F471969

General Info

Members Datasets Scaffolds Average Seq Length
643 305 640 567

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0711520|Ga0436360_0711520_768_2843
Length 669
Sequence MKWRRRPGPAGRTGSSPKRPSDGSYREESLASGVGTLDAMAHVRVAACQINTVVGDLEGNATRILDAAAGAARAGADLAIFPELAVTGYPPEDLLERPAFVADNRVVFERLAQATGECAVAFGYVGVDASGRLTNSAALCARGQVVADYAKRMLPNYGVFDERRWFAPGEAPAMPVVVAGVPIGLTICEDMWFAEGPMQEEARAGARLLVNLNASPYSRGRRLERLTVLRERAAETGCAIAYVNQVGGQDELVFDGASMVVGADGELLAEAPQFAEAMLLYDLEVADGRAESVVAEAGGAVDSPSLIAVVSHASRSSETGVRVGHDATVVRGRAEPLSECAEVYEALVLGTRDYVGKNGFTDVVVGLSGGIDSSLVVTVAVDALGPEHVHGVAMPSRYSSEGSIDDARLLGDNLGIDLAAVPIEPVHGAFASSLAPLLGADPAGLTDENLQSRIRGVLLMALSNARGWLVLTTGNKSEMATGYSTLYGDSAGGFAVIKDVPKTLVYELCRYRNARAGRPLIPDAVLVKAPSAELRPEQRDEDSLPPYSELDPIVAGYVEGDRSAADLVAEGFHPATVARVVALVDRAEYKRRQMPPGVRISGKAFGKDRRMPITNHYEGLSEGAGAPDGRSEAATADSHRPGLSADEGAIGVKGVSSLRAAEGEASAVV

Samples

Sample ID Description Type Environment
1 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
2 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
3 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
165 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
166 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
167 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
168 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
173 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
176 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
177 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
178 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
183 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
191 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
204 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
216 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
217 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
264 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
265 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
268 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
271 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
272 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
273 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
274 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
277 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
278 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
281 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
282 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
283 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
284 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
285 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
286 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
287 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
290 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
291 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
298 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
301 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
302 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
303 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
304 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
305 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0
Isolates 0.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.51
Nodule 0
Rhizoplane 5.6
Rhizosphere 87.25
Stem 0
Stem Tuber 0
Unclassified 2.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10021445 3300003203 Bacteria 2593
2 Ga0070676_10006175 3300005328 Bacteria 6395
3 Ga0070683_100033173 3300005329 Bacteria 4706
4 Ga0070683_100070013 3300005329 Bacteria 3272
5 Ga0070690_100000305 3300005330 Bacteria 25337
6 Ga0070690_100002234 3300005330 Bacteria 10375
7 Ga0070690_100002631 3300005330 Bacteria 9671
8 Ga0070670_100005213 3300005331 Bacteria 10942
9 Ga0070670_100006871 3300005331 Bacteria 9641
10 Ga0070677_10003228 3300005333 Bacteria 5248
11 Ga0070666_10003792 3300005335 Bacteria 9165
12 Ga0070680_100001202 3300005336 Bacteria 18677
13 Ga0070680_100008822 3300005336 Bacteria 7732
14 Ga0070680_100100415 3300005336 Bacteria 2402
15 Ga0068868_100011537 3300005338 Bacteria 6436
16 Ga0068868_100020604 3300005338 Bacteria 4958
17 Ga0068868_100088288 3300005338 Bacteria 2495
18 Ga0070689_100000158 3300005340 Bacteria 39830
19 Ga0070689_100013395 3300005340 Bacteria 5932
20 Ga0070689_100082042 3300005340 Bacteria 2532
21 Ga0070687_100002317 3300005343 Bacteria 7082
22 Ga0070692_10010491 3300005345 Bacteria 4218
23 Ga0070668_100005046 3300005347 Bacteria 9774
24 Ga0070668_100142192 3300005347 Bacteria 1934
25 Ga0070669_100016569 3300005353 Bacteria 5260
26 Ga0070675_100000972 3300005354 Bacteria 20492
27 Ga0070675_100002574 3300005354 Bacteria 13590
28 Ga0070675_100004249 3300005354 Bacteria 10904
29 Ga0070671_100003350 3300005355 Bacteria 12499
30 Ga0070671_100009254 3300005355 Bacteria 7913
31 Ga0070674_100000802 3300005356 Bacteria 16179
32 Ga0070674_100000865 3300005356 Bacteria 15742
33 Ga0070673_100000143 3300005364 Bacteria 33944
34 Ga0070673_100019731 3300005364 Bacteria 4845
35 Ga0070673_100138022 3300005364 Bacteria 2054
36 Ga0070688_100003566 3300005365 Bacteria 8021
37 Ga0070688_100006698 3300005365 Bacteria 6174
38 Ga0070659_100034509 3300005366 Bacteria 3935
39 Ga0070667_100003919 3300005367 Bacteria 12641
40 Ga0070667_100006723 3300005367 Bacteria 9554
41 Ga0070667_100008294 3300005367 Bacteria 8610
42 Ga0070713_100002374 3300005436 Bacteria 12270
43 Ga0070710_10020150 3300005437 Bacteria 3456
44 Ga0070701_10000814 3300005438 Bacteria 11137
45 Ga0070701_10001128 3300005438 Bacteria 9766
46 Ga0070711_100059029 3300005439 Bacteria 2662
47 Ga0070705_100020583 3300005440 Bacteria 3495
48 Ga0070700_100004262 3300005441 Bacteria 7467
49 Ga0070700_100007622 3300005441 Bacteria 5856
50 Ga0070694_100000606 3300005444 Bacteria 19752
51 Ga0070694_100033217 3300005444 Bacteria 3393
52 Ga0070694_100050542 3300005444 Bacteria 2803
53 Ga0070708_100000766 3300005445 Bacteria 24179
54 Ga0070663_100003515 3300005455 Bacteria 9048
55 Ga0070678_100000378 3300005456 Bacteria 20834
56 Ga0070678_100144684 3300005456 Bacteria 1907
57 Ga0070662_100027455 3300005457 Bacteria 3951
58 Ga0070662_100102847 3300005457 Bacteria 2165
59 Ga0070681_10021331 3300005458 Bacteria 6494
60 Ga0068867_100002418 3300005459 Bacteria 13127
61 Ga0068867_100043609 3300005459 Bacteria 3284
62 Ga0070685_10000304 3300005466 Bacteria 30868
63 Ga0070706_100053398 3300005467 Bacteria 3730
64 Ga0070706_100069209 3300005467 Bacteria 3264
65 Ga0070706_100110745 3300005467 Bacteria 2555
66 Ga0070707_100004903 3300005468 Bacteria 12542
67 Ga0070707_100036153 3300005468 Bacteria 4713
68 Ga0070698_100023799 3300005471 Bacteria 6396
69 Ga0070698_100101129 3300005471 Bacteria 2854
70 Ga0070699_100015977 3300005518 Bacteria 6445
71 Ga0070699_100070280 3300005518 Bacteria 3043
72 Ga0070679_100013601 3300005530 Bacteria 7796
73 Ga0070679_100062244 3300005530 Bacteria 3720
74 Ga0070697_100019654 3300005536 Bacteria 5335
75 Ga0070672_100000197 3300005543 Bacteria 33442
76 Ga0070672_100093007 3300005543 Bacteria 2435
77 Ga0070686_100001064 3300005544 Bacteria 15834
78 Ga0070686_100005443 3300005544 Bacteria 7048
79 Ga0070695_100011036 3300005545 Bacteria 5401
80 Ga0070695_100024880 3300005545 Bacteria 3692
81 Ga0070695_100029601 3300005545 Bacteria 3402
82 Ga0070696_100024483 3300005546 Bacteria 4104
83 Ga0070693_100041862 3300005547 Bacteria 2579
84 Ga0070665_100001080 3300005548 Bacteria 33916
85 Ga0070665_100010272 3300005548 Bacteria 9472
86 Ga0070665_100023373 3300005548 Bacteria 6223
87 Ga0070665_100098839 3300005548 Bacteria 2923
88 Ga0068855_100002418 3300005563 Bacteria 23041
89 Ga0068855_100025043 3300005563 Bacteria 7142
90 Ga0068855_100025777 3300005563 Bacteria 7031
91 Ga0068855_100086919 3300005563 Bacteria 3614
92 Ga0068855_100091367 3300005563 Bacteria 3511
93 Ga0068855_100216079 3300005563 Bacteria 2152
94 Ga0070664_100028557 3300005564 Bacteria 4642
95 Ga0068857_100026351 3300005577 Bacteria 5124
96 Ga0068859_100076500 3300005617 Bacteria 3388
97 Ga0068864_100011866 3300005618 Bacteria 7196
98 Ga0068861_100061520 3300005719 Bacteria 2882
99 Ga0068861_100062254 3300005719 Bacteria 2866
100 Ga0068851_10036920 3300005834 Bacteria 2449
101 Ga0068860_100053803 3300005843 Bacteria 3827
102 Ga0068862_100123964 3300005844 Bacteria 2280
103 Ga0081455_10018220 3300005937 Bacteria 6701
104 Ga0081538_10000006 3300005981 Bacteria 181056
105 Ga0081538_10000185 3300005981 Bacteria 68366
106 Ga0081538_10000800 3300005981 Bacteria 34115
107 Ga0081538_10001125 3300005981 Bacteria 28308
108 Ga0081538_10007201 3300005981 Bacteria 9656
109 Ga0081538_10013275 3300005981 Bacteria 6532
110 Ga0081538_10058015 3300005981 Bacteria 2249
111 Ga0081540_1000159 3300005983 Bacteria 69507
112 Ga0081539_10003739 3300005985 Bacteria 18101
113 Ga0081539_10006735 3300005985 Bacteria 10812
114 Ga0075365_10000424 3300006038 Bacteria 15614
115 Ga0075363_100014971 3300006048 Unclassified 3803
116 Ga0075364_10000724 3300006051 Bacteria 17261
117 Ga0075364_10000955 3300006051 Bacteria 15254
118 Ga0075364_10002607 3300006051 Bacteria 10119
119 Ga0075364_10012861 3300006051 Bacteria 5133
120 Ga0075364_10017851 3300006051 Bacteria 4437
121 Ga0075364_10019874 3300006051 Bacteria 4222
122 Ga0075364_10039651 3300006051 Unclassified 3054
123 Ga0075432_10001488 3300006058 Bacteria 7647
124 Ga0070712_100001607 3300006175 Bacteria 13809
125 Ga0075362_10006533 3300006177 Bacteria 4354
126 Ga0075367_10007323 3300006178 Bacteria 5643
127 Ga0075369_10004307 3300006186 Bacteria 5244
128 Ga0097621_100006479 3300006237 Bacteria 8314
129 Ga0075370_10000205 3300006353 Bacteria 20906
130 Ga0068871_100003744 3300006358 Bacteria 10468
131 Ga0068871_100098676 3300006358 Bacteria 2444
132 Ga0075428_100000538 3300006844 Bacteria 38617
133 Ga0075428_100003176 3300006844 Bacteria 17959
134 Ga0075428_100004141 3300006844 Bacteria 15964
135 Ga0075428_100007682 3300006844 Bacteria 11953
136 Ga0075430_100000022 3300006846 Bacteria 81752
137 Ga0075430_100000126 3300006846 Bacteria 48056
138 Ga0075430_100014570 3300006846 Bacteria 6698
139 Ga0075430_100033898 3300006846 Bacteria 4334
140 Ga0075430_100043207 3300006846 Bacteria 3809
141 Ga0075431_100000203 3300006847 Bacteria 43754
142 Ga0075431_100017262 3300006847 Bacteria 7334
143 Ga0075431_100027664 3300006847 Bacteria 5819
144 Ga0075431_100037642 3300006847 Unclassified 4982
145 Ga0075431_100062606 3300006847 Bacteria 3838
146 Ga0075431_100070259 3300006847 Bacteria 3612
147 Ga0075431_100112489 3300006847 Bacteria 2810
148 Ga0075431_100118930 3300006847 Bacteria 2726
149 Ga0075433_10000055 3300006852 Bacteria 48950
150 Ga0075433_10000868 3300006852 Bacteria 21168
151 Ga0075433_10022968 3300006852 Bacteria 5244
152 Ga0075433_10024377 3300006852 Bacteria 5104
153 Ga0075434_100006129 3300006871 Bacteria 11010
154 Ga0075434_100019970 3300006871 Bacteria 6489
155 Ga0075434_100036459 3300006871 Bacteria 4865
156 Ga0075429_100000069 3300006880 Bacteria 51472
157 Ga0075429_100002699 3300006880 Bacteria 14957
158 Ga0075429_100019577 3300006880 Bacteria 5866
159 Ga0075429_100021045 3300006880 Bacteria 5660
160 Ga0068865_100023984 3300006881 Bacteria 3999
161 Ga0068865_100126864 3300006881 Bacteria 1906
162 Ga0097620_100076502 3300006931 Bacteria 3388
163 Ga0075435_100013974 3300007076 Bacteria 5987
164 Ga0075435_100026214 3300007076 Bacteria 4545
165 Ga0099794_10001536 3300007265 Bacteria 8126
166 Ga0105240_10001845 3300009093 Bacteria 35484
167 Ga0105240_10062437 3300009093 Bacteria 4638
168 Ga0105240_10090674 3300009093 Bacteria 3735
169 Ga0111539_10000081 3300009094 Bacteria 97006
170 Ga0111539_10000274 3300009094 Bacteria 61652
171 Ga0111539_10016794 3300009094 Bacteria 9067
172 Ga0111539_10018478 3300009094 Bacteria 8635
173 Ga0111539_10032707 3300009094 Bacteria 6316
174 Ga0111539_10136005 3300009094 Bacteria 2878
175 Ga0105245_10004403 3300009098 Bacteria 12457
176 Ga0105247_10000278 3300009101 Bacteria 47180
177 Ga0114129_10000830 3300009147 Bacteria 39917
178 Ga0114129_10044693 3300009147 Bacteria 6231
179 Ga0114129_10065170 3300009147 Bacteria 5085
180 Ga0114129_10065834 3300009147 Bacteria 5056
181 Ga0105243_10002135 3300009148 Bacteria 16720
182 Ga0105242_10000479 3300009176 Bacteria 31794
183 Ga0105242_10000921 3300009176 Bacteria 22877
184 Ga0105242_10048633 3300009176 Bacteria 3447
185 Ga0105248_10005285 3300009177 Bacteria 14208
186 Ga0105237_10004164 3300009545 Bacteria 16839
187 Ga0105238_10144229 3300009551 Bacteria 2358
188 Ga0105249_10019551 3300009553 Bacteria 6044
189 Ga0105249_10023725 3300009553 Bacteria 5508
190 Ga0105249_10025298 3300009553 Bacteria 5343
191 Ga0105239_10017132 3300010375 Bacteria 8010
192 Ga0105239_10100730 3300010375 Bacteria 3195
193 Ga0105239_10114714 3300010375 Bacteria 2988
194 Ga0105239_10185349 3300010375 Bacteria 2329
195 Ga0105246_10000806 3300011119 Bacteria 17816
196 Ga0157369_10002658 3300013105 Bacteria 21335
197 Ga0157374_10076801 3300013296 Bacteria 3158
198 Ga0157378_10000610 3300013297 Bacteria 33628
199 Ga0157378_10003105 3300013297 Bacteria 14767
200 Ga0163162_10010688 3300013306 Bacteria 8928
201 Ga0157375_10028173 3300013308 Bacteria 5261
202 Ga0163163_10004489 3300014325 Bacteria 11909
203 Ga0163163_10064218 3300014325 Bacteria 3642
204 Ga0163163_10225399 3300014325 Bacteria 1923
205 Ga0157380_10007013 3300014326 Bacteria 7975
206 Ga0157377_10013662 3300014745 Bacteria 4115
207 Ga0157377_10013792 3300014745 Bacteria 4097
208 Ga0157376_10011158 3300014969 Bacteria 6610
209 Ga0157376_10013961 3300014969 Bacteria 6009
210 Ga0207710_10000502 3300025900 Bacteria 24324
211 Ga0207688_10005394 3300025901 Bacteria 6950
212 Ga0207680_10041826 3300025903 Bacteria 2677
213 Ga0207647_10006961 3300025904 Bacteria 8195
214 Ga0207645_10000134 3300025907 Bacteria 56602
215 Ga0207645_10033284 3300025907 Bacteria 3313
216 Ga0207643_10029813 3300025908 Bacteria 3035
217 Ga0207684_10001278 3300025910 Bacteria 27767
218 Ga0207684_10011397 3300025910 Bacteria 7779
219 Ga0207707_10053735 3300025912 Bacteria 3507
220 Ga0207695_10012561 3300025913 Bacteria 10151
221 Ga0207695_10018267 3300025913 Bacteria 8115
222 Ga0207695_10019085 3300025913 Bacteria 7908
223 Ga0207695_10029271 3300025913 Bacteria 6091
224 Ga0207695_10127629 3300025913 Bacteria 2504
225 Ga0207671_10002923 3300025914 Bacteria 17607
226 Ga0207662_10002099 3300025918 Bacteria 9900
227 Ga0207657_10012644 3300025919 Bacteria 8320
228 Ga0207652_10000867 3300025921 Bacteria 28615
229 Ga0207652_10146131 3300025921 Bacteria 2116
230 Ga0207646_10000311 3300025922 Bacteria 66146
231 Ga0207646_10165281 3300025922 Bacteria 1998
232 Ga0207681_10004762 3300025923 Bacteria 8352
233 Ga0207681_10010335 3300025923 Bacteria 5710
234 Ga0207681_10104363 3300025923 Bacteria 2050
235 Ga0207650_10031455 3300025925 Bacteria 3832
236 Ga0207659_10002985 3300025926 Bacteria 10084
237 Ga0207687_10009645 3300025927 Bacteria 6312
238 Ga0207690_10070541 3300025932 Bacteria 2407
239 Ga0207706_10000433 3300025933 Bacteria 44824
240 Ga0207706_10014061 3300025933 Bacteria 7258
241 Ga0207706_10030789 3300025933 Bacteria 4785
242 Ga0207706_10090275 3300025933 Bacteria 2694
243 Ga0207686_10002267 3300025934 Bacteria 10553
244 Ga0207686_10016114 3300025934 Bacteria 4189
245 Ga0207670_10000797 3300025936 Bacteria 16479
246 Ga0207670_10034436 3300025936 Bacteria 3273
247 Ga0207669_10005346 3300025937 Bacteria 5751
248 Ga0207669_10017005 3300025937 Bacteria 3716
249 Ga0207704_10011927 3300025938 Bacteria 4297
250 Ga0207665_10018688 3300025939 Bacteria 4555
251 Ga0207691_10000080 3300025940 Bacteria 82234
252 Ga0207691_10002262 3300025940 Bacteria 18854
253 Ga0207691_10154562 3300025940 Bacteria 2016
254 Ga0207711_10023212 3300025941 Bacteria 5191
255 Ga0207711_10033760 3300025941 Bacteria 4331
256 Ga0207689_10004452 3300025942 Bacteria 12701
257 Ga0207661_10062896 3300025944 Bacteria 3004
258 Ga0207679_10000816 3300025945 Bacteria 20095
259 Ga0207679_10003763 3300025945 Bacteria 9403
260 Ga0207667_10008748 3300025949 Bacteria 12002
261 Ga0207651_10000078 3300025960 Bacteria 44168
262 Ga0207651_10015139 3300025960 Bacteria 4473
263 Ga0207712_10010069 3300025961 Bacteria 5994
264 Ga0207668_10101913 3300025972 Bacteria 2135
265 Ga0207658_10007664 3300025986 Bacteria 7351
266 Ga0207658_10018850 3300025986 Bacteria 4772
267 Ga0207677_10025766 3300026023 Bacteria 3674
268 Ga0207703_10016836 3300026035 Bacteria 5702
269 Ga0207678_10001469 3300026067 Bacteria 21623
270 Ga0207708_10000394 3300026075 Bacteria 34403
271 Ga0207708_10002710 3300026075 Bacteria 13017
272 Ga0207648_10000557 3300026089 Bacteria 41682
273 Ga0207648_10011733 3300026089 Bacteria 8240
274 Ga0207648_10067184 3300026089 Bacteria 3126
275 Ga0207674_10037265 3300026116 Bacteria 5059
276 Ga0207675_100126594 3300026118 Bacteria 2420
277 Ga0207683_10000361 3300026121 Bacteria 41745
278 Ga0207683_10047464 3300026121 Bacteria 3761
279 Ga0209969_1000272 3300027360 Bacteria 6900
280 Ga0209967_1000170 3300027364 Bacteria 9005
281 Ga0209981_1000162 3300027378 Bacteria 8239
282 Ga0209984_1000274 3300027424 Bacteria 5866
283 Ga0210000_1000280 3300027462 Bacteria 7285
284 Ga0209995_1000103 3300027471 Bacteria 13417
285 Ga0209982_1000036 3300027552 Bacteria 12172
286 Ga0210002_1000089 3300027617 Bacteria 14269
287 Ga0209983_1000237 3300027665 Bacteria 11176
288 Ga0209966_1000553 3300027695 Bacteria 9414
289 Ga0209998_10000014 3300027717 Bacteria 91397
290 Ga0207428_10000426 3300027907 Bacteria 52198
291 Ga0207428_10002909 3300027907 Bacteria 16966
292 Ga0207428_10010288 3300027907 Bacteria 8361
293 Ga0207428_10021185 3300027907 Bacteria 5506
294 Ga0207428_10053680 3300027907 Bacteria 3213
295 Ga0268266_10000264 3300028379 Bacteria 88067
296 Ga0268266_10004961 3300028379 Bacteria 12594
297 Ga0268266_10037493 3300028379 Bacteria 4129
298 Ga0268266_10038686 3300028379 Bacteria 4060
299 Ga0268266_10092741 3300028379 Bacteria 2650
300 Ga0268266_10094745 3300028379 Bacteria 2621
301 Ga0268264_10110890 3300028381 Bacteria 2403
302 Ga0268264_10161779 3300028381 Bacteria 2017
303 Ga0265337_1000240 3300028556 Bacteria 29757
304 Ga0265326_10000393 3300028558 Bacteria 17549
305 Ga0265326_10000621 3300028558 Bacteria 13262
306 Ga0265319_1005656 3300028563 Bacteria 5944
307 Ga0265322_10000029 3300028654 Bacteria 82867
308 Ga0265336_10000005 3300028666 Bacteria 399349
309 Ga0265338_10000001 3300028800 Bacteria 1177449
310 Ga0265324_10000423 3300029957 Bacteria 30311
311 Ga0265324_10021184 3300029957 Bacteria 2332
312 Ga0265332_10021232 3300031238 Bacteria 2869
313 Ga0265328_10003911 3300031239 Bacteria 6552
314 Ga0265320_10000011 3300031240 Bacteria 249534
315 Ga0265325_10034845 3300031241 Bacteria 2676
316 Ga0265340_10000001 3300031247 Bacteria 1647668
317 Ga0265331_10001215 3300031250 Bacteria 19370
318 Ga0265327_10000015 3300031251 Bacteria 496677
319 Ga0265327_10001841 3300031251 Bacteria 24614
320 Ga0265327_10002681 3300031251 Bacteria 18268
321 Ga0265316_10000536 3300031344 Bacteria 42732
322 Ga0265316_10005336 3300031344 Bacteria 12523
323 Ga0307408_100059961 3300031548 Bacteria 2772
324 Ga0316579_10003307 3300031691 Bacteria 6260
325 Ga0316579_10017057 3300031691 Bacteria 3181
326 Ga0265314_10000361 3300031711 Bacteria 63269
327 Ga0265342_10055996 3300031712 Bacteria 2339
328 Ga0316576_10024737 3300031727 Bacteria 4196
329 Ga0307405_10020736 3300031731 Bacteria 3679
330 Ga0316577_10006313 3300031733 Bacteria 6255
331 Ga0307413_10109394 3300031824 Bacteria 1847
332 Ga0307409_100014418 3300031995 Bacteria 5142
333 Ga0307409_100014889 3300031995 Bacteria 5080
334 Ga0307409_100040359 3300031995 Bacteria 3474
335 Ga0307409_100092838 3300031995 Bacteria 2478
336 Ga0307416_100011881 3300032002 Bacteria 5839
337 Ga0307415_100001589 3300032126 Bacteria 10960
338 Ga0307415_100054497 3300032126 Bacteria 2730
339 Ga0307415_100101116 3300032126 Bacteria 2115
340 Ga0373929_0006848 3300035085 Bacteria 2070
341 Ga0373961_0031534 3300035241 Bacteria 1481
342 Ga0373931_0002440 3300035691 Bacteria 8235
343 Ga0373927_0003744 3300035695 Bacteria 10797
344 Ga0373947_0088568 3300035725 Bacteria 1927
345 Ga0316584_0000757 3300036712 Bacteria 18034
346 Ga0316584_0022454 3300036712 Bacteria 4602
347 Ga0373925_0003041 3300037068 Bacteria 13196
348 Ga0395899_0071121 3300037312 Bacteria 2546
349 Ga0395900_0005975 3300037418 Bacteria 12709
350 Ga0395898_0012550 3300037466 Bacteria 8763
351 Ga0395898_0145767 3300037466 Bacteria 2266
352 Ga0395898_0179344 3300037466 Bacteria 2024
353 Ga0395905_0021240 3300037471 Bacteria 6143
354 Ga0436364_0154387 3300037853 Bacteria 2460
355 Ga0395901_0009290 3300038443 Bacteria 9966
356 Ga0395901_0010764 3300038443 Bacteria 9273
357 Ga0395901_0102890 3300038443 Bacteria 2997
358 Ga0395901_0197065 3300038443 Bacteria 2112
359 Ga0436360_0711520 3300039438 Bacteria 2920
360 Ga0439460_0011819 3300042461 Bacteria 2256
361 Ga0451577_0001787 3300042876 Bacteria 27578
362 Ga0451577_0002216 3300042876 Bacteria 23670
363 Ga0451577_0005547 3300042876 Bacteria 12856
364 Ga0451577_0013714 3300042876 Bacteria 7573
365 Ga0451577_0023154 3300042876 Bacteria 5668
366 Ga0451577_0026266 3300042876 Bacteria 5275
367 Ga0439440_0001118 3300042993 Bacteria 4790
368 Ga0466963_0032574 3300044694 Bacteria 3377
369 Ga0453684_0000010 3300044712 Bacteria 1133422
370 Ga0453684_0000072 3300044712 Bacteria 442457
371 Ga0453684_0000177 3300044712 Bacteria 282969
372 Ga0453684_0004180 3300044712 Bacteria 31097
373 Ga0453684_0012309 3300044712 Bacteria 14156
374 Ga0453684_0037153 3300044712 Bacteria 6690
375 Ga0453684_0052448 3300044712 Bacteria 5333
376 Ga0453684_0068036 3300044712 Bacteria 4525
377 Ga0453684_0079171 3300044712 Bacteria 4109
378 Ga0451576_0007659 3300045051 Bacteria 12837
379 Ga0451576_0089859 3300045051 Bacteria 3194
380 Ga0466967_0141287 3300045976 Bacteria 2243
381 Ga0495603_0000596 3300046455 Bacteria 20312
382 Ga0495629_0039398 3300046459 Bacteria 3326
383 Ga0495638_0013818 3300046460 Bacteria 5481
384 Ga0495641_0001114 3300046461 Bacteria 23115
385 Ga0495580_0016116 3300046472 Bacteria 5618
386 Ga0495580_0022002 3300046472 Bacteria 4699
387 Ga0495582_0005093 3300046473 Bacteria 7361
388 Ga0495664_0000012 3300046477 Bacteria 226118
389 Ga0495630_0000891 3300046517 Bacteria 20921
390 Ga0495667_0000020 3300046559 Bacteria 180876
391 Ga0495634_0085438 3300046642 Bacteria 2056
392 Ga0495657_0000007 3300046675 Bacteria 222471
393 Ga0495657_0076028 3300046675 Bacteria 2182
394 Ga0495604_0000190 3300047317 Bacteria 55090
395 Ga0495604_0103329 3300047317 Bacteria 2091
396 Ga0495676_0000805 3300047321 Bacteria 26189
397 Ga0495676_0045786 3300047321 Bacteria 3557
398 Ga0495680_0002123 3300047322 Bacteria 20590
399 Ga0495680_0108170 3300047322 Bacteria 2064
400 Ga0495686_0024455 3300047472 Bacteria 3968
401 Ga0496100_0000001 3300048903 Bacteria 530179
402 Ga0496100_0020234 3300048903 Bacteria 3987
403 Ga0496100_0020337 3300048903 Bacteria 3978
404 Ga0496101_0000004 3300048904 Bacteria 331599
405 Ga0496102_0000027 3300048905 Bacteria 225466
406 Ga0496102_0212050 3300048905 Bacteria 1826
407 Ga0496103_0000155 3300048906 Bacteria 72091
408 Ga0496103_0023229 3300048906 Bacteria 3738
409 Ga0496104_0000015 3300048907 Bacteria 374530
410 Ga0496104_0016788 3300048907 Bacteria 6654
411 Ga0496104_0025988 3300048907 Bacteria 5400
412 Ga0496104_0055926 3300048907 Bacteria 3731
413 Ga0496104_0058523 3300048907 Bacteria 3648
414 Ga0496105_0000004 3300048908 Bacteria 475798
415 Ga0496105_0002253 3300048908 Bacteria 13976
416 Ga0496105_0018671 3300048908 Bacteria 5583
417 Ga0496106_0001278 3300048909 Bacteria 18871
418 Ga0496106_0035676 3300048909 Bacteria 3719
419 Ga0496106_0046899 3300048909 Bacteria 3250
420 Ga0496106_0076105 3300048909 Bacteria 2572
421 Ga0496106_0086688 3300048909 Bacteria 2412
422 Ga0496107_0000005 3300048910 Bacteria 281747
423 Ga0496107_0033457 3300048910 Bacteria 3678
424 Ga0496107_0035024 3300048910 Bacteria 3599
425 Ga0496108_0011493 3300048911 Bacteria 7195
426 Ga0496109_0013371 3300048912 Bacteria 7117
427 Ga0496109_0173032 3300048912 Bacteria 2026
428 Ga0496110_0082585 3300048913 Bacteria 2866
429 Ga0496112_0053022 3300048915 Bacteria 3982
430 Ga0496113_0088786 3300048916 Bacteria 2378
431 Ga0496114_0008997 3300048917 Bacteria 7915
432 Ga0496114_0015247 3300048917 Bacteria 6178
433 Ga0496115_0000035 3300048918 Bacteria 134475
434 Ga0496115_0000143 3300048918 Bacteria 65909
435 Ga0496115_0002639 3300048918 Bacteria 12880
436 Ga0496115_0086374 3300048918 Bacteria 2559
437 Ga0496116_0000176 3300048919 Bacteria 128426
438 Ga0496117_0002967 3300048920 Bacteria 20476
439 Ga0496119_0001444 3300048922 Bacteria 28583
440 Ga0496119_0006106 3300048922 Bacteria 11282
441 Ga0496119_0038824 3300048922 Bacteria 3070
442 Ga0496120_0003250 3300048923 Bacteria 15033
443 Ga0496121_0003484 3300048924 Bacteria 22403
444 Ga0496121_0004005 3300048924 Bacteria 20303
445 Ga0496121_0014377 3300048924 Bacteria 8404
446 Ga0496121_0014861 3300048924 Bacteria 8213
447 Ga0496121_0055701 3300048924 Bacteria 3291
448 Ga0496125_0028123 3300048928 Bacteria 5084
449 Ga0496126_0003514 3300048929 Bacteria 19727
450 Ga0496126_0023298 3300048929 Bacteria 6000
451 Ga0501031_0019266 3300049568 Bacteria 4443
452 Ga0501031_0024011 3300049568 Bacteria 3975
453 Ga0501032_0017545 3300049569 Bacteria 5024
454 Ga0501032_0025482 3300049569 Bacteria 4076
455 Ga0501032_0037486 3300049569 Bacteria 3306
456 Ga0501033_0005704 3300049570 Bacteria 9815
457 Ga0501033_0013165 3300049570 Bacteria 6301
458 Ga0501033_0040723 3300049570 Bacteria 3468
459 Ga0501033_0082766 3300049570 Bacteria 2353
460 Ga0501034_0016464 3300049571 Bacteria 7587
461 Ga0501034_0030467 3300049571 Bacteria 5485
462 Ga0501034_0082005 3300049571 Bacteria 3227
463 Ga0501034_0140020 3300049571 Bacteria 2399
464 Ga0501034_0163229 3300049571 Bacteria 2198
465 Ga0501036_0002059 3300049572 Bacteria 15663
466 Ga0501036_0006253 3300049572 Bacteria 9658
467 Ga0501036_0031963 3300049572 Bacteria 4447
468 Ga0501037_0000901 3300049573 Bacteria 22167
469 Ga0501037_0124783 3300049573 Bacteria 1849
470 Ga0501038_0017202 3300049574 Bacteria 6537
471 Ga0501038_0039586 3300049574 Bacteria 4123
472 Ga0501038_0053041 3300049574 Bacteria 3493
473 Ga0501038_0076358 3300049574 Bacteria 2830
474 Ga0501038_0088147 3300049574 Bacteria 2605
475 Ga0501039_0014387 3300049575 Bacteria 6059
476 Ga0501039_0019777 3300049575 Bacteria 5162
477 Ga0501039_0034932 3300049575 Bacteria 3880
478 Ga0501039_0035324 3300049575 Bacteria 3857
479 Ga0501039_0056957 3300049575 Bacteria 3028
480 Ga0501039_0106997 3300049575 Bacteria 2184
481 Ga0501039_0118994 3300049575 Bacteria 2069
482 Ga0501040_0001522 3300049576 Bacteria 14713
483 Ga0501040_0006557 3300049576 Bacteria 7557
484 Ga0501040_0023647 3300049576 Bacteria 4121
485 Ga0501040_0025428 3300049576 Bacteria 3981
486 Ga0501040_0043555 3300049576 Bacteria 3060
487 Ga0501040_0072628 3300049576 Bacteria 2376
488 Ga0501040_0098330 3300049576 Bacteria 2039
489 Ga0501041_0007553 3300049577 Bacteria 6382
490 Ga0501041_0016982 3300049577 Bacteria 4331
491 Ga0501041_0028787 3300049577 Bacteria 3351
492 Ga0501041_0034230 3300049577 Bacteria 3075
493 Ga0501041_0041266 3300049577 Bacteria 2802
494 Ga0501042_0001724 3300049578 Bacteria 13073
495 Ga0501042_0011854 3300049578 Bacteria 5887
496 Ga0501042_0018290 3300049578 Bacteria 4850
497 Ga0501042_0020204 3300049578 Bacteria 4634
498 Ga0501042_0029580 3300049578 Bacteria 3864
499 Ga0501042_0065925 3300049578 Bacteria 2588
500 Ga0501043_0002515 3300049579 Bacteria 15490
501 Ga0501043_0045244 3300049579 Bacteria 3461
502 Ga0501046_0005055 3300049580 Bacteria 11824
503 Ga0501046_0007307 3300049580 Bacteria 9717
504 Ga0501046_0056469 3300049580 Bacteria 3082
505 Ga0501046_0062494 3300049580 Bacteria 2909
506 Ga0501046_0063196 3300049580 Bacteria 2891
507 Ga0501047_0002109 3300049581 Bacteria 19029
508 Ga0501047_0006504 3300049581 Bacteria 10998
509 Ga0501047_0020607 3300049581 Bacteria 6331
510 Ga0501047_0143821 3300049581 Bacteria 2262
511 Ga0501048_0004425 3300049582 Bacteria 10700
512 Ga0501048_0005976 3300049582 Bacteria 9270
513 Ga0501048_0026309 3300049582 Bacteria 4236
514 Ga0501048_0028092 3300049582 Bacteria 4084
515 Ga0501048_0049052 3300049582 Bacteria 3010
516 Ga0501048_0072099 3300049582 Bacteria 2438
517 Ga0501067_0008416 3300049583 Bacteria 5726
518 Ga0501068_0026246 3300049584 Bacteria 3431
519 Ga0501068_0039269 3300049584 Bacteria 2838
520 Ga0501069_0007255 3300049585 Bacteria 5813
521 Ga0501069_0021301 3300049585 Bacteria 3517
522 Ga0501070_0000592 3300049586 Bacteria 33029
523 Ga0501070_0017472 3300049586 Bacteria 6022
524 Ga0501071_0000146 3300049587 Bacteria 29418
525 Ga0501071_0048581 3300049587 Bacteria 3053
526 Ga0501071_0084832 3300049587 Bacteria 2322
527 Ga0501072_0001102 3300049588 Bacteria 20088
528 Ga0501072_0003271 3300049588 Bacteria 12171
529 Ga0501072_0004269 3300049588 Bacteria 10840
530 Ga0501072_0078213 3300049588 Bacteria 2619
531 Ga0501073_0006491 3300049589 Bacteria 8703
532 Ga0501073_0099530 3300049589 Bacteria 2019
533 Ga0501074_0004840 3300049590 Bacteria 9651
534 Ga0501074_0009485 3300049590 Bacteria 7068
535 Ga0501074_0062018 3300049590 Bacteria 2694
536 Ga0501075_0000052 3300049591 Bacteria 49149
537 Ga0501075_0000387 3300049591 Bacteria 25430
538 Ga0501075_0013557 3300049591 Bacteria 5821
539 Ga0501076_0000744 3300049592 Bacteria 21082
540 Ga0501076_0000935 3300049592 Bacteria 19029
541 Ga0501076_0007345 3300049592 Bacteria 8019
542 Ga0501076_0014867 3300049592 Bacteria 5874
543 Ga0501076_0015737 3300049592 Bacteria 5721
544 Ga0501076_0028117 3300049592 Bacteria 4364
545 Ga0501077_0026890 3300049593 Bacteria 3653
546 Ga0501077_0035180 3300049593 Bacteria 3189
547 Ga0501077_0073771 3300049593 Bacteria 2162
548 Ga0501079_0000292 3300049741 Bacteria 30851
549 Ga0501079_0013780 3300049741 Bacteria 6164
550 Ga0501079_0024567 3300049741 Bacteria 4624
551 Ga0501079_0026522 3300049741 Bacteria 4441
552 Ga0501079_0074484 3300049741 Bacteria 2624
553 Ga0501079_0081859 3300049741 Bacteria 2496
554 Ga0501080_0000228 3300049742 Bacteria 42084
555 Ga0501080_0122185 3300049742 Bacteria 2412
556 Ga0501081_0000416 3300049743 Bacteria 23512
557 Ga0501081_0050144 3300049743 Bacteria 2876
558 Ga0501081_0054175 3300049743 Bacteria 2771
559 Ga0501081_0073865 3300049743 Bacteria 2378
560 Ga0501081_0094566 3300049743 Bacteria 2106
561 Ga0501083_0004753 3300049744 Bacteria 9592
562 Ga0501083_0035911 3300049744 Bacteria 3384
563 Ga0501083_0053085 3300049744 Bacteria 2721
564 Ga0501035_0000368 3300049822 Bacteria 51908
565 Ga0501035_0012623 3300049822 Bacteria 7806
566 Ga0501035_0033741 3300049822 Bacteria 4652
567 Ga0501035_0093010 3300049822 Bacteria 2653
568 Ga0501044_0000684 3300049823 Bacteria 40967
569 Ga0501044_0006739 3300049823 Bacteria 12663
570 Ga0501044_0039906 3300049823 Bacteria 4894
571 Ga0501045_0003796 3300049824 Bacteria 10391
572 Ga0501045_0089350 3300049824 Bacteria 2276
573 nmdc:mga03683_3645_c1 3300050489 Bacteria 5006
574 nmdc:mga03n38_143_c1 3300050490 Bacteria 15695
575 nmdc:mga03n38_24429_c1 3300050490 Bacteria 2471
576 nmdc:mga00v17_2264_c1 3300050491 Bacteria 9863
577 nmdc:mga00v17_34182_c1 3300050491 Bacteria 3017
578 nmdc:mga00v17_5517_c1 3300050491 Bacteria 6666
579 nmdc:mga0yw44_18945_c1 3300050492 Bacteria 3784
580 nmdc:mga0yw44_7343_c1 3300050492 Bacteria 5413
581 nmdc:mga0yw44_88_c1 3300050492 Bacteria 32594
582 nmdc:mga0k408_33228_c1 3300050493 Bacteria 2950
583 nmdc:mga06z11_2325_c1 3300050494 Bacteria 7235
584 nmdc:mga07m45_69_c1 3300050496 Bacteria 38695
585 nmdc:mga05p37_117857_c1 3300050507 Bacteria 3262
586 nmdc:mga05p37_1820_c1 3300050507 Bacteria 24856
587 nmdc:mga05p37_19885_c1 3300050507 Bacteria 8122
588 nmdc:mga05p37_21210_c1 3300050507 Bacteria 7866
589 nmdc:mga05p37_44861_c1 3300050507 Bacteria 5438
590 nmdc:mga09592_405_c1 3300050508 Bacteria 31613
591 nmdc:mga09592_410_c1 3300050508 Bacteria 31410
592 nmdc:mga0qj67_16683_c1 3300050509 Bacteria 5574
593 nmdc:mga0qj67_2445_c1 3300050509 Bacteria 13228
594 nmdc:mga0qj67_302_c1 3300050509 Bacteria 34246
595 nmdc:mga0qj67_32926_c1 3300050509 Bacteria 4043
596 nmdc:mga06r32_108492_c1 3300050510 Bacteria 2729
597 nmdc:mga06r32_21166_c1 3300050510 Bacteria 6002
598 nmdc:mga06r32_5740_c1 3300050510 Bacteria 11176
599 nmdc:mga06r32_6387_c1 3300050510 Bacteria 10591
600 nmdc:mga08y16_17331_c1 3300050511 Bacteria 7582
601 nmdc:mga08y16_196_c1 3300050511 Bacteria 54632
602 nmdc:mga08y16_2827_c1 3300050511 Bacteria 17838
603 nmdc:mga0n895_138179_c1 3300050512 Unclassified 2464
604 nmdc:mga0n895_25905_c1 3300050512 Bacteria 5546
605 nmdc:mga0n895_26597_c1 3300050512 Bacteria 5483
606 nmdc:mga0n895_28653_c1 3300050512 Bacteria 5300
607 nmdc:mga0n895_5164_c1 3300050512 Bacteria 10861
608 nmdc:mga0rr50_3934_c1 3300050513 Bacteria 4422
609 nmdc:mga0rr50_55433_c1 3300050513 Bacteria 2957
610 nmdc:mga08x19_51140_c1 3300050514 Bacteria 2654
611 nmdc:mga08x19_61390_c1 3300050514 Bacteria 2436
612 nmdc:mga08x19_7279_c1 3300050514 Bacteria 6571
613 nmdc:mga0a205_127515_c1 3300050515 Bacteria 2445
614 nmdc:mga0a205_2674_c1 3300050515 Bacteria 15763
615 nmdc:mga0a205_366_c1 3300050515 Bacteria 34091
616 nmdc:mga0a205_4128_c1 3300050515 Bacteria 12998
617 nmdc:mga0a205_4535_c1 3300050515 Bacteria 12467
618 nmdc:mga0a205_6077_c1 3300050515 Bacteria 10889
619 nmdc:mga0sz30_25_c2 3300050516 Bacteria 27265
620 Ga0495601_0008867 3300053077 Bacteria 5936
621 Ga0495601_0019043 3300053077 Bacteria 4183
622 Ga0495601_0041304 3300053077 Bacteria 2890
623 Ga0495619_0053584 3300053085 Bacteria 2669
624 Ga0500641_0005118 3300053096 Bacteria 4646
625 Ga0500555_001423 3300053103 Bacteria 7362
626 Ga0500559_0053041 3300053136 Bacteria 1794
627 Ga0501084_0000912 3300054114 Bacteria 22846
628 Ga0501084_0019806 3300054114 Bacteria 5607
629 Ga0501084_0036170 3300054114 Bacteria 4125
630 Ga0501082_0002443 3300060353 Bacteria 16310
631 Ga0501082_0008754 3300060353 Bacteria 8725
632 Ga0501082_0038968 3300060353 Bacteria 4099
633 Ga0501082_0058718 3300060353 Bacteria 3315
634 Ga0530510_0000017 3300061734 Bacteria 84530
635 Ga0530510_0000168 3300061734 Bacteria 39753
636 Ga0530510_0007392 3300061734 Bacteria 7647
637 Ga0530510_0009273 3300061734 Bacteria 6904
638 Ga0530510_0031753 3300061734 Bacteria 3797
639 Ga0530510_0033345 3300061734 Bacteria 3708
640 Ga0530510_0109831 3300061734 Bacteria 2019

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006881 Ga0068865_100126864 Ga0068865_1001268642 452
2 3300035241 Ga0373961_0031534 Ga0373961_0031534_19_1467 473
3 3300049743 Ga0501081_0073865 Ga0501081_0073865_107_1576 473
4 3300049822 Ga0501035_0033741 Ga0501035_0033741_64_1593 484
5 3300050493 nmdc:mga0k408_33228_c1 nmdc:mga0k408_33228_c1_17_1627 497
6 3300061734 Ga0530510_0031753 Ga0530510_0031753_2129_3751 511
7 3300006871 Ga0075434_100006129 Ga0075434_10000612911 513
8 3300007076 Ga0075435_100026214 Ga0075435_1000262143 513
9 3300050512 nmdc:mga0n895_5164_c1 nmdc:mga0n895_5164_c1_714_2354 513
10 3300050513 nmdc:mga0rr50_3934_c1 nmdc:mga0rr50_3934_c1_2034_3674 513
11 3300048909 Ga0496106_0035676 Ga0496106_0035676_323_1984 514
12 3300048918 Ga0496115_0086374 Ga0496115_0086374_417_2159 517
13 3300037312 Ga0395899_0071121 Ga0395899_0071121_882_2513 518
14 3300049581 Ga0501047_0006504 Ga0501047_0006504_6836_8506 518
15 3300005618 Ga0068864_100011866 Ga0068864_1000118665 520
16 3300035085 Ga0373929_0006848 Ga0373929_0006848_31_1782 520
17 3300048910 Ga0496107_0033457 Ga0496107_0033457_161_1939 520
18 3300048911 Ga0496108_0011493 Ga0496108_0011493_1713_3491 520
19 3300048917 Ga0496114_0008997 Ga0496114_0008997_4117_5895 520
20 3300049744 Ga0501083_0053085 Ga0501083_0053085_1053_2681 520
21 3300053077 Ga0495601_0041304 Ga0495601_0041304_815_2566 520
22 3300047321 Ga0495676_0000805 Ga0495676_0000805_2654_4291 521
23 3300048903 Ga0496100_0000001 Ga0496100_0000001_494607_496244 521
24 3300048904 Ga0496101_0000004 Ga0496101_0000004_295959_297596 521
25 3300048909 Ga0496106_0001278 Ga0496106_0001278_12687_14324 521
26 3300048910 Ga0496107_0000005 Ga0496107_0000005_34004_35641 521
27 3300006177 Ga0075362_10006533 Ga0075362_100065333 522
28 3300046459 Ga0495629_0039398 Ga0495629_0039398_1620_3281 522
29 3300046472 Ga0495580_0016116 Ga0495580_0016116_982_2643 522
30 3300046473 Ga0495582_0005093 Ga0495582_0005093_263_1924 522
31 3300049743 Ga0501081_0094566 Ga0501081_0094566_43_1656 522
32 3300005329 Ga0070683_100070013 Ga0070683_1000700132 523
33 3300005563 Ga0068855_100025777 Ga0068855_1000257772 523
34 3300013105 Ga0157369_10002658 Ga0157369_100026584 523
35 3300025944 Ga0207661_10062896 Ga0207661_100628962 523
36 3300048907 Ga0496104_0055926 Ga0496104_0055926_241_1926 523
37 3300005548 Ga0070665_100098839 Ga0070665_1000988392 524
38 3300005719 Ga0068861_100061520 Ga0068861_1000615202 524
39 3300009551 Ga0105238_10144229 Ga0105238_101442292 524
40 3300010375 Ga0105239_10100730 Ga0105239_101007302 524
41 3300010375 Ga0105239_10114714 Ga0105239_101147142 524
42 3300025904 Ga0207647_10006961 Ga0207647_100069615 524
43 3300028379 Ga0268266_10092741 Ga0268266_100927412 524
44 3300044712 Ga0453684_0079171 Ga0453684_0079171_32_1678 524
45 3300049568 Ga0501031_0024011 Ga0501031_0024011_1746_3359 524
46 3300049569 Ga0501032_0025482 Ga0501032_0025482_594_2207 524
47 3300049570 Ga0501033_0005704 Ga0501033_0005704_5002_6675 524
48 3300049570 Ga0501033_0040723 Ga0501033_0040723_1758_3371 524
49 3300049571 Ga0501034_0016464 Ga0501034_0016464_1790_3403 524
50 3300049571 Ga0501034_0082005 Ga0501034_0082005_772_2445 524
51 3300049571 Ga0501034_0140020 Ga0501034_0140020_696_2309 524
52 3300049572 Ga0501036_0006253 Ga0501036_0006253_599_2212 524
53 3300049573 Ga0501037_0000901 Ga0501037_0000901_1901_3514 524
54 3300049574 Ga0501038_0039586 Ga0501038_0039586_1938_3551 524
55 3300049574 Ga0501038_0088147 Ga0501038_0088147_84_1757 524
56 3300049575 Ga0501039_0035324 Ga0501039_0035324_1746_3359 524
57 3300049579 Ga0501043_0045244 Ga0501043_0045244_1734_3347 524
58 3300049580 Ga0501046_0007307 Ga0501046_0007307_596_2209 524
59 3300049581 Ga0501047_0002109 Ga0501047_0002109_15621_17234 524
60 3300049581 Ga0501047_0020607 Ga0501047_0020607_3650_5323 524
61 3300049582 Ga0501048_0005976 Ga0501048_0005976_117_1730 524
62 3300049586 Ga0501070_0000592 Ga0501070_0000592_7173_8786 524
63 3300049589 Ga0501073_0006491 Ga0501073_0006491_1641_3254 524
64 3300049744 Ga0501083_0035911 Ga0501083_0035911_1664_3277 524
65 3300049822 Ga0501035_0000368 Ga0501035_0000368_31190_32803 524
66 3300049823 Ga0501044_0000684 Ga0501044_0000684_5423_7036 524
67 3300049823 Ga0501044_0039906 Ga0501044_0039906_2566_4239 524
68 3300060353 Ga0501082_0058718 Ga0501082_0058718_1596_3209 524
69 3300005439 Ga0070711_100059029 Ga0070711_1000590292 525
70 3300049744 Ga0501083_0004753 Ga0501083_0004753_4110_5771 525
71 3300031241 Ga0265325_10034845 Ga0265325_100348451 527
72 3300031712 Ga0265342_10055996 Ga0265342_100559962 527
73 3300044712 Ga0453684_0000010 Ga0453684_0000010_49115_50824 527
74 3300006038 Ga0075365_10000424 Ga0075365_100004242 528
75 3300006051 Ga0075364_10000955 Ga0075364_1000095515 528
76 3300006051 Ga0075364_10012861 Ga0075364_100128615 528
77 3300025908 Ga0207643_10029813 Ga0207643_100298132 528
78 3300025933 Ga0207706_10030789 Ga0207706_100307894 528
79 3300031344 Ga0265316_10005336 Ga0265316_1000533612 528
80 3300050492 nmdc:mga0yw44_88_c1 nmdc:mga0yw44_88_c1_17768_19378 528
81 3300005355 Ga0070671_100009254 Ga0070671_1000092545 529
82 3300005364 Ga0070673_100019731 Ga0070673_1000197313 529
83 3300005455 Ga0070663_100003515 Ga0070663_1000035153 529
84 3300005530 Ga0070679_100013601 Ga0070679_1000136015 529
85 3300005548 Ga0070665_100023373 Ga0070665_1000233736 529
86 3300005563 Ga0068855_100002418 Ga0068855_10000241819 529
87 3300005834 Ga0068851_10036920 Ga0068851_100369202 529
88 3300006048 Ga0075363_100014971 Ga0075363_1000149714 529
89 3300006051 Ga0075364_10039651 Ga0075364_100396512 529
90 3300006186 Ga0075369_10004307 Ga0075369_100043076 529
91 3300006353 Ga0075370_10000205 Ga0075370_100002057 529
92 3300006871 Ga0075434_100036459 Ga0075434_1000364592 529
93 3300006880 Ga0075429_100002699 Ga0075429_1000026996 529
94 3300009093 Ga0105240_10001845 Ga0105240_100018456 529
95 3300009093 Ga0105240_10090674 Ga0105240_100906745 529
96 3300010375 Ga0105239_10185349 Ga0105239_101853493 529
97 3300013296 Ga0157374_10076801 Ga0157374_100768013 529
98 3300014325 Ga0163163_10004489 Ga0163163_1000448911 529
99 3300025913 Ga0207695_10018267 Ga0207695_100182676 529
100 3300025913 Ga0207695_10127629 Ga0207695_101276293 529
101 3300025921 Ga0207652_10000867 Ga0207652_1000086714 529
102 3300025941 Ga0207711_10033760 Ga0207711_100337602 529
103 3300025960 Ga0207651_10015139 Ga0207651_100151391 529
104 3300026035 Ga0207703_10016836 Ga0207703_100168362 529
105 3300026067 Ga0207678_10001469 Ga0207678_100014693 529
106 3300026121 Ga0207683_10047464 Ga0207683_100474643 529
107 3300028379 Ga0268266_10094745 Ga0268266_100947453 529
108 3300042876 Ga0451577_0002216 Ga0451577_0002216_17480_19123 529
109 3300044712 Ga0453684_0000177 Ga0453684_0000177_140502_142145 529
110 3300046642 Ga0495634_0085438 Ga0495634_0085438_284_1933 529
111 3300048918 Ga0496115_0002639 Ga0496115_0002639_4349_5974 529
112 3300049585 Ga0501069_0007255 Ga0501069_0007255_3717_5387 529
113 3300049741 Ga0501079_0024567 Ga0501079_0024567_1435_3105 529
114 3300050489 nmdc:mga03683_3645_c1 nmdc:mga03683_3645_c1_3244_4914 529
115 3300050490 nmdc:mga03n38_143_c1 nmdc:mga03n38_143_c1_3334_4947 529
116 3300050490 nmdc:mga03n38_24429_c1 nmdc:mga03n38_24429_c1_356_2026 529
117 3300050491 nmdc:mga00v17_5517_c1 nmdc:mga00v17_5517_c1_855_2468 529
118 3300050494 nmdc:mga06z11_2325_c1 nmdc:mga06z11_2325_c1_1434_3047 529
119 3300050496 nmdc:mga07m45_69_c1 nmdc:mga07m45_69_c1_26327_27940 529
120 3300050508 nmdc:mga09592_410_c1 nmdc:mga09592_410_c1_20328_21941 529
121 3300050512 nmdc:mga0n895_138179_c1 nmdc:mga0n895_138179_c1_578_2191 529
122 3300050516 nmdc:mga0sz30_25_c2 nmdc:mga0sz30_25_c2_3551_5164 529
123 iso_pu_bacteria 2919493220 2919497294 529
124 iso_pu_bacteria 2919543075 2919544549 529
125 iso_pu_bacteria 2923525760 2923527039 529
126 3300009101 Ga0105247_10000278 Ga0105247_1000027844 530
127 3300009176 Ga0105242_10000921 Ga0105242_100009214 530
128 3300025900 Ga0207710_10000502 Ga0207710_1000050216 530
129 3300025934 Ga0207686_10002267 Ga0207686_100022677 530
130 3300047472 Ga0495686_0024455 Ga0495686_0024455_453_2117 530
131 3300048907 Ga0496104_0000015 Ga0496104_0000015_336926_338584 530
132 3300048908 Ga0496105_0000004 Ga0496105_0000004_137215_138873 530
133 3300048922 Ga0496119_0038824 Ga0496119_0038824_350_2008 530
134 3300049587 Ga0501071_0048581 Ga0501071_0048581_1107_2813 530
135 3300053103 Ga0500555_001423 Ga0500555_001423_2752_4380 530
136 3300005436 Ga0070713_100002374 Ga0070713_10000237410 531
137 3300005563 Ga0068855_100025043 Ga0068855_1000250435 531
138 3300005563 Ga0068855_100086919 Ga0068855_1000869192 531
139 3300006051 Ga0075364_10002607 Ga0075364_100026077 531
140 3300006175 Ga0070712_100001607 Ga0070712_10000160710 531
141 3300006852 Ga0075433_10000055 Ga0075433_100000552 531
142 3300025913 Ga0207695_10012561 Ga0207695_100125618 531
143 3300025913 Ga0207695_10019085 Ga0207695_100190854 531
144 3300025949 Ga0207667_10008748 Ga0207667_100087483 531
145 3300028379 Ga0268266_10037493 Ga0268266_100374932 531
146 3300028379 Ga0268266_10038686 Ga0268266_100386862 531
147 3300037466 Ga0395898_0179344 Ga0395898_0179344_71_1726 531
148 3300038443 Ga0395901_0102890 Ga0395901_0102890_1105_2760 531
149 3300042876 Ga0451577_0013714 Ga0451577_0013714_2862_4544 531
150 3300044712 Ga0453684_0004180 Ga0453684_0004180_13931_15613 531
151 3300048905 Ga0496102_0000027 Ga0496102_0000027_188802_190532 531
152 3300048906 Ga0496103_0000155 Ga0496103_0000155_48265_49995 531
153 3300048924 Ga0496121_0055701 Ga0496121_0055701_962_2623 531
154 3300049568 Ga0501031_0019266 Ga0501031_0019266_13_1668 531
155 3300049570 Ga0501033_0082766 Ga0501033_0082766_81_1736 531
156 3300049571 Ga0501034_0030467 Ga0501034_0030467_334_1989 531
157 3300049574 Ga0501038_0053041 Ga0501038_0053041_994_2649 531
158 3300049575 Ga0501039_0019777 Ga0501039_0019777_3208_4863 531
159 3300049578 Ga0501042_0018290 Ga0501042_0018290_3005_4660 531
160 3300049579 Ga0501043_0002515 Ga0501043_0002515_13241_14896 531
161 3300049580 Ga0501046_0063196 Ga0501046_0063196_300_1955 531
162 3300049581 Ga0501047_0143821 Ga0501047_0143821_286_1941 531
163 3300049582 Ga0501048_0028092 Ga0501048_0028092_1797_3452 531
164 3300049583 Ga0501067_0008416 Ga0501067_0008416_87_1742 531
165 3300049584 Ga0501068_0026246 Ga0501068_0026246_405_2060 531
166 3300049586 Ga0501070_0017472 Ga0501070_0017472_485_2140 531
167 3300049590 Ga0501074_0004840 Ga0501074_0004840_218_1873 531
168 3300049741 Ga0501079_0013780 Ga0501079_0013780_2953_4608 531
169 3300049742 Ga0501080_0122185 Ga0501080_0122185_286_1941 531
170 3300049823 Ga0501044_0006739 Ga0501044_0006739_2717_4372 531
171 3300050491 nmdc:mga00v17_2264_c1 nmdc:mga00v17_2264_c1_3939_5558 531
172 3300050515 nmdc:mga0a205_366_c1 nmdc:mga0a205_366_c1_137_1801 531
173 3300054114 Ga0501084_0019806 Ga0501084_0019806_856_2511 531
174 3300005563 Ga0068855_100091367 Ga0068855_1000913673 532
175 3300028556 Ga0265337_1000240 Ga0265337_10002406 532
176 3300028558 Ga0265326_10000393 Ga0265326_100003932 532
177 3300028654 Ga0265322_10000029 Ga0265322_1000002953 532
178 3300029957 Ga0265324_10000423 Ga0265324_100004234 532
179 3300031238 Ga0265332_10021232 Ga0265332_100212323 532
180 3300031239 Ga0265328_10003911 Ga0265328_100039116 532
181 3300031240 Ga0265320_10000011 Ga0265320_10000011229 532
182 3300031250 Ga0265331_10001215 Ga0265331_1000121515 532
183 3300031251 Ga0265327_10000015 Ga0265327_10000015337 532
184 3300031711 Ga0265314_10000361 Ga0265314_1000036138 532
185 3300046455 Ga0495603_0000596 Ga0495603_0000596_18527_20197 532
186 3300046559 Ga0495667_0000020 Ga0495667_0000020_144130_145803 532
187 3300046675 Ga0495657_0076028 Ga0495657_0076028_401_2059 532
188 3300047322 Ga0495680_0002123 Ga0495680_0002123_9128_10801 532
189 3300053136 Ga0500559_0053041 Ga0500559_0053041_35_1693 532
190 3300005347 Ga0070668_100142192 Ga0070668_1001421922 533
191 3300005354 Ga0070675_100002574 Ga0070675_10000257412 533
192 3300005441 Ga0070700_100004262 Ga0070700_1000042621 533
193 3300005456 Ga0070678_100144684 Ga0070678_1001446842 533
194 3300005564 Ga0070664_100028557 Ga0070664_1000285574 533
195 3300005719 Ga0068861_100062254 Ga0068861_1000622543 533
196 3300014325 Ga0163163_10225399 Ga0163163_102253991 533
197 3300025907 Ga0207645_10033284 Ga0207645_100332843 533
198 3300025923 Ga0207681_10104363 Ga0207681_101043632 533
199 3300025934 Ga0207686_10016114 Ga0207686_100161142 533
200 3300025940 Ga0207691_10154562 Ga0207691_101545622 533
201 3300025942 Ga0207689_10004452 Ga0207689_100044523 533
202 3300025945 Ga0207679_10003763 Ga0207679_100037634 533
203 3300025972 Ga0207668_10101913 Ga0207668_101019132 533
204 3300026089 Ga0207648_10067184 Ga0207648_100671842 533
205 3300005354 Ga0070675_100004249 Ga0070675_1000042491 534
206 3300005367 Ga0070667_100006723 Ga0070667_1000067233 534
207 3300005444 Ga0070694_100000606 Ga0070694_10000060616 534
208 3300005548 Ga0070665_100010272 Ga0070665_1000102728 534
209 3300005981 Ga0081538_10000006 Ga0081538_1000000619 534
210 3300025986 Ga0207658_10007664 Ga0207658_100076644 534
211 3300028379 Ga0268266_10000264 Ga0268266_1000026430 534
212 3300028381 Ga0268264_10110890 Ga0268264_101108902 534
213 3300044712 Ga0453684_0052448 Ga0453684_0052448_2464_4113 534
214 3300046477 Ga0495664_0000012 Ga0495664_0000012_185812_187533 534
215 3300048906 Ga0496103_0023229 Ga0496103_0023229_1207_2892 534
216 3300048907 Ga0496104_0016788 Ga0496104_0016788_2895_4565 534
217 3300048908 Ga0496105_0018671 Ga0496105_0018671_1221_2891 534
218 3300048909 Ga0496106_0076105 Ga0496106_0076105_845_2515 534
219 3300048910 Ga0496107_0035024 Ga0496107_0035024_1341_3011 534
220 3300048919 Ga0496116_0000176 Ga0496116_0000176_58544_60214 534
221 3300048920 Ga0496117_0002967 Ga0496117_0002967_17238_18923 534
222 3300048922 Ga0496119_0001444 Ga0496119_0001444_4086_5756 534
223 3300048922 Ga0496119_0006106 Ga0496119_0006106_26_1696 534
224 3300048924 Ga0496121_0014377 Ga0496121_0014377_1885_3555 534
225 3300053077 Ga0495601_0008867 Ga0495601_0008867_3194_4915 534
226 3300005338 Ga0068868_100088288 Ga0068868_1000882882 535
227 3300037853 Ga0436364_0154387 Ga0436364_0154387_348_2072 535
228 3300047317 Ga0495604_0103329 Ga0495604_0103329_88_1812 535
229 3300006847 Ga0075431_100070259 Ga0075431_1000702593 536
230 3300035725 Ga0373947_0088568 Ga0373947_0088568_38_1867 537
231 3300047317 Ga0495604_0000190 Ga0495604_0000190_3772_5544 537
232 3300048924 Ga0496121_0004005 Ga0496121_0004005_15876_17630 537
233 3300006178 Ga0075367_10007323 Ga0075367_100073233 538
234 3300048903 Ga0496100_0020337 Ga0496100_0020337_748_2484 538
235 3300048929 Ga0496126_0003514 Ga0496126_0003514_2035_3726 538
236 3300050492 nmdc:mga0yw44_18945_c1 nmdc:mga0yw44_18945_c1_972_2714 538
237 3300053096 Ga0500641_0005118 Ga0500641_0005118_1173_2915 538
238 3300046460 Ga0495638_0013818 Ga0495638_0013818_3499_5241 539
239 3300005518 Ga0070699_100015977 Ga0070699_1000159774 540
240 3300006051 Ga0075364_10000724 Ga0075364_100007249 540
241 3300006051 Ga0075364_10019874 Ga0075364_100198743 540
242 3300050491 nmdc:mga00v17_34182_c1 nmdc:mga00v17_34182_c1_343_1998 540
243 3300048923 Ga0496120_0003250 Ga0496120_0003250_4004_5710 541
244 3300048924 Ga0496121_0014861 Ga0496121_0014861_1648_3354 541
245 3300048928 Ga0496125_0028123 Ga0496125_0028123_2450_4156 541
246 3300042876 Ga0451577_0023154 Ga0451577_0023154_593_2257 542
247 3300042876 Ga0451577_0026266 Ga0451577_0026266_150_1844 542
248 3300044712 Ga0453684_0012309 Ga0453684_0012309_11535_13349 542
249 3300053077 Ga0495601_0019043 Ga0495601_0019043_1144_2904 542
250 3300048929 Ga0496126_0023298 Ga0496126_0023298_101_1831 543
251 3300049593 Ga0501077_0026890 Ga0501077_0026890_595_2367 543
252 3300005545 Ga0070695_100011036 Ga0070695_1000110363 544
253 3300009093 Ga0105240_10062437 Ga0105240_100624372 544
254 3300014325 Ga0163163_10064218 Ga0163163_100642183 544
255 3300031251 Ga0265327_10001841 Ga0265327_1000184114 544
256 3300006844 Ga0075428_100000538 Ga0075428_10000053835 545
257 3300006846 Ga0075430_100000022 Ga0075430_10000002269 545
258 3300006847 Ga0075431_100027664 Ga0075431_1000276644 545
259 3300006880 Ga0075429_100000069 Ga0075429_10000006942 545
260 3300046472 Ga0495580_0022002 Ga0495580_0022002_1052_2761 545
261 3300047321 Ga0495676_0045786 Ga0495676_0045786_1055_2764 545
262 3300047322 Ga0495680_0108170 Ga0495680_0108170_354_2054 545
263 3300050508 nmdc:mga09592_405_c1 nmdc:mga09592_405_c1_1696_3417 545
264 3300050509 nmdc:mga0qj67_302_c1 nmdc:mga0qj67_302_c1_7026_8747 545
265 3300050510 nmdc:mga06r32_21166_c1 nmdc:mga06r32_21166_c1_2713_4434 545
266 3300045976 Ga0466967_0141287 Ga0466967_0141287_21_1736 546
267 3300053085 Ga0495619_0053584 Ga0495619_0053584_903_2642 546
268 3300005353 Ga0070669_100016569 Ga0070669_1000165694 547
269 3300005441 Ga0070700_100007622 Ga0070700_1000076224 547
270 3300005457 Ga0070662_100027455 Ga0070662_1000274552 547
271 3300025913 Ga0207695_10029271 Ga0207695_100292716 547
272 3300025923 Ga0207681_10004762 Ga0207681_100047625 547
273 3300025927 Ga0207687_10009645 Ga0207687_100096455 547
274 3300027378 Ga0209981_1000162 Ga0209981_10001621 547
275 3300031251 Ga0265327_10002681 Ga0265327_100026812 547
276 3300032126 Ga0307415_100054497 Ga0307415_1000544972 547
277 3300005330 Ga0070690_100002234 Ga0070690_1000022343 548
278 3300005331 Ga0070670_100006871 Ga0070670_1000068713 548
279 3300005333 Ga0070677_10003228 Ga0070677_100032284 548
280 3300005336 Ga0070680_100001202 Ga0070680_1000012023 548
281 3300005338 Ga0068868_100011537 Ga0068868_1000115374 548
282 3300005340 Ga0070689_100013395 Ga0070689_1000133954 548
283 3300005347 Ga0070668_100005046 Ga0070668_1000050467 548
284 3300005356 Ga0070674_100000865 Ga0070674_1000008655 548
285 3300005366 Ga0070659_100034509 Ga0070659_1000345092 548
286 3300005367 Ga0070667_100003919 Ga0070667_1000039199 548
287 3300005440 Ga0070705_100020583 Ga0070705_1000205832 548
288 3300005458 Ga0070681_10021331 Ga0070681_100213314 548
289 3300005459 Ga0068867_100002418 Ga0068867_1000024187 548
290 3300005530 Ga0070679_100062244 Ga0070679_1000622442 548
291 3300005543 Ga0070672_100093007 Ga0070672_1000930072 548
292 3300005545 Ga0070695_100024880 Ga0070695_1000248803 548
293 3300005547 Ga0070693_100041862 Ga0070693_1000418621 548
294 3300005563 Ga0068855_100216079 Ga0068855_1002160792 548
295 3300005577 Ga0068857_100026351 Ga0068857_1000263512 548
296 3300005843 Ga0068860_100053803 Ga0068860_1000538032 548
297 3300006058 Ga0075432_10001488 Ga0075432_100014882 548
298 3300006237 Ga0097621_100006479 Ga0097621_1000064792 548
299 3300006358 Ga0068871_100098676 Ga0068871_1000986762 548
300 3300006846 Ga0075430_100043207 Ga0075430_1000432073 548
301 3300006880 Ga0075429_100019577 Ga0075429_1000195774 548
302 3300006881 Ga0068865_100023984 Ga0068865_1000239842 548
303 3300007076 Ga0075435_100013974 Ga0075435_1000139744 548
304 3300007265 Ga0099794_10001536 Ga0099794_100015365 548
305 3300009098 Ga0105245_10004403 Ga0105245_1000440311 548
306 3300009148 Ga0105243_10002135 Ga0105243_100021352 548
307 3300009176 Ga0105242_10000479 Ga0105242_1000047918 548
308 3300009553 Ga0105249_10019551 Ga0105249_100195512 548
309 3300010375 Ga0105239_10017132 Ga0105239_100171322 548
310 3300011119 Ga0105246_10000806 Ga0105246_100008063 548
311 3300013297 Ga0157378_10003105 Ga0157378_1000310510 548
312 3300014326 Ga0157380_10007013 Ga0157380_100070135 548
313 3300014745 Ga0157377_10013792 Ga0157377_100137922 548
314 3300014969 Ga0157376_10011158 Ga0157376_100111582 548
315 3300025901 Ga0207688_10005394 Ga0207688_100053947 548
316 3300025907 Ga0207645_10000134 Ga0207645_1000013427 548
317 3300025912 Ga0207707_10053735 Ga0207707_100537351 548
318 3300025918 Ga0207662_10002099 Ga0207662_100020994 548
319 3300025919 Ga0207657_10012644 Ga0207657_100126449 548
320 3300025921 Ga0207652_10146131 Ga0207652_101461311 548
321 3300025932 Ga0207690_10070541 Ga0207690_100705412 548
322 3300025933 Ga0207706_10000433 Ga0207706_1000043325 548
323 3300025937 Ga0207669_10017005 Ga0207669_100170053 548
324 3300025938 Ga0207704_10011927 Ga0207704_100119273 548
325 3300025939 Ga0207665_10018688 Ga0207665_100186884 548
326 3300025940 Ga0207691_10002262 Ga0207691_100022624 548
327 3300025961 Ga0207712_10010069 Ga0207712_100100694 548
328 3300026023 Ga0207677_10025766 Ga0207677_100257663 548
329 3300026075 Ga0207708_10000394 Ga0207708_1000039420 548
330 3300026089 Ga0207648_10000557 Ga0207648_1000055715 548
331 3300026116 Ga0207674_10037265 Ga0207674_100372655 548
332 3300026121 Ga0207683_10000361 Ga0207683_1000036128 548
333 3300027360 Ga0209969_1000272 Ga0209969_10002722 548
334 3300027364 Ga0209967_1000170 Ga0209967_10001707 548
335 3300027424 Ga0209984_1000274 Ga0209984_10002742 548
336 3300027462 Ga0210000_1000280 Ga0210000_10002802 548
337 3300027471 Ga0209995_1000103 Ga0209995_10001037 548
338 3300027552 Ga0209982_1000036 Ga0209982_10000369 548
339 3300027617 Ga0210002_1000089 Ga0210002_10000898 548
340 3300027665 Ga0209983_1000237 Ga0209983_10002372 548
341 3300027695 Ga0209966_1000553 Ga0209966_10005537 548
342 3300027717 Ga0209998_10000014 Ga0209998_100000142 548
343 3300027907 Ga0207428_10021185 Ga0207428_100211854 548
344 3300044694 Ga0466963_0032574 Ga0466963_0032574_71_1834 548
345 3300049575 Ga0501039_0034932 Ga0501039_0034932_763_2484 548
346 3300049588 Ga0501072_0004269 Ga0501072_0004269_7697_9418 548
347 3300049591 Ga0501075_0013557 Ga0501075_0013557_2955_4754 548
348 3300049592 Ga0501076_0014867 Ga0501076_0014867_2514_4244 548
349 3300049593 Ga0501077_0035180 Ga0501077_0035180_435_2156 548
350 3300049741 Ga0501079_0074484 Ga0501079_0074484_744_2465 548
351 3300050507 nmdc:mga05p37_21210_c1 nmdc:mga05p37_21210_c1_133_1905 548
352 3300050509 nmdc:mga0qj67_16683_c1 nmdc:mga0qj67_16683_c1_970_2742 548
353 3300050514 nmdc:mga08x19_61390_c1 nmdc:mga08x19_61390_c1_127_1899 548
354 3300050515 nmdc:mga0a205_127515_c1 nmdc:mga0a205_127515_c1_249_2021 548
355 3300028558 Ga0265326_10000621 Ga0265326_100006216 549
356 3300028563 Ga0265319_1005656 Ga0265319_10056565 549
357 3300028666 Ga0265336_10000005 Ga0265336_10000005304 549
358 3300028800 Ga0265338_10000001 Ga0265338_100000011122 549
359 3300029957 Ga0265324_10021184 Ga0265324_100211842 549
360 3300031247 Ga0265340_10000001 Ga0265340_100000011120 549
361 3300049576 Ga0501040_0023647 Ga0501040_0023647_368_2161 549
362 3300049578 Ga0501042_0029580 Ga0501042_0029580_1236_3029 549
363 3300049822 Ga0501035_0093010 Ga0501035_0093010_72_1865 549
364 3300049824 Ga0501045_0089350 Ga0501045_0089350_150_1943 549
365 3300005467 Ga0070706_100053398 Ga0070706_1000533982 550
366 3300031548 Ga0307408_100059961 Ga0307408_1000599611 550
367 3300006871 Ga0075434_100019970 Ga0075434_1000199702 551
368 3300009094 Ga0111539_10018478 Ga0111539_100184785 551
369 3300009147 Ga0114129_10065834 Ga0114129_100658345 551
370 3300009553 Ga0105249_10025298 Ga0105249_100252986 551
371 3300044712 Ga0453684_0000072 Ga0453684_0000072_104030_105730 551
372 3300046461 Ga0495641_0001114 Ga0495641_0001114_19141_20859 551
373 3300050507 nmdc:mga05p37_44861_c1 nmdc:mga05p37_44861_c1_629_2389 551
374 3300050514 nmdc:mga08x19_51140_c1 nmdc:mga08x19_51140_c1_411_2135 552
375 3300050515 nmdc:mga0a205_6077_c1 nmdc:mga0a205_6077_c1_158_1882 552
376 3300005468 Ga0070707_100036153 Ga0070707_1000361534 553
377 3300006847 Ga0075431_100112489 Ga0075431_1001124892 553
378 3300014745 Ga0157377_10013662 Ga0157377_100136621 553
379 3300025922 Ga0207646_10165281 Ga0207646_101652811 553
380 3300050515 nmdc:mga0a205_2674_c1 nmdc:mga0a205_2674_c1_3898_5610 553
381 3300005444 Ga0070694_100050542 Ga0070694_1000505422 554
382 3300005467 Ga0070706_100110745 Ga0070706_1001107452 554
383 3300005471 Ga0070698_100023799 Ga0070698_1000237993 554
384 3300005518 Ga0070699_100070280 Ga0070699_1000702802 554
385 3300005536 Ga0070697_100019654 Ga0070697_1000196544 554
386 3300009176 Ga0105242_10048633 Ga0105242_100486332 554
387 3300025910 Ga0207684_10001278 Ga0207684_1000127812 554
388 3300025922 Ga0207646_10000311 Ga0207646_1000031120 554
389 3300042876 Ga0451577_0005547 Ga0451577_0005547_9910_11637 554
390 3300049569 Ga0501032_0017545 Ga0501032_0017545_3266_5008 555
391 3300049576 Ga0501040_0025428 Ga0501040_0025428_1788_3512 555
392 3300049577 Ga0501041_0034230 Ga0501041_0034230_930_2654 555
393 3300049578 Ga0501042_0065925 Ga0501042_0065925_739_2463 555
394 3300049580 Ga0501046_0056469 Ga0501046_0056469_1036_2760 555
395 3300049588 Ga0501072_0078213 Ga0501072_0078213_796_2550 555
396 3300049592 Ga0501076_0015737 Ga0501076_0015737_1544_3298 555
397 3300049593 Ga0501077_0073771 Ga0501077_0073771_35_1789 555
398 3300049743 Ga0501081_0050144 Ga0501081_0050144_938_2692 555
399 3300060353 Ga0501082_0002443 Ga0501082_0002443_3308_5032 555
400 3300005336 Ga0070680_100100415 Ga0070680_1001004152 556
401 3300005345 Ga0070692_10010491 Ga0070692_100104912 556
402 3300005438 Ga0070701_10001128 Ga0070701_100011287 556
403 3300005444 Ga0070694_100033217 Ga0070694_1000332172 556
404 3300005545 Ga0070695_100029601 Ga0070695_1000296012 556
405 3300005937 Ga0081455_10018220 Ga0081455_100182205 556
406 3300006358 Ga0068871_100003744 Ga0068871_1000037442 556
407 3300006844 Ga0075428_100004141 Ga0075428_10000414115 556
408 3300006846 Ga0075430_100014570 Ga0075430_1000145707 556
409 3300006847 Ga0075431_100017262 Ga0075431_1000172627 556
410 3300006852 Ga0075433_10022968 Ga0075433_100229682 556
411 3300006880 Ga0075429_100021045 Ga0075429_1000210452 556
412 3300009147 Ga0114129_10065170 Ga0114129_100651702 556
413 3300013308 Ga0157375_10028173 Ga0157375_100281732 556
414 3300025926 Ga0207659_10002985 Ga0207659_100029856 556
415 3300025933 Ga0207706_10014061 Ga0207706_100140613 556
416 3300025945 Ga0207679_10000816 Ga0207679_100008164 556
417 3300035695 Ga0373927_0003744 Ga0373927_0003744_1924_3648 556
418 3300037068 Ga0373925_0003041 Ga0373925_0003041_4324_6048 556
419 3300048907 Ga0496104_0058523 Ga0496104_0058523_824_2575 556
420 3300048917 Ga0496114_0015247 Ga0496114_0015247_2530_4281 556
421 3300049573 Ga0501037_0124783 Ga0501037_0124783_13_1764 556
422 3300049585 Ga0501069_0021301 Ga0501069_0021301_19_1770 556
423 3300050509 nmdc:mga0qj67_32926_c1 nmdc:mga0qj67_32926_c1_195_1910 556
424 3300050510 nmdc:mga06r32_6387_c1 nmdc:mga06r32_6387_c1_1002_2717 556
425 3300049574 Ga0501038_0076358 Ga0501038_0076358_816_2570 557
426 3300049575 Ga0501039_0056957 Ga0501039_0056957_442_2196 557
427 3300005445 Ga0070708_100000766 Ga0070708_1000007666 558
428 3300005467 Ga0070706_100069209 Ga0070706_1000692092 558
429 3300005471 Ga0070698_100101129 Ga0070698_1001011291 558
430 3300005981 Ga0081538_10000185 Ga0081538_1000018528 558
431 3300005981 Ga0081538_10001125 Ga0081538_100011258 558
432 3300006847 Ga0075431_100118930 Ga0075431_1001189302 558
433 3300031727 Ga0316576_10024737 Ga0316576_100247374 558
434 3300031733 Ga0316577_10006313 Ga0316577_100063136 558
435 3300042461 Ga0439460_0011819 Ga0439460_0011819_292_2010 558
436 3300042993 Ga0439440_0001118 Ga0439440_0001118_1961_3679 558
437 3300049575 Ga0501039_0118994 Ga0501039_0118994_288_2006 558
438 3300049576 Ga0501040_0043555 Ga0501040_0043555_189_1907 558
439 3300049741 Ga0501079_0026522 Ga0501079_0026522_1942_3660 558
440 3300050507 nmdc:mga05p37_117857_c1 nmdc:mga05p37_117857_c1_1041_2759 558
441 3300005468 Ga0070707_100004903 Ga0070707_10000490313 559
442 3300006846 Ga0075430_100000126 Ga0075430_10000012629 559
443 3300025910 Ga0207684_10011397 Ga0207684_100113974 559
444 3300050507 nmdc:mga05p37_19885_c1 nmdc:mga05p37_19885_c1_1789_3591 559
445 3300050509 nmdc:mga0qj67_2445_c1 nmdc:mga0qj67_2445_c1_8666_10468 559
446 3300005367 Ga0070667_100008294 Ga0070667_1000082945 560
447 3300005457 Ga0070662_100102847 Ga0070662_1001028471 560
448 3300005981 Ga0081538_10007201 Ga0081538_100072017 560
449 3300006847 Ga0075431_100062606 Ga0075431_1000626062 560
450 3300006852 Ga0075433_10000868 Ga0075433_1000086819 560
451 3300009094 Ga0111539_10000274 Ga0111539_1000027410 560
452 3300025933 Ga0207706_10090275 Ga0207706_100902751 560
453 3300025986 Ga0207658_10018850 Ga0207658_100188503 560
454 3300027907 Ga0207428_10000426 Ga0207428_1000042651 560
455 3300031691 Ga0316579_10017057 Ga0316579_100170572 560
456 3300035691 Ga0373931_0002440 Ga0373931_0002440_5146_6870 560
457 3300042876 Ga0451577_0001787 Ga0451577_0001787_3229_4950 560
458 3300044712 Ga0453684_0037153 Ga0453684_0037153_147_1868 560
459 3300044712 Ga0453684_0068036 Ga0453684_0068036_1089_2816 560
460 3300045051 Ga0451576_0089859 Ga0451576_0089859_1036_2757 560
461 3300048909 Ga0496106_0086688 Ga0496106_0086688_306_2030 560
462 3300049590 Ga0501074_0062018 Ga0501074_0062018_252_1979 560
463 3300050512 nmdc:mga0n895_26597_c1 nmdc:mga0n895_26597_c1_989_2716 560
464 3300050512 nmdc:mga0n895_28653_c1 nmdc:mga0n895_28653_c1_981_2702 560
465 3300050513 nmdc:mga0rr50_55433_c1 nmdc:mga0rr50_55433_c1_63_1790 560
466 3300050514 nmdc:mga08x19_7279_c1 nmdc:mga08x19_7279_c1_3350_5074 560
467 3300050515 nmdc:mga0a205_4128_c1 nmdc:mga0a205_4128_c1_5141_6862 560
468 3300050515 nmdc:mga0a205_4535_c1 nmdc:mga0a205_4535_c1_9102_10823 560
469 3300005340 Ga0070689_100082042 Ga0070689_1000820421 561
470 3300006051 Ga0075364_10017851 Ga0075364_100178513 561
471 3300006844 Ga0075428_100003176 Ga0075428_1000031762 561
472 3300009094 Ga0111539_10016794 Ga0111539_100167946 561
473 3300009094 Ga0111539_10136005 Ga0111539_101360052 561
474 3300009147 Ga0114129_10000830 Ga0114129_1000083016 561
475 3300009553 Ga0105249_10023725 Ga0105249_100237255 561
476 3300013306 Ga0163162_10010688 Ga0163162_100106882 561
477 3300025923 Ga0207681_10010335 Ga0207681_100103354 561
478 3300025936 Ga0207670_10034436 Ga0207670_100344361 561
479 3300027907 Ga0207428_10010288 Ga0207428_100102885 561
480 3300028381 Ga0268264_10161779 Ga0268264_101617791 561
481 3300031691 Ga0316579_10003307 Ga0316579_100033074 561
482 3300036712 Ga0316584_0000757 Ga0316584_0000757_15677_17413 561
483 3300036712 Ga0316584_0022454 Ga0316584_0022454_2176_3912 561
484 3300037418 Ga0395900_0005975 Ga0395900_0005975_7619_9379 561
485 3300037466 Ga0395898_0012550 Ga0395898_0012550_6238_8001 561
486 3300037471 Ga0395905_0021240 Ga0395905_0021240_902_2662 561
487 3300038443 Ga0395901_0009290 Ga0395901_0009290_4864_6627 561
488 3300038443 Ga0395901_0010764 Ga0395901_0010764_3972_5732 561
489 3300049569 Ga0501032_0037486 Ga0501032_0037486_1383_3113 561
490 3300049570 Ga0501033_0013165 Ga0501033_0013165_3830_5560 561
491 3300049572 Ga0501036_0002059 Ga0501036_0002059_4201_5931 561
492 3300049572 Ga0501036_0031963 Ga0501036_0031963_43_1773 561
493 3300049574 Ga0501038_0017202 Ga0501038_0017202_1242_2972 561
494 3300049575 Ga0501039_0014387 Ga0501039_0014387_4201_5931 561
495 3300049576 Ga0501040_0001522 Ga0501040_0001522_4568_6298 561
496 3300049576 Ga0501040_0006557 Ga0501040_0006557_4618_6348 561
497 3300049577 Ga0501041_0007553 Ga0501041_0007553_1062_2792 561
498 3300049578 Ga0501042_0001724 Ga0501042_0001724_1369_3099 561
499 3300049578 Ga0501042_0011854 Ga0501042_0011854_3552_5282 561
500 3300049578 Ga0501042_0020204 Ga0501042_0020204_111_1841 561
501 3300049580 Ga0501046_0062494 Ga0501046_0062494_1011_2741 561
502 3300049582 Ga0501048_0004425 Ga0501048_0004425_4703_6433 561
503 3300049582 Ga0501048_0026309 Ga0501048_0026309_1185_2915 561
504 3300049584 Ga0501068_0039269 Ga0501068_0039269_1080_2810 561
505 3300049587 Ga0501071_0000146 Ga0501071_0000146_5724_7454 561
506 3300049587 Ga0501071_0084832 Ga0501071_0084832_433_2163 561
507 3300049588 Ga0501072_0001102 Ga0501072_0001102_6333_8063 561
508 3300049588 Ga0501072_0003271 Ga0501072_0003271_290_2020 561
509 3300049589 Ga0501073_0099530 Ga0501073_0099530_150_1880 561
510 3300049590 Ga0501074_0009485 Ga0501074_0009485_4585_6315 561
511 3300049591 Ga0501075_0000052 Ga0501075_0000052_38301_40031 561
512 3300049591 Ga0501075_0000387 Ga0501075_0000387_18975_20705 561
513 3300049592 Ga0501076_0000744 Ga0501076_0000744_7333_9063 561
514 3300049592 Ga0501076_0000935 Ga0501076_0000935_8224_9954 561
515 3300049592 Ga0501076_0007345 Ga0501076_0007345_1270_3000 561
516 3300049741 Ga0501079_0000292 Ga0501079_0000292_17852_19582 561
517 3300049742 Ga0501080_0000228 Ga0501080_0000228_23646_25376 561
518 3300049743 Ga0501081_0000416 Ga0501081_0000416_20564_22294 561
519 3300049743 Ga0501081_0054175 Ga0501081_0054175_236_2029 561
520 3300049822 Ga0501035_0012623 Ga0501035_0012623_5669_7399 561
521 3300049824 Ga0501045_0003796 Ga0501045_0003796_4563_6293 561
522 3300050492 nmdc:mga0yw44_7343_c1 nmdc:mga0yw44_7343_c1_1853_3613 561
523 3300050507 nmdc:mga05p37_1820_c1 nmdc:mga05p37_1820_c1_13455_15185 561
524 3300050511 nmdc:mga08y16_2827_c1 nmdc:mga08y16_2827_c1_3350_5074 561
525 3300054114 Ga0501084_0000912 Ga0501084_0000912_6332_8062 561
526 3300060353 Ga0501082_0008754 Ga0501082_0008754_373_2103 561
527 3300060353 Ga0501082_0038968 Ga0501082_0038968_350_2080 561
528 3300061734 Ga0530510_0000017 Ga0530510_0000017_35783_37513 561
529 3300061734 Ga0530510_0000168 Ga0530510_0000168_1159_2883 561
530 3300061734 Ga0530510_0007392 Ga0530510_0007392_3552_5282 561
531 3300061734 Ga0530510_0009273 Ga0530510_0009273_4680_6410 561
532 3300037466 Ga0395898_0145767 Ga0395898_0145767_548_2248 562
533 3300038443 Ga0395901_0197065 Ga0395901_0197065_322_2088 562
534 3300048905 Ga0496102_0212050 Ga0496102_0212050_20_1720 562
535 3300048918 Ga0496115_0000035 Ga0496115_0000035_84813_86552 562
536 3300005330 Ga0070690_100000305 Ga0070690_1000003054 563
537 3300005343 Ga0070687_100002317 Ga0070687_1000023172 563
538 3300005364 Ga0070673_100138022 Ga0070673_1001380221 563
539 3300005365 Ga0070688_100006698 Ga0070688_1000066986 563
540 3300005543 Ga0070672_100000197 Ga0070672_10000019725 563
541 3300005544 Ga0070686_100005443 Ga0070686_1000054432 563
542 3300006846 Ga0075430_100033898 Ga0075430_1000338983 563
543 3300006847 Ga0075431_100037642 Ga0075431_1000376422 563
544 3300009545 Ga0105237_10004164 Ga0105237_1000416412 563
545 3300013297 Ga0157378_10000610 Ga0157378_1000061038 563
546 3300025903 Ga0207680_10041826 Ga0207680_100418262 563
547 3300025925 Ga0207650_10031455 Ga0207650_100314552 563
548 3300025940 Ga0207691_10000080 Ga0207691_1000008035 563
549 3300025960 Ga0207651_10000078 Ga0207651_1000007824 563
550 3300045051 Ga0451576_0007659 Ga0451576_0007659_11007_12779 563
551 3300049571 Ga0501034_0163229 Ga0501034_0163229_252_2018 563
552 3300049575 Ga0501039_0106997 Ga0501039_0106997_34_1800 563
553 3300049576 Ga0501040_0098330 Ga0501040_0098330_213_1985 563
554 3300049577 Ga0501041_0028787 Ga0501041_0028787_1153_2925 563
555 3300049577 Ga0501041_0041266 Ga0501041_0041266_914_2680 563
556 3300049580 Ga0501046_0005055 Ga0501046_0005055_9665_11431 563
557 3300049582 Ga0501048_0049052 Ga0501048_0049052_500_2272 563
558 3300049582 Ga0501048_0072099 Ga0501048_0072099_16_1782 563
559 3300049592 Ga0501076_0028117 Ga0501076_0028117_740_2512 563
560 3300049741 Ga0501079_0081859 Ga0501079_0081859_13_1785 563
561 3300054114 Ga0501084_0036170 Ga0501084_0036170_831_2603 563
562 3300061734 Ga0530510_0109831 Ga0530510_0109831_173_1945 563
563 3300005336 Ga0070680_100008822 Ga0070680_1000088225 564
564 3300005546 Ga0070696_100024483 Ga0070696_1000244831 564
565 3300006847 Ga0075431_100000203 Ga0075431_10000020325 564
566 3300006852 Ga0075433_10024377 Ga0075433_100243775 564
567 3300014969 Ga0157376_10013961 Ga0157376_100139612 564
568 3300026118 Ga0207675_100126594 Ga0207675_1001265942 564
569 3300031344 Ga0265316_10000536 Ga0265316_100005362 564
570 3300050510 nmdc:mga06r32_5740_c1 nmdc:mga06r32_5740_c1_8564_10366 564
571 3300031824 Ga0307413_10109394 Ga0307413_101093941 565
572 3300031995 Ga0307409_100040359 Ga0307409_1000403591 565
573 3300049577 Ga0501041_0016982 Ga0501041_0016982_2427_4220 565
574 3300046517 Ga0495630_0000891 Ga0495630_0000891_423_2195 566
575 3300046675 Ga0495657_0000007 Ga0495657_0000007_144293_146065 566
576 3300009147 Ga0114129_10044693 Ga0114129_100446933 567
577 3300050510 nmdc:mga06r32_108492_c1 nmdc:mga06r32_108492_c1_365_2149 567
578 3300005330 Ga0070690_100002631 Ga0070690_1000026318 568
579 3300005340 Ga0070689_100000158 Ga0070689_1000001583 568
580 3300005365 Ga0070688_100003566 Ga0070688_1000035665 568
581 3300005437 Ga0070710_10020150 Ga0070710_100201502 568
582 3300005438 Ga0070701_10000814 Ga0070701_100008145 568
583 3300005466 Ga0070685_10000304 Ga0070685_100003049 568
584 3300005544 Ga0070686_100001064 Ga0070686_1000010648 568
585 3300009177 Ga0105248_10005285 Ga0105248_100052853 568
586 3300025936 Ga0207670_10000797 Ga0207670_100007976 568
587 3300025941 Ga0207711_10023212 Ga0207711_100232124 568
588 3300026075 Ga0207708_10002710 Ga0207708_100027103 568
589 3300026089 Ga0207648_10011733 Ga0207648_100117336 568
590 3300050512 nmdc:mga0n895_25905_c1 nmdc:mga0n895_25905_c1_443_2236 568
591 3300005328 Ga0070676_10006175 Ga0070676_100061753 569
592 3300005331 Ga0070670_100005213 Ga0070670_1000052132 569
593 3300005335 Ga0070666_10003792 Ga0070666_100037927 569
594 3300005338 Ga0068868_100020604 Ga0068868_1000206043 569
595 3300005354 Ga0070675_100000972 Ga0070675_10000097216 569
596 3300005355 Ga0070671_100003350 Ga0070671_1000033503 569
597 3300005356 Ga0070674_100000802 Ga0070674_1000008025 569
598 3300005364 Ga0070673_100000143 Ga0070673_10000014315 569
599 3300005456 Ga0070678_100000378 Ga0070678_10000037814 569
600 3300005459 Ga0068867_100043609 Ga0068867_1000436093 569
601 3300025937 Ga0207669_10005346 Ga0207669_100053463 569
602 3300048907 Ga0496104_0025988 Ga0496104_0025988_3432_5153 569
603 3300048908 Ga0496105_0002253 Ga0496105_0002253_6616_8337 569
604 3300048909 Ga0496106_0046899 Ga0496106_0046899_238_1959 569
605 3300048912 Ga0496109_0013371 Ga0496109_0013371_3069_4790 569
606 3300048912 Ga0496109_0173032 Ga0496109_0173032_71_1792 569
607 3300048915 Ga0496112_0053022 Ga0496112_0053022_1067_2785 569
608 3300048916 Ga0496113_0088786 Ga0496113_0088786_71_1792 569
609 3300005983 Ga0081540_1000159 Ga0081540_100015914 570
610 3300009094 Ga0111539_10000081 Ga0111539_1000008190 570
611 3300025914 Ga0207671_10002923 Ga0207671_1000292317 570
612 3300027907 Ga0207428_10002909 Ga0207428_100029093 570
613 3300048903 Ga0496100_0020234 Ga0496100_0020234_187_2001 570
614 3300050511 nmdc:mga08y16_196_c1 nmdc:mga08y16_196_c1_35223_37037 570
615 3300048918 Ga0496115_0000143 Ga0496115_0000143_23281_25050 571
616 3300039438 Ga0436360_0711520 Ga0436360_0711520_768_2843 572
617 3300005548 Ga0070665_100001080 Ga0070665_10000108031 574
618 3300005985 Ga0081539_10006735 Ga0081539_100067355 574
619 3300028379 Ga0268266_10004961 Ga0268266_100049618 574
620 3300005981 Ga0081538_10013275 Ga0081538_100132752 575
621 3300048924 Ga0496121_0003484 Ga0496121_0003484_7465_9201 577
622 3300031731 Ga0307405_10020736 Ga0307405_100207362 578
623 3300031995 Ga0307409_100014889 Ga0307409_1000148892 578
624 3300032126 Ga0307415_100001589 Ga0307415_10000158910 578
625 3300032126 Ga0307415_100101116 Ga0307415_1001011162 578
626 3300005617 Ga0068859_100076500 Ga0068859_1000765002 581
627 3300005844 Ga0068862_100123964 Ga0068862_1001239642 581
628 3300006931 Ga0097620_100076502 Ga0097620_1000765022 581
629 3300048913 Ga0496110_0082585 Ga0496110_0082585_467_2212 581
630 3300005329 Ga0070683_100033173 Ga0070683_1000331732 583
631 3300005981 Ga0081538_10000800 Ga0081538_100008003 585
632 3300005981 Ga0081538_10058015 Ga0081538_100580152 585
633 3300009094 Ga0111539_10032707 Ga0111539_100327073 585
634 3300031995 Ga0307409_100014418 Ga0307409_1000144183 585
635 3300032002 Ga0307416_100011881 Ga0307416_1000118815 585
636 3300050511 nmdc:mga08y16_17331_c1 nmdc:mga08y16_17331_c1_4255_6012 585
637 3300049576 Ga0501040_0072628 Ga0501040_0072628_104_1867 587
638 3300061734 Ga0530510_0033345 Ga0530510_0033345_400_2163 587
639 3300006844 Ga0075428_100007682 Ga0075428_1000076823 588
640 3300027907 Ga0207428_10053680 Ga0207428_100536803 588
641 3300031995 Ga0307409_100092838 Ga0307409_1000928382 588
642 3300003203 JGI25406J46586_10021445 JGI25406J46586_100214452 589
643 3300005985 Ga0081539_10003739 Ga0081539_1000373913 589

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02540

NAD_synthase

NAD synthase

343

595

0.96

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

44

290

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xnh-assembly1.cif.gz_A-2 crystal structure of nh3-dependent nad+ synthetase from helicobacter pylori 0.925 301 550
3p52-assembly1.cif.gz_A nh3-dependent nad synthetase from campylobacter jejuni subsp. jejuni nctc 11168 in complex with the nitrate ion 0.9123 297 550
3p52-assembly1.cif.gz_B nh3-dependent nad synthetase from campylobacter jejuni subsp. jejuni nctc 11168 in complex with the nitrate ion 0.912 298 550
3fiu-assembly2.cif.gz_D structure of nmn synthetase from francisella tularensis 0.9015 297 551
3n05-assembly1.cif.gz_A crystal structure of nh3-dependent nad+ synthetase from streptomyces avermitilis 0.8914 8 578
ID Description Score Start End Superfamily
af_Q9XXK6_5_292_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9375 8 254 3.60.110.10
3n05B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9352 300 489 3.40.50.620
3n05B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9253 300 489 3.40.50.620
1xnhA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.925 301 550 3.40.50.620
3fiuC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9248 297 551 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A534NNB0-F1-model_v4 NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) 0.9989 301 436 GO:0003952
GO:0004359
GO:0005524
GO:0005737
GO:0008795
GO:0009435
AF-A0A3D2JLK1-F1-model_v4 NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) 0.997 334 438 GO:0003952
GO:0004359
GO:0005524
GO:0005737
GO:0008795
GO:0009435
AF-X1DKX7-F1-model_v4 NAD/GMP synthase domain-containing protein 0.9889 381 550 GO:0003952
GO:0004359
GO:0005524
GO:0005737
GO:0009435
AF-A0A3N5T2D8-F1-model_v4 NAD+ synthase 0.9858 8 250 GO:0000257
GO:0003952
GO:0004359
GO:0005737
GO:0009435
AF-A0A497IJU7-F1-model_v4 NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) 0.9843 404 563 GO:0003952
GO:0004359
GO:0005524
GO:0005737
GO:0008795
GO:0009435

Feature Viewer

pLDDT pTM Quality
90.45 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map