | Ga0209969_10002722 | 548 |
| 334 | 3300027364 | Ga0209967_1000170 | Ga0209967_10001707 | 548 |
| 335 | 3300027424 | Ga0209984_1000274 | Ga0209984_10002742 | 548 |
| 336 | 3300027462 | Ga0210000_1000280 | Ga0210000_10002802 | 548 |
| 337 | 3300027471 | Ga0209995_1000103 | Ga0209995_10001037 | 548 |
| 338 | 3300027552 | Ga0209982_1000036 | Ga0209982_10000369 | 548 |
| 339 | 3300027617 | Ga0210002_1000089 | Ga0210002_10000898 | 548 |
| 340 | 3300027665 | Ga0209983_1000237 | Ga0209983_10002372 | 548 |
| 341 | 3300027695 | Ga0209966_1000553 | Ga0209966_10005537 | 548 |
| 342 | 3300027717 | Ga0209998_10000014 | Ga0209998_100000142 | 548 |
| 343 | 3300027907 | Ga0207428_10021185 | Ga0207428_100211854 | 548 |
| 344 | 3300044694 | Ga0466963_0032574 | Ga0466963_0032574_71_1834 | 548 |
| 345 | 3300049575 | Ga0501039_0034932 | Ga0501039_0034932_763_2484 | 548 |
| 346 | 3300049588 | Ga0501072_0004269 | Ga0501072_0004269_7697_9418 | 548 |
| 347 | 3300049591 | Ga0501075_0013557 | Ga0501075_0013557_2955_4754 | 548 |
| 348 | 3300049592 | Ga0501076_0014867 | Ga0501076_0014867_2514_4244 | 548 |
| 349 | 3300049593 | Ga0501077_0035180 | Ga0501077_0035180_435_2156 | 548 |
| 350 | 3300049741 | Ga0501079_0074484 | Ga0501079_0074484_744_2465 | 548 |
| 351 | 3300050507 | nmdc:mga05p37_21210_c1 | nmdc:mga05p37_21210_c1_133_1905 | 548 |
| 352 | 3300050509 | nmdc:mga0qj67_16683_c1 | nmdc:mga0qj67_16683_c1_970_2742 | 548 |
| 353 | 3300050514 | nmdc:mga08x19_61390_c1 | nmdc:mga08x19_61390_c1_127_1899 | 548 |
| 354 | 3300050515 | nmdc:mga0a205_127515_c1 | nmdc:mga0a205_127515_c1_249_2021 | 548 |
| 355 | 3300028558 | Ga0265326_10000621 | Ga0265326_100006216 | 549 |
| 356 | 3300028563 | Ga0265319_1005656 | Ga0265319_10056565 | 549 |
| 357 | 3300028666 | Ga0265336_10000005 | Ga0265336_10000005304 | 549 |
| 358 | 3300028800 | Ga0265338_10000001 | Ga0265338_100000011122 | 549 |
| 359 | 3300029957 | Ga0265324_10021184 | Ga0265324_100211842 | 549 |
| 360 | 3300031247 | Ga0265340_10000001 | Ga0265340_100000011120 | 549 |
| 361 | 3300049576 | Ga0501040_0023647 | Ga0501040_0023647_368_2161 | 549 |
| 362 | 3300049578 | Ga0501042_0029580 | Ga0501042_0029580_1236_3029 | 549 |
| 363 | 3300049822 | Ga0501035_0093010 | Ga0501035_0093010_72_1865 | 549 |
| 364 | 3300049824 | Ga0501045_0089350 | Ga0501045_0089350_150_1943 | 549 |
| 365 | 3300005467 | Ga0070706_100053398 | Ga0070706_1000533982 | 550 |
| 366 | 3300031548 | Ga0307408_100059961 | Ga0307408_1000599611 | 550 |
| 367 | 3300006871 | Ga0075434_100019970 | Ga0075434_1000199702 | 551 |
| 368 | 3300009094 | Ga0111539_10018478 | Ga0111539_100184785 | 551 |
| 369 | 3300009147 | Ga0114129_10065834 | Ga0114129_100658345 | 551 |
| 370 | 3300009553 | Ga0105249_10025298 | Ga0105249_100252986 | 551 |
| 371 | 3300044712 | Ga0453684_0000072 | Ga0453684_0000072_104030_105730 | 551 |
| 372 | 3300046461 | Ga0495641_0001114 | Ga0495641_0001114_19141_20859 | 551 |
| 373 | 3300050507 | nmdc:mga05p37_44861_c1 | nmdc:mga05p37_44861_c1_629_2389 | 551 |
| 374 | 3300050514 | nmdc:mga08x19_51140_c1 | nmdc:mga08x19_51140_c1_411_2135 | 552 |
| 375 | 3300050515 | nmdc:mga0a205_6077_c1 | nmdc:mga0a205_6077_c1_158_1882 | 552 |
| 376 | 3300005468 | Ga0070707_100036153 | Ga0070707_1000361534 | 553 |
| 377 | 3300006847 | Ga0075431_100112489 | Ga0075431_1001124892 | 553 |
| 378 | 3300014745 | Ga0157377_10013662 | Ga0157377_100136621 | 553 |
| 379 | 3300025922 | Ga0207646_10165281 | Ga0207646_101652811 | 553 |
| 380 | 3300050515 | nmdc:mga0a205_2674_c1 | nmdc:mga0a205_2674_c1_3898_5610 | 553 |
| 381 | 3300005444 | Ga0070694_100050542 | Ga0070694_1000505422 | 554 |
| 382 | 3300005467 | Ga0070706_100110745 | Ga0070706_1001107452 | 554 |
| 383 | 3300005471 | Ga0070698_100023799 | Ga0070698_1000237993 | 554 |
| 384 | 3300005518 | Ga0070699_100070280 | Ga0070699_1000702802 | 554 |
| 385 | 3300005536 | Ga0070697_100019654 | Ga0070697_1000196544 | 554 |
| 386 | 3300009176 | Ga0105242_10048633 | Ga0105242_100486332 | 554 |
| 387 | 3300025910 | Ga0207684_10001278 | Ga0207684_1000127812 | 554 |
| 388 | 3300025922 | Ga0207646_10000311 | Ga0207646_1000031120 | 554 |
| 389 | 3300042876 | Ga0451577_0005547 | Ga0451577_0005547_9910_11637 | 554 |
| 390 | 3300049569 | Ga0501032_0017545 | Ga0501032_0017545_3266_5008 | 555 |
| 391 | 3300049576 | Ga0501040_0025428 | Ga0501040_0025428_1788_3512 | 555 |
| 392 | 3300049577 | Ga0501041_0034230 | Ga0501041_0034230_930_2654 | 555 |
| 393 | 3300049578 | Ga0501042_0065925 | Ga0501042_0065925_739_2463 | 555 |
| 394 | 3300049580 | Ga0501046_0056469 | Ga0501046_0056469_1036_2760 | 555 |
| 395 | 3300049588 | Ga0501072_0078213 | Ga0501072_0078213_796_2550 | 555 |
| 396 | 3300049592 | Ga0501076_0015737 | Ga0501076_0015737_1544_3298 | 555 |
| 397 | 3300049593 | Ga0501077_0073771 | Ga0501077_0073771_35_1789 | 555 |
| 398 | 3300049743 | Ga0501081_0050144 | Ga0501081_0050144_938_2692 | 555 |
| 399 | 3300060353 | Ga0501082_0002443 | Ga0501082_0002443_3308_5032 | 555 |
| 400 | 3300005336 | Ga0070680_100100415 | Ga0070680_1001004152 | 556 |
| 401 | 3300005345 | Ga0070692_10010491 | Ga0070692_100104912 | 556 |
| 402 | 3300005438 | Ga0070701_10001128 | Ga0070701_100011287 | 556 |
| 403 | 3300005444 | Ga0070694_100033217 | Ga0070694_1000332172 | 556 |
| 404 | 3300005545 | Ga0070695_100029601 | Ga0070695_1000296012 | 556 |
| 405 | 3300005937 | Ga0081455_10018220 | Ga0081455_100182205 | 556 |
| 406 | 3300006358 | Ga0068871_100003744 | Ga0068871_1000037442 | 556 |
| 407 | 3300006844 | Ga0075428_100004141 | Ga0075428_10000414115 | 556 |
| 408 | 3300006846 | Ga0075430_100014570 | Ga0075430_1000145707 | 556 |
| 409 | 3300006847 | Ga0075431_100017262 | Ga0075431_1000172627 | 556 |
| 410 | 3300006852 | Ga0075433_10022968 | Ga0075433_100229682 | 556 |
| 411 | 3300006880 | Ga0075429_100021045 | Ga0075429_1000210452 | 556 |
| 412 | 3300009147 | Ga0114129_10065170 | Ga0114129_100651702 | 556 |
| 413 | 3300013308 | Ga0157375_10028173 | Ga0157375_100281732 | 556 |
| 414 | 3300025926 | Ga0207659_10002985 | Ga0207659_100029856 | 556 |
| 415 | 3300025933 | Ga0207706_10014061 | Ga0207706_100140613 | 556 |
| 416 | 3300025945 | Ga0207679_10000816 | Ga0207679_100008164 | 556 |
| 417 | 3300035695 | Ga0373927_0003744 | Ga0373927_0003744_1924_3648 | 556 |
| 418 | 3300037068 | Ga0373925_0003041 | Ga0373925_0003041_4324_6048 | 556 |
| 419 | 3300048907 | Ga0496104_0058523 | Ga0496104_0058523_824_2575 | 556 |
| 420 | 3300048917 | Ga0496114_0015247 | Ga0496114_0015247_2530_4281 | 556 |
| 421 | 3300049573 | Ga0501037_0124783 | Ga0501037_0124783_13_1764 | 556 |
| 422 | 3300049585 | Ga0501069_0021301 | Ga0501069_0021301_19_1770 | 556 |
| 423 | 3300050509 | nmdc:mga0qj67_32926_c1 | nmdc:mga0qj67_32926_c1_195_1910 | 556 |
| 424 | 3300050510 | nmdc:mga06r32_6387_c1 | nmdc:mga06r32_6387_c1_1002_2717 | 556 |
| 425 | 3300049574 | Ga0501038_0076358 | Ga0501038_0076358_816_2570 | 557 |
| 426 | 3300049575 | Ga0501039_0056957 | Ga0501039_0056957_442_2196 | 557 |
| 427 | 3300005445 | Ga0070708_100000766 | Ga0070708_1000007666 | 558 |
| 428 | 3300005467 | Ga0070706_100069209 | Ga0070706_1000692092 | 558 |
| 429 | 3300005471 | Ga0070698_100101129 | Ga0070698_1001011291 | 558 |
| 430 | 3300005981 | Ga0081538_10000185 | Ga0081538_1000018528 | 558 |
| 431 | 3300005981 | Ga0081538_10001125 | Ga0081538_100011258 | 558 |
| 432 | 3300006847 | Ga0075431_100118930 | Ga0075431_1001189302 | 558 |
| 433 | 3300031727 | Ga0316576_10024737 | Ga0316576_100247374 | 558 |
| 434 | 3300031733 | Ga0316577_10006313 | Ga0316577_100063136 | 558 |
| 435 | 3300042461 | Ga0439460_0011819 | Ga0439460_0011819_292_2010 | 558 |
| 436 | 3300042993 | Ga0439440_0001118 | Ga0439440_0001118_1961_3679 | 558 |
| 437 | 3300049575 | Ga0501039_0118994 | Ga0501039_0118994_288_2006 | 558 |
| 438 | 3300049576 | Ga0501040_0043555 | Ga0501040_0043555_189_1907 | 558 |
| 439 | 3300049741 | Ga0501079_0026522 | Ga0501079_0026522_1942_3660 | 558 |
| 440 | 3300050507 | nmdc:mga05p37_117857_c1 | nmdc:mga05p37_117857_c1_1041_2759 | 558 |
| 441 | 3300005468 | Ga0070707_100004903 | Ga0070707_10000490313 | 559 |
| 442 | 3300006846 | Ga0075430_100000126 | Ga0075430_10000012629 | 559 |
| 443 | 3300025910 | Ga0207684_10011397 | Ga0207684_100113974 | 559 |
| 444 | 3300050507 | nmdc:mga05p37_19885_c1 | nmdc:mga05p37_19885_c1_1789_3591 | 559 |
| 445 | 3300050509 | nmdc:mga0qj67_2445_c1 | nmdc:mga0qj67_2445_c1_8666_10468 | 559 |
| 446 | 3300005367 | Ga0070667_100008294 | Ga0070667_1000082945 | 560 |
| 447 | 3300005457 | Ga0070662_100102847 | Ga0070662_1001028471 | 560 |
| 448 | 3300005981 | Ga0081538_10007201 | Ga0081538_100072017 | 560 |
| 449 | 3300006847 | Ga0075431_100062606 | Ga0075431_1000626062 | 560 |
| 450 | 3300006852 | Ga0075433_10000868 | Ga0075433_1000086819 | 560 |
| 451 | 3300009094 | Ga0111539_10000274 | Ga0111539_1000027410 | 560 |
| 452 | 3300025933 | Ga0207706_10090275 | Ga0207706_100902751 | 560 |
| 453 | 3300025986 | Ga0207658_10018850 | Ga0207658_100188503 | 560 |
| 454 | 3300027907 | Ga0207428_10000426 | Ga0207428_1000042651 | 560 |
| 455 | 3300031691 | Ga0316579_10017057 | Ga0316579_100170572 | 560 |
| 456 | 3300035691 | Ga0373931_0002440 | Ga0373931_0002440_5146_6870 | 560 |
| 457 | 3300042876 | Ga0451577_0001787 | Ga0451577_0001787_3229_4950 | 560 |
| 458 | 3300044712 | Ga0453684_0037153 | Ga0453684_0037153_147_1868 | 560 |
| 459 | 3300044712 | Ga0453684_0068036 | Ga0453684_0068036_1089_2816 | 560 |
| 460 | 3300045051 | Ga0451576_0089859 | Ga0451576_0089859_1036_2757 | 560 |
| 461 | 3300048909 | Ga0496106_0086688 | Ga0496106_0086688_306_2030 | 560 |
| 462 | 3300049590 | Ga0501074_0062018 | Ga0501074_0062018_252_1979 | 560 |
| 463 | 3300050512 | nmdc:mga0n895_26597_c1 | nmdc:mga0n895_26597_c1_989_2716 | 560 |
| 464 | 3300050512 | nmdc:mga0n895_28653_c1 | nmdc:mga0n895_28653_c1_981_2702 | 560 |
| 465 | 3300050513 | nmdc:mga0rr50_55433_c1 | nmdc:mga0rr50_55433_c1_63_1790 | 560 |
| 466 | 3300050514 | nmdc:mga08x19_7279_c1 | nmdc:mga08x19_7279_c1_3350_5074 | 560 |
| 467 | 3300050515 | nmdc:mga0a205_4128_c1 | nmdc:mga0a205_4128_c1_5141_6862 | 560 |
| 468 | 3300050515 | nmdc:mga0a205_4535_c1 | nmdc:mga0a205_4535_c1_9102_10823 | 560 |
| 469 | 3300005340 | Ga0070689_100082042 | Ga0070689_1000820421 | 561 |
| 470 | 3300006051 | Ga0075364_10017851 | Ga0075364_100178513 | 561 |
| 471 | 3300006844 | Ga0075428_100003176 | Ga0075428_1000031762 | 561 |
| 472 | 3300009094 | Ga0111539_10016794 | Ga0111539_100167946 | 561 |
| 473 | 3300009094 | Ga0111539_10136005 | Ga0111539_101360052 | 561 |
| 474 | 3300009147 | Ga0114129_10000830 | Ga0114129_1000083016 | 561 |
| 475 | 3300009553 | Ga0105249_10023725 | Ga0105249_100237255 | 561 |
| 476 | 3300013306 | Ga0163162_10010688 | Ga0163162_100106882 | 561 |
| 477 | 3300025923 | Ga0207681_10010335 | Ga0207681_100103354 | 561 |
| 478 | 3300025936 | Ga0207670_10034436 | Ga0207670_100344361 | 561 |
| 479 | 3300027907 | Ga0207428_10010288 | Ga0207428_100102885 | 561 |
| 480 | 3300028381 | Ga0268264_10161779 | Ga0268264_101617791 | 561 |
| 481 | 3300031691 | Ga0316579_10003307 | Ga0316579_100033074 | 561 |
| 482 | 3300036712 | Ga0316584_0000757 | Ga0316584_0000757_15677_17413 | 561 |
| 483 | 3300036712 | Ga0316584_0022454 | Ga0316584_0022454_2176_3912 | 561 |
| 484 | 3300037418 | Ga0395900_0005975 | Ga0395900_0005975_7619_9379 | 561 |
| 485 | 3300037466 | Ga0395898_0012550 | Ga0395898_0012550_6238_8001 | 561 |
| 486 | 3300037471 | Ga0395905_0021240 | Ga0395905_0021240_902_2662 | 561 |
| 487 | 3300038443 | Ga0395901_0009290 | Ga0395901_0009290_4864_6627 | 561 |
| 488 | 3300038443 | Ga0395901_0010764 | Ga0395901_0010764_3972_5732 | 561 |
| 489 | 3300049569 | Ga0501032_0037486 | Ga0501032_0037486_1383_3113 | 561 |
| 490 | 3300049570 | Ga0501033_0013165 | Ga0501033_0013165_3830_5560 | 561 |
| 491 | 3300049572 | Ga0501036_0002059 | Ga0501036_0002059_4201_5931 | 561 |
| 492 | 3300049572 | Ga0501036_0031963 | Ga0501036_0031963_43_1773 | 561 |
| 493 | 3300049574 | Ga0501038_0017202 | Ga0501038_0017202_1242_2972 | 561 |
| 494 | 3300049575 | Ga0501039_0014387 | Ga0501039_0014387_4201_5931 | 561 |
| 495 | 3300049576 | Ga0501040_0001522 | Ga0501040_0001522_4568_6298 | 561 |
| 496 | 3300049576 | Ga0501040_0006557 | Ga0501040_0006557_4618_6348 | 561 |
| 497 | 3300049577 | Ga0501041_0007553 | Ga0501041_0007553_1062_2792 | 561 |
| 498 | 3300049578 | Ga0501042_0001724 | Ga0501042_0001724_1369_3099 | 561 |
| 499 | 3300049578 | Ga0501042_0011854 | Ga0501042_0011854_3552_5282 | 561 |
| 500 | 3300049578 | Ga0501042_0020204 | Ga0501042_0020204_111_1841 | 561 |
| 501 | 3300049580 | Ga0501046_0062494 | Ga0501046_0062494_1011_2741 | 561 |
| 502 | 3300049582 | Ga0501048_0004425 | Ga0501048_0004425_4703_6433 | 561 |
| 503 | 3300049582 | Ga0501048_0026309 | Ga0501048_0026309_1185_2915 | 561 |
| 504 | 3300049584 | Ga0501068_0039269 | Ga0501068_0039269_1080_2810 | 561 |
| 505 | 3300049587 | Ga0501071_0000146 | Ga0501071_0000146_5724_7454 | 561 |
| 506 | 3300049587 | Ga0501071_0084832 | Ga0501071_0084832_433_2163 | 561 |
| 507 | 3300049588 | Ga0501072_0001102 | Ga0501072_0001102_6333_8063 | 561 |
| 508 | 3300049588 | Ga0501072_0003271 | Ga0501072_0003271_290_2020 | 561 |
| 509 | 3300049589 | Ga0501073_0099530 | Ga0501073_0099530_150_1880 | 561 |
| 510 | 3300049590 | Ga0501074_0009485 | Ga0501074_0009485_4585_6315 | 561 |
| 511 | 3300049591 | Ga0501075_0000052 | Ga0501075_0000052_38301_40031 | 561 |
| 512 | 3300049591 | Ga0501075_0000387 | Ga0501075_0000387_18975_20705 | 561 |
| 513 | 3300049592 | Ga0501076_0000744 | Ga0501076_0000744_7333_9063 | 561 |
| 514 | 3300049592 | Ga0501076_0000935 | Ga0501076_0000935_8224_9954 | 561 |
| 515 | 3300049592 | Ga0501076_0007345 | Ga0501076_0007345_1270_3000 | 561 |
| 516 | 3300049741 | Ga0501079_0000292 | Ga0501079_0000292_17852_19582 | 561 |
| 517 | 3300049742 | Ga0501080_0000228 | Ga0501080_0000228_23646_25376 | 561 |
| 518 | 3300049743 | Ga0501081_0000416 | Ga0501081_0000416_20564_22294 | 561 |
| 519 | 3300049743 | Ga0501081_0054175 | Ga0501081_0054175_236_2029 | 561 |
| 520 | 3300049822 | Ga0501035_0012623 | Ga0501035_0012623_5669_7399 | 561 |
| 521 | 3300049824 | Ga0501045_0003796 | Ga0501045_0003796_4563_6293 | 561 |
| 522 | 3300050492 | nmdc:mga0yw44_7343_c1 | nmdc:mga0yw44_7343_c1_1853_3613 | 561 |
| 523 | 3300050507 | nmdc:mga05p37_1820_c1 | nmdc:mga05p37_1820_c1_13455_15185 | 561 |
| 524 | 3300050511 | nmdc:mga08y16_2827_c1 | nmdc:mga08y16_2827_c1_3350_5074 | 561 |
| 525 | 3300054114 | Ga0501084_0000912 | Ga0501084_0000912_6332_8062 | 561 |
| 526 | 3300060353 | Ga0501082_0008754 | Ga0501082_0008754_373_2103 | 561 |
| 527 | 3300060353 | Ga0501082_0038968 | Ga0501082_0038968_350_2080 | 561 |
| 528 | 3300061734 | Ga0530510_0000017 | Ga0530510_0000017_35783_37513 | 561 |
| 529 | 3300061734 | Ga0530510_0000168 | Ga0530510_0000168_1159_2883 | 561 |
| 530 | 3300061734 | Ga0530510_0007392 | Ga0530510_0007392_3552_5282 | 561 |
| 531 | 3300061734 | Ga0530510_0009273 | Ga0530510_0009273_4680_6410 | 561 |
| 532 | 3300037466 | Ga0395898_0145767 | Ga0395898_0145767_548_2248 | 562 |
| 533 | 3300038443 | Ga0395901_0197065 | Ga0395901_0197065_322_2088 | 562 |
| 534 | 3300048905 | Ga0496102_0212050 | Ga0496102_0212050_20_1720 | 562 |
| 535 | 3300048918 | Ga0496115_0000035 | Ga0496115_0000035_84813_86552 | 562 |
| 536 | 3300005330 | Ga0070690_100000305 | Ga0070690_1000003054 | 563 |
| 537 | 3300005343 | Ga0070687_100002317 | Ga0070687_1000023172 | 563 |
| 538 | 3300005364 | Ga0070673_100138022 | Ga0070673_1001380221 | 563 |
| 539 | 3300005365 | Ga0070688_100006698 | Ga0070688_1000066986 | 563 |
| 540 | 3300005543 | Ga0070672_100000197 | Ga0070672_10000019725 | 563 |
| 541 | 3300005544 | Ga0070686_100005443 | Ga0070686_1000054432 | 563 |
| 542 | 3300006846 | Ga0075430_100033898 | Ga0075430_1000338983 | 563 |
| 543 | 3300006847 | Ga0075431_100037642 | Ga0075431_1000376422 | 563 |
| 544 | 3300009545 | Ga0105237_10004164 | Ga0105237_1000416412 | 563 |
| 545 | 3300013297 | Ga0157378_10000610 | Ga0157378_1000061038 | 563 |
| 546 | 3300025903 | Ga0207680_10041826 | Ga0207680_100418262 | 563 |
| 547 | 3300025925 | Ga0207650_10031455 | Ga0207650_100314552 | 563 |
| 548 | 3300025940 | Ga0207691_10000080 | Ga0207691_1000008035 | 563 |
| 549 | 3300025960 | Ga0207651_10000078 | Ga0207651_1000007824 | 563 |
| 550 | 3300045051 | Ga0451576_0007659 | Ga0451576_0007659_11007_12779 | 563 |
| 551 | 3300049571 | Ga0501034_0163229 | Ga0501034_0163229_252_2018 | 563 |
| 552 | 3300049575 | Ga0501039_0106997 | Ga0501039_0106997_34_1800 | 563 |
| 553 | 3300049576 | Ga0501040_0098330 | Ga0501040_0098330_213_1985 | 563 |
| 554 | 3300049577 | Ga0501041_0028787 | Ga0501041_0028787_1153_2925 | 563 |
| 555 | 3300049577 | Ga0501041_0041266 | Ga0501041_0041266_914_2680 | 563 |
| 556 | 3300049580 | Ga0501046_0005055 | Ga0501046_0005055_9665_11431 | 563 |
| 557 | 3300049582 | Ga0501048_0049052 | Ga0501048_0049052_500_2272 | 563 |
| 558 | 3300049582 | Ga0501048_0072099 | Ga0501048_0072099_16_1782 | 563 |
| 559 | 3300049592 | Ga0501076_0028117 | Ga0501076_0028117_740_2512 | 563 |
| 560 | 3300049741 | Ga0501079_0081859 | Ga0501079_0081859_13_1785 | 563 |
| 561 | 3300054114 | Ga0501084_0036170 | Ga0501084_0036170_831_2603 | 563 |
| 562 | 3300061734 | Ga0530510_0109831 | Ga0530510_0109831_173_1945 | 563 |
| 563 | 3300005336 | Ga0070680_100008822 | Ga0070680_1000088225 | 564 |
| 564 | 3300005546 | Ga0070696_100024483 | Ga0070696_1000244831 | 564 |
| 565 | 3300006847 | Ga0075431_100000203 | Ga0075431_10000020325 | 564 |
| 566 | 3300006852 | Ga0075433_10024377 | Ga0075433_100243775 | 564 |
| 567 | 3300014969 | Ga0157376_10013961 | Ga0157376_100139612 | 564 |
| 568 | 3300026118 | Ga0207675_100126594 | Ga0207675_1001265942 | 564 |
| 569 | 3300031344 | Ga0265316_10000536 | Ga0265316_100005362 | 564 |
| 570 | 3300050510 | nmdc:mga06r32_5740_c1 | nmdc:mga06r32_5740_c1_8564_10366 | 564 |
| 571 | 3300031824 | Ga0307413_10109394 | Ga0307413_101093941 | 565 |
| 572 | 3300031995 | Ga0307409_100040359 | Ga0307409_1000403591 | 565 |
| 573 | 3300049577 | Ga0501041_0016982 | Ga0501041_0016982_2427_4220 | 565 |
| 574 | 3300046517 | Ga0495630_0000891 | Ga0495630_0000891_423_2195 | 566 |
| 575 | 3300046675 | Ga0495657_0000007 | Ga0495657_0000007_144293_146065 | 566 |
| 576 | 3300009147 | Ga0114129_10044693 | Ga0114129_100446933 | 567 |
| 577 | 3300050510 | nmdc:mga06r32_108492_c1 | nmdc:mga06r32_108492_c1_365_2149 | 567 |
| 578 | 3300005330 | Ga0070690_100002631 | Ga0070690_1000026318 | 568 |
| 579 | 3300005340 | Ga0070689_100000158 | Ga0070689_1000001583 | 568 |
| 580 | 3300005365 | Ga0070688_100003566 | Ga0070688_1000035665 | 568 |
| 581 | 3300005437 | Ga0070710_10020150 | Ga0070710_100201502 | 568 |
| 582 | 3300005438 | Ga0070701_10000814 | Ga0070701_100008145 | 568 |
| 583 | 3300005466 | Ga0070685_10000304 | Ga0070685_100003049 | 568 |
| 584 | 3300005544 | Ga0070686_100001064 | Ga0070686_1000010648 | 568 |
| 585 | 3300009177 | Ga0105248_10005285 | Ga0105248_100052853 | 568 |
| 586 | 3300025936 | Ga0207670_10000797 | Ga0207670_100007976 | 568 |
| 587 | 3300025941 | Ga0207711_10023212 | Ga0207711_100232124 | 568 |
| 588 | 3300026075 | Ga0207708_10002710 | Ga0207708_100027103 | 568 |
| 589 | 3300026089 | Ga0207648_10011733 | Ga0207648_100117336 | 568 |
| 590 | 3300050512 | nmdc:mga0n895_25905_c1 | nmdc:mga0n895_25905_c1_443_2236 | 568 |
| 591 | 3300005328 | Ga0070676_10006175 | Ga0070676_100061753 | 569 |
| 592 | 3300005331 | Ga0070670_100005213 | Ga0070670_1000052132 | 569 |
| 593 | 3300005335 | Ga0070666_10003792 | Ga0070666_100037927 | 569 |
| 594 | 3300005338 | Ga0068868_100020604 | Ga0068868_1000206043 | 569 |
| 595 | 3300005354 | Ga0070675_100000972 | Ga0070675_10000097216 | 569 |
| 596 | 3300005355 | Ga0070671_100003350 | Ga0070671_1000033503 | 569 |
| 597 | 3300005356 | Ga0070674_100000802 | Ga0070674_1000008025 | 569 |
| 598 | 3300005364 | Ga0070673_100000143 | Ga0070673_10000014315 | 569 |
| 599 | 3300005456 | Ga0070678_100000378 | Ga0070678_10000037814 | 569 |
| 600 | 3300005459 | Ga0068867_100043609 | Ga0068867_1000436093 | 569 |
| 601 | 3300025937 | Ga0207669_10005346 | Ga0207669_100053463 | 569 |
| 602 | 3300048907 | Ga0496104_0025988 | Ga0496104_0025988_3432_5153 | 569 |
| 603 | 3300048908 | Ga0496105_0002253 | Ga0496105_0002253_6616_8337 | 569 |
| 604 | 3300048909 | Ga0496106_0046899 | Ga0496106_0046899_238_1959 | 569 |
| 605 | 3300048912 | Ga0496109_0013371 | Ga0496109_0013371_3069_4790 | 569 |
| 606 | 3300048912 | Ga0496109_0173032 | Ga0496109_0173032_71_1792 | 569 |
| 607 | 3300048915 | Ga0496112_0053022 | Ga0496112_0053022_1067_2785 | 569 |
| 608 | 3300048916 | Ga0496113_0088786 | Ga0496113_0088786_71_1792 | 569 |
| 609 | 3300005983 | Ga0081540_1000159 | Ga0081540_100015914 | 570 |
| 610 | 3300009094 | Ga0111539_10000081 | Ga0111539_1000008190 | 570 |
| 611 | 3300025914 | Ga0207671_10002923 | Ga0207671_1000292317 | 570 |
| 612 | 3300027907 | Ga0207428_10002909 | Ga0207428_100029093 | 570 |
| 613 | 3300048903 | Ga0496100_0020234 | Ga0496100_0020234_187_2001 | 570 |
| 614 | 3300050511 | nmdc:mga08y16_196_c1 | nmdc:mga08y16_196_c1_35223_37037 | 570 |
| 615 | 3300048918 | Ga0496115_0000143 | Ga0496115_0000143_23281_25050 | 571 |
| 616 | 3300039438 | Ga0436360_0711520 | Ga0436360_0711520_768_2843 | 572 |
| 617 | 3300005548 | Ga0070665_100001080 | Ga0070665_10000108031 | 574 |
| 618 | 3300005985 | Ga0081539_10006735 | Ga0081539_100067355 | 574 |
| 619 | 3300028379 | Ga0268266_10004961 | Ga0268266_100049618 | 574 |
| 620 | 3300005981 | Ga0081538_10013275 | Ga0081538_100132752 | 575 |
| 621 | 3300048924 | Ga0496121_0003484 | Ga0496121_0003484_7465_9201 | 577 |
| 622 | 3300031731 | Ga0307405_10020736 | Ga0307405_100207362 | 578 |
| 623 | 3300031995 | Ga0307409_100014889 | Ga0307409_1000148892 | 578 |
| 624 | 3300032126 | Ga0307415_100001589 | Ga0307415_10000158910 | 578 |
| 625 | 3300032126 | Ga0307415_100101116 | Ga0307415_1001011162 | 578 |
| 626 | 3300005617 | Ga0068859_100076500 | Ga0068859_1000765002 | 581 |
| 627 | 3300005844 | Ga0068862_100123964 | Ga0068862_1001239642 | 581 |
| 628 | 3300006931 | Ga0097620_100076502 | Ga0097620_1000765022 | 581 |
| 629 | 3300048913 | Ga0496110_0082585 | Ga0496110_0082585_467_2212 | 581 |
| 630 | 3300005329 | Ga0070683_100033173 | Ga0070683_1000331732 | 583 |
| 631 | 3300005981 | Ga0081538_10000800 | Ga0081538_100008003 | 585 |
| 632 | 3300005981 | Ga0081538_10058015 | Ga0081538_100580152 | 585 |
| 633 | 3300009094 | Ga0111539_10032707 | Ga0111539_100327073 | 585 |
| 634 | 3300031995 | Ga0307409_100014418 | Ga0307409_1000144183 | 585 |
| 635 | 3300032002 | Ga0307416_100011881 | Ga0307416_1000118815 | 585 |
| 636 | 3300050511 | nmdc:mga08y16_17331_c1 | nmdc:mga08y16_17331_c1_4255_6012 | 585 |
| 637 | 3300049576 | Ga0501040_0072628 | Ga0501040_0072628_104_1867 | 587 |
| 638 | 3300061734 | Ga0530510_0033345 | Ga0530510_0033345_400_2163 | 587 |
| 639 | 3300006844 | Ga0075428_100007682 | Ga0075428_1000076823 | 588 |
| 640 | 3300027907 | Ga0207428_10053680 | Ga0207428_100536803 | 588 |
| 641 | 3300031995 | Ga0307409_100092838 | Ga0307409_1000928382 | 588 |
| 642 | 3300003203 | JGI25406J46586_10021445 | JGI25406J46586_100214452 | 589 |
| 643 | 3300005985 | Ga0081539_10003739 | Ga0081539_1000373913 | 589 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xnh-assembly1.cif.gz_A-2 | crystal structure of nh3-dependent nad+ synthetase from helicobacter pylori | 0.925 | 301 | 550 |
| 3p52-assembly1.cif.gz_A | nh3-dependent nad synthetase from campylobacter jejuni subsp. jejuni nctc 11168 in complex with the nitrate ion | 0.9123 | 297 | 550 |
| 3p52-assembly1.cif.gz_B | nh3-dependent nad synthetase from campylobacter jejuni subsp. jejuni nctc 11168 in complex with the nitrate ion | 0.912 | 298 | 550 |
| 3fiu-assembly2.cif.gz_D | structure of nmn synthetase from francisella tularensis | 0.9015 | 297 | 551 |
| 3n05-assembly1.cif.gz_A | crystal structure of nh3-dependent nad+ synthetase from streptomyces avermitilis | 0.8914 | 8 | 578 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9XXK6_5_292_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9375 | 8 | 254 | 3.60.110.10 |
| 3n05B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9352 | 300 | 489 | 3.40.50.620 |
| 3n05B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9253 | 300 | 489 | 3.40.50.620 |
| 1xnhA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.925 | 301 | 550 | 3.40.50.620 |
| 3fiuC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9248 | 297 | 551 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534NNB0-F1-model_v4 | NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) | 0.9989 | 301 | 436 |
GO:0003952
GO:0004359 GO:0005524 GO:0005737 GO:0008795 GO:0009435 |
| AF-A0A3D2JLK1-F1-model_v4 | NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) | 0.997 | 334 | 438 |
GO:0003952
GO:0004359 GO:0005524 GO:0005737 GO:0008795 GO:0009435 |
| AF-X1DKX7-F1-model_v4 | NAD/GMP synthase domain-containing protein | 0.9889 | 381 | 550 |
GO:0003952
GO:0004359 GO:0005524 GO:0005737 GO:0009435 |
| AF-A0A3N5T2D8-F1-model_v4 | NAD+ synthase | 0.9858 | 8 | 250 |
GO:0000257
GO:0003952 GO:0004359 GO:0005737 GO:0009435 |
| AF-A0A497IJU7-F1-model_v4 | NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) | 0.9843 | 404 | 563 |
GO:0003952
GO:0004359 GO:0005524 GO:0005737 GO:0008795 GO:0009435 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar