F471963
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 643 | 356 | 605 | 243 |
Family's Representative Sequence
| Representative Sequence | 3300031731|Ga0307405_10168115|Ga0307405_101681152 |
| Length | 273 |
| Sequence | LRPGRIFLYVTYTDPFTYERMSITGNGVIVGKLDGKVAVITGGSTGLALAGAKLFVDEGAYVFIQARRQEALDDAVKLIGRNVTAVQGDAAELDDLDRLFDTVKREKGSIDVLWASAGMGEPAVLGEITEEQFHRAFSLNARGTLFTVQKALPLINDNGSILMTGSNASLGAFPGWSLYAGSKAVQQAWARVWLNELRDRRIRVNVLTPGQVATAKQQELFDEATRSAFESLIPRGEMGRPEEIASIALFLASDDSSYVNGLELVADGGTTAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 2 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 3 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 4 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 5 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 6 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 7 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 8 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 9 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 10 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 11 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 12 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 13 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 14 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 15 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 16 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 17 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 18 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 19 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 20 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 21 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 22 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 23 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 24 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 25 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 26 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 27 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 28 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 29 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 30 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 31 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 32 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 33 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 34 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 35 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 36 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 37 | 3300003611 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 38 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 39 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 76 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 148 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 149 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 150 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 151 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 153 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 154 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 155 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 157 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 158 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 159 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 160 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 161 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 162 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 163 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 164 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 165 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 168 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 169 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 170 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 171 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 172 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 174 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 176 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 178 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 179 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 180 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 183 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 184 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 185 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 186 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 259 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 260 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 261 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 262 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 263 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 264 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 267 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 268 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 269 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 270 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 271 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 272 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 273 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 274 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 275 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 276 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 277 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 278 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 279 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 280 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 281 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 307 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 308 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 309 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 310 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 311 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 313 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 315 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 317 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 318 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 319 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 320 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 321 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 322 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 323 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 324 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 325 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 326 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 327 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 328 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 329 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 330 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 331 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 332 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 333 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 334 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 335 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 336 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 337 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 338 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 339 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 340 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 341 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 342 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 343 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 344 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 345 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 346 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 347 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 350 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 351 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 352 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 353 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 354 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 355 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 356 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.16 |
| Metatranscriptomes | 1.09 |
| Isolates | 5.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.95 |
| Nodule | 1.71 |
| Rhizoplane | 6.22 |
| Rhizosphere | 69.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10002752 | 3300001989 | Bacteria | 6762 |
| 2 | JGI24737J22298_10027289 | 3300001990 | Bacteria | 1801 |
| 3 | JGI24751J29686_10015835 | 3300002459 | Bacteria | 1555 |
| 4 | JGI25151J46595_10098038 | 3300003187 | Unclassified | 797 |
| 5 | rootH1_10079142 | 3300003316 | Bacteria | 7746 |
| 6 | rootH2_10230140 | 3300003320 | Unclassified | 2291 |
| 7 | rootH2_10267319 | 3300003320 | Bacteria | 1517 |
| 8 | rootH1_10071420 | 3300003323 | Bacteria | 3528 |
| 9 | rootH1_10165931 | 3300003323 | Unclassified | 3845 |
| 10 | rootH1_10286776 | 3300003323 | Bacteria | 3651 |
| 11 | Ga0007416J51690_1009241 | 3300003577 | Bacteria | 813 |
| 12 | Ga0007411J51799_106219 | 3300003611 | Bacteria | 825 |
| 13 | Ga0055542_1000439 | 3300003762 | Bacteria | 39835 |
| 14 | Ga0065714_10030916 | 3300005288 | Bacteria | 1356 |
| 15 | Ga0070683_100326623 | 3300005329 | Bacteria | 1460 |
| 16 | Ga0070666_10010743 | 3300005335 | Bacteria | 5729 |
| 17 | Ga0070671_100000949 | 3300005355 | Bacteria | 21211 |
| 18 | Ga0070674_100409687 | 3300005356 | Bacteria | 1110 |
| 19 | Ga0070667_100000308 | 3300005367 | Bacteria | 54638 |
| 20 | Ga0070714_100019981 | 3300005435 | Bacteria | 5465 |
| 21 | Ga0070714_100054094 | 3300005435 | Bacteria | 3429 |
| 22 | Ga0070714_100063694 | 3300005435 | Bacteria | 3171 |
| 23 | Ga0070714_100339925 | 3300005435 | Bacteria | 1408 |
| 24 | Ga0070714_100497129 | 3300005435 | Bacteria | 1163 |
| 25 | Ga0070713_100128517 | 3300005436 | Bacteria | 2232 |
| 26 | Ga0070713_100576844 | 3300005436 | Bacteria | 1067 |
| 27 | Ga0070710_10288389 | 3300005437 | Bacteria | 1067 |
| 28 | Ga0070711_100111142 | 3300005439 | Bacteria | 2012 |
| 29 | Ga0070700_100328262 | 3300005441 | Bacteria | 1127 |
| 30 | Ga0070663_100118299 | 3300005455 | Bacteria | 1999 |
| 31 | Ga0070663_100189552 | 3300005455 | Bacteria | 1599 |
| 32 | Ga0070678_100516959 | 3300005456 | Bacteria | 1056 |
| 33 | Ga0070679_100005317 | 3300005530 | Bacteria | 11917 |
| 34 | Ga0070679_100136007 | 3300005530 | Bacteria | 2439 |
| 35 | Ga0070679_100554525 | 3300005530 | Bacteria | 1093 |
| 36 | Ga0070665_100108097 | 3300005548 | Bacteria | 2784 |
| 37 | Ga0070665_100179527 | 3300005548 | Bacteria | 2118 |
| 38 | Ga0068855_100042178 | 3300005563 | Bacteria | 5406 |
| 39 | Ga0068855_100669726 | 3300005563 | Bacteria | 1113 |
| 40 | Ga0070664_100136957 | 3300005564 | Bacteria | 2153 |
| 41 | Ga0068856_100525393 | 3300005614 | Bacteria | 1205 |
| 42 | Ga0068852_100050125 | 3300005616 | Bacteria | 3575 |
| 43 | Ga0068852_100101469 | 3300005616 | Bacteria | 2598 |
| 44 | Ga0068859_100006027 | 3300005617 | Bacteria | 12313 |
| 45 | Ga0068864_100320816 | 3300005618 | Bacteria | 1455 |
| 46 | Ga0068858_100002726 | 3300005842 | Bacteria | 17777 |
| 47 | Ga0068860_100000155 | 3300005843 | Bacteria | 111737 |
| 48 | Ga0068862_100000096 | 3300005844 | Bacteria | 104906 |
| 49 | Ga0081540_1022853 | 3300005983 | Bacteria | 3680 |
| 50 | Ga0070717_10136297 | 3300006028 | Unclassified | 2114 |
| 51 | Ga0075365_10012747 | 3300006038 | Bacteria | 5004 |
| 52 | Ga0075365_10032306 | 3300006038 | Bacteria | 3363 |
| 53 | Ga0075363_100058089 | 3300006048 | Bacteria | 2077 |
| 54 | Ga0075364_10037286 | 3300006051 | Bacteria | 3147 |
| 55 | Ga0070716_100035357 | 3300006173 | Bacteria | 2746 |
| 56 | Ga0070712_100033901 | 3300006175 | Bacteria | 3457 |
| 57 | Ga0070712_100178141 | 3300006175 | Bacteria | 1654 |
| 58 | Ga0075362_10013512 | 3300006177 | Bacteria | 3270 |
| 59 | Ga0075369_10089581 | 3300006186 | Bacteria | 1372 |
| 60 | Ga0075370_10014473 | 3300006353 | Bacteria | 4209 |
| 61 | Ga0075434_100918859 | 3300006871 | Bacteria | 890 |
| 62 | Ga0097620_100006027 | 3300006931 | Bacteria | 12313 |
| 63 | Ga0099826_10268791 | 3300006948 | Bacteria | 888 |
| 64 | Ga0099795_10010741 | 3300007788 | Bacteria | 2709 |
| 65 | Ga0099795_10094914 | 3300007788 | Bacteria | 1161 |
| 66 | Ga0105240_10201565 | 3300009093 | Bacteria | 2331 |
| 67 | Ga0105240_10743114 | 3300009093 | Bacteria | 1067 |
| 68 | Ga0105240_10780583 | 3300009093 | Bacteria | 1036 |
| 69 | Ga0105245_10590819 | 3300009098 | Bacteria | 1136 |
| 70 | Ga0105247_10000040 | 3300009101 | Bacteria | 158975 |
| 71 | Ga0105241_10313280 | 3300009174 | Bacteria | 1351 |
| 72 | Ga0105241_10406454 | 3300009174 | Bacteria | 1195 |
| 73 | Ga0105248_10000095 | 3300009177 | Bacteria | 98093 |
| 74 | Ga0105248_10137550 | 3300009177 | Bacteria | 2756 |
| 75 | Ga0105248_10963290 | 3300009177 | Bacteria | 964 |
| 76 | Ga0105237_10148880 | 3300009545 | Bacteria | 2336 |
| 77 | Ga0105237_10232907 | 3300009545 | Bacteria | 1843 |
| 78 | Ga0105237_10728712 | 3300009545 | Bacteria | 998 |
| 79 | Ga0105238_10151181 | 3300009551 | Bacteria | 2297 |
| 80 | Ga0105238_10152586 | 3300009551 | Bacteria | 2285 |
| 81 | Ga0105238_10283619 | 3300009551 | Bacteria | 1638 |
| 82 | Ga0105238_10714340 | 3300009551 | Bacteria | 1015 |
| 83 | Ga0105249_10000069 | 3300009553 | Bacteria | 148118 |
| 84 | Ga0099796_10066653 | 3300010159 | Bacteria | 1290 |
| 85 | Ga0105239_10181186 | 3300010375 | Bacteria | 2357 |
| 86 | Ga0105239_10363307 | 3300010375 | Bacteria | 1635 |
| 87 | Ga0105239_10578964 | 3300010375 | Bacteria | 1280 |
| 88 | Ga0105246_10033294 | 3300011119 | Bacteria | 3424 |
| 89 | Ga0157342_1014844 | 3300012507 | Bacteria | 847 |
| 90 | Ga0157370_10000317 | 3300013104 | Bacteria | 60594 |
| 91 | Ga0157370_10026255 | 3300013104 | Bacteria | 5754 |
| 92 | Ga0157370_10157873 | 3300013104 | Bacteria | 2110 |
| 93 | Ga0157369_10407593 | 3300013105 | Bacteria | 1410 |
| 94 | Ga0157369_10409534 | 3300013105 | Bacteria | 1406 |
| 95 | Ga0157374_10278718 | 3300013296 | Bacteria | 1650 |
| 96 | Ga0163162_10105490 | 3300013306 | Bacteria | 2913 |
| 97 | Ga0163162_10170835 | 3300013306 | Bacteria | 2299 |
| 98 | Ga0163162_10181355 | 3300013306 | Bacteria | 2232 |
| 99 | Ga0157375_10077352 | 3300013308 | Bacteria | 3357 |
| 100 | Ga0157375_10240458 | 3300013308 | Bacteria | 1970 |
| 101 | Ga0163163_10014016 | 3300014325 | Bacteria | 7355 |
| 102 | Ga0163163_10580939 | 3300014325 | Bacteria | 1184 |
| 103 | Ga0157380_10835954 | 3300014326 | Bacteria | 941 |
| 104 | Ga0157379_10025856 | 3300014968 | Bacteria | 5219 |
| 105 | Ga0182005_1000004 | 3300015265 | Bacteria | 609645 |
| 106 | Ga0206356_11243581 | 3300020070 | Bacteria | 861 |
| 107 | Ga0206353_11300916 | 3300020082 | Bacteria | 818 |
| 108 | Ga0224712_10193976 | 3300022467 | Bacteria | 921 |
| 109 | Ga0209233_1008225 | 3300025261 | Bacteria | 3241 |
| 110 | Ga0209025_1001389 | 3300025294 | Bacteria | 32297 |
| 111 | Ga0207655_1032430 | 3300025728 | Bacteria | 2387 |
| 112 | Ga0207692_10050411 | 3300025898 | Bacteria | 2105 |
| 113 | Ga0207642_10320638 | 3300025899 | Bacteria | 905 |
| 114 | Ga0207710_10000050 | 3300025900 | Bacteria | 186453 |
| 115 | Ga0207688_10136566 | 3300025901 | Bacteria | 1440 |
| 116 | Ga0207647_10025551 | 3300025904 | Bacteria | 3878 |
| 117 | Ga0207647_10033454 | 3300025904 | Bacteria | 3292 |
| 118 | Ga0207647_10124806 | 3300025904 | Bacteria | 1516 |
| 119 | Ga0207699_10059943 | 3300025906 | Bacteria | 2283 |
| 120 | Ga0207699_10499563 | 3300025906 | Bacteria | 878 |
| 121 | Ga0207645_10113300 | 3300025907 | Bacteria | 1757 |
| 122 | Ga0207705_10338020 | 3300025909 | Bacteria | 1159 |
| 123 | Ga0207654_10002481 | 3300025911 | Bacteria | 9375 |
| 124 | Ga0207707_10123483 | 3300025912 | Bacteria | 2264 |
| 125 | Ga0207695_10014892 | 3300025913 | Bacteria | 9179 |
| 126 | Ga0207671_10001125 | 3300025914 | Bacteria | 32185 |
| 127 | Ga0207671_10122616 | 3300025914 | Bacteria | 1987 |
| 128 | Ga0207671_10265473 | 3300025914 | Bacteria | 1351 |
| 129 | Ga0207671_10594749 | 3300025914 | Bacteria | 882 |
| 130 | Ga0207693_10043227 | 3300025915 | Bacteria | 3546 |
| 131 | Ga0207693_10295167 | 3300025915 | Bacteria | 1270 |
| 132 | Ga0207693_10533809 | 3300025915 | Bacteria | 915 |
| 133 | Ga0207663_10077835 | 3300025916 | Bacteria | 2160 |
| 134 | Ga0207663_10081704 | 3300025916 | Bacteria | 2117 |
| 135 | Ga0207660_10580727 | 3300025917 | Bacteria | 912 |
| 136 | Ga0207657_10606321 | 3300025919 | Bacteria | 854 |
| 137 | Ga0207652_10067625 | 3300025921 | Bacteria | 3098 |
| 138 | Ga0207652_10512592 | 3300025921 | Bacteria | 1079 |
| 139 | Ga0207681_10002841 | 3300025923 | Bacteria | 10957 |
| 140 | Ga0207694_10101413 | 3300025924 | Bacteria | 2281 |
| 141 | Ga0207694_10288478 | 3300025924 | Bacteria | 1349 |
| 142 | Ga0207650_10091927 | 3300025925 | Bacteria | 2320 |
| 143 | Ga0207687_10069301 | 3300025927 | Bacteria | 2515 |
| 144 | Ga0207687_10120347 | 3300025927 | Bacteria | 1962 |
| 145 | Ga0207700_10280462 | 3300025928 | Bacteria | 1433 |
| 146 | Ga0207664_10002394 | 3300025929 | Bacteria | 12407 |
| 147 | Ga0207664_10022536 | 3300025929 | Bacteria | 4706 |
| 148 | Ga0207664_10108015 | 3300025929 | Bacteria | 2310 |
| 149 | Ga0207664_10190169 | 3300025929 | Bacteria | 1767 |
| 150 | Ga0207664_10321894 | 3300025929 | Bacteria | 1365 |
| 151 | Ga0207644_10089307 | 3300025931 | Bacteria | 2293 |
| 152 | Ga0207709_10560423 | 3300025935 | Bacteria | 900 |
| 153 | Ga0207665_10051276 | 3300025939 | Bacteria | 2776 |
| 154 | Ga0207691_10080042 | 3300025940 | Bacteria | 2940 |
| 155 | Ga0207691_10107009 | 3300025940 | Bacteria | 2490 |
| 156 | Ga0207711_10000082 | 3300025941 | Bacteria | 102386 |
| 157 | Ga0207689_10218716 | 3300025942 | Bacteria | 1574 |
| 158 | Ga0207661_10477584 | 3300025944 | Bacteria | 1138 |
| 159 | Ga0207679_10144966 | 3300025945 | Bacteria | 1925 |
| 160 | Ga0207679_10608861 | 3300025945 | Bacteria | 985 |
| 161 | Ga0207712_10000084 | 3300025961 | Bacteria | 107789 |
| 162 | Ga0207640_10111051 | 3300025981 | Bacteria | 1943 |
| 163 | Ga0207658_10000868 | 3300025986 | Bacteria | 25220 |
| 164 | Ga0207703_11038697 | 3300026035 | Bacteria | 787 |
| 165 | Ga0207678_10018048 | 3300026067 | Bacteria | 6199 |
| 166 | Ga0207678_10195735 | 3300026067 | Bacteria | 1728 |
| 167 | Ga0207678_10413101 | 3300026067 | Bacteria | 1170 |
| 168 | Ga0207676_10513251 | 3300026095 | Bacteria | 1140 |
| 169 | Ga0207674_10405816 | 3300026116 | Bacteria | 1317 |
| 170 | Ga0207683_10121955 | 3300026121 | Bacteria | 2341 |
| 171 | Ga0207698_10073403 | 3300026142 | Bacteria | 2724 |
| 172 | Ga0268266_10059382 | 3300028379 | Bacteria | 3295 |
| 173 | Ga0268266_10464642 | 3300028379 | Bacteria | 1204 |
| 174 | Ga0268265_10000106 | 3300028380 | Bacteria | 104924 |
| 175 | Ga0268264_10000219 | 3300028381 | Bacteria | 111751 |
| 176 | Ga0268264_10700813 | 3300028381 | Bacteria | 1006 |
| 177 | Ga0265319_1017014 | 3300028563 | Bacteria | 2776 |
| 178 | Ga0265336_10005155 | 3300028666 | Bacteria | 4856 |
| 179 | Ga0265336_10045147 | 3300028666 | Bacteria | 1340 |
| 180 | Ga0265336_10049927 | 3300028666 | Bacteria | 1266 |
| 181 | Ga0307517_10044770 | 3300028786 | Bacteria | 4670 |
| 182 | Ga0307517_10113193 | 3300028786 | Bacteria | 2049 |
| 183 | Ga0307515_10000846 | 3300028794 | Bacteria | 70343 |
| 184 | Ga0307515_10049581 | 3300028794 | Bacteria | 6311 |
| 185 | Ga0307515_10061669 | 3300028794 | Bacteria | 5313 |
| 186 | Ga0265338_10003900 | 3300028800 | Bacteria | 20610 |
| 187 | Ga0265338_10017188 | 3300028800 | Bacteria | 7813 |
| 188 | Ga0265338_10021357 | 3300028800 | Bacteria | 6755 |
| 189 | Ga0265338_10042925 | 3300028800 | Bacteria | 4203 |
| 190 | Ga0265338_10107746 | 3300028800 | Bacteria | 2252 |
| 191 | Ga0307511_10003090 | 3300030521 | Bacteria | 17155 |
| 192 | Ga0307511_10141165 | 3300030521 | Bacteria | 1415 |
| 193 | Ga0307512_10004311 | 3300030522 | Bacteria | 15692 |
| 194 | Ga0307512_10007896 | 3300030522 | Bacteria | 10457 |
| 195 | Ga0265760_10076694 | 3300031090 | Bacteria | 1031 |
| 196 | Ga0265330_10027609 | 3300031235 | Bacteria | 2564 |
| 197 | Ga0307513_10001603 | 3300031456 | Bacteria | 32478 |
| 198 | Ga0307513_10069471 | 3300031456 | Bacteria | 3686 |
| 199 | Ga0307513_10331367 | 3300031456 | Bacteria | 1276 |
| 200 | Ga0307509_10013229 | 3300031507 | Bacteria | 9791 |
| 201 | Ga0307509_10023765 | 3300031507 | Bacteria | 6872 |
| 202 | Ga0307509_10093453 | 3300031507 | Bacteria | 3069 |
| 203 | Ga0307508_10001782 | 3300031616 | Bacteria | 23942 |
| 204 | Ga0307508_10009013 | 3300031616 | Bacteria | 9193 |
| 205 | Ga0307508_10139501 | 3300031616 | Bacteria | 2028 |
| 206 | Ga0307508_10156550 | 3300031616 | Bacteria | 1882 |
| 207 | Ga0307508_10352832 | 3300031616 | Bacteria | 1062 |
| 208 | Ga0307514_10023311 | 3300031649 | Bacteria | 5022 |
| 209 | Ga0307516_10051225 | 3300031730 | Bacteria | 4047 |
| 210 | Ga0307405_10168115 | 3300031731 | Bacteria | 1561 |
| 211 | Ga0307507_10001954 | 3300033179 | Bacteria | 44758 |
| 212 | Ga0307507_10027336 | 3300033179 | Bacteria | 6119 |
| 213 | Ga0307507_10036156 | 3300033179 | Bacteria | 5055 |
| 214 | Ga0307507_10053550 | 3300033179 | Bacteria | 3854 |
| 215 | Ga0307510_10004939 | 3300033180 | Bacteria | 15782 |
| 216 | Ga0307510_10049355 | 3300033180 | Bacteria | 4477 |
| 217 | Ga0307510_10152891 | 3300033180 | Bacteria | 1922 |
| 218 | Ga0373934_0096245 | 3300035086 | Bacteria | 1195 |
| 219 | Ga0373951_0000086 | 3300035091 | Bacteria | 36308 |
| 220 | Ga0373923_0201848 | 3300035111 | Bacteria | 919 |
| 221 | Ga0373936_0005116 | 3300035113 | Bacteria | 4936 |
| 222 | Ga0373954_0017921 | 3300035118 | Bacteria | 3185 |
| 223 | Ga0373957_0085805 | 3300035120 | Bacteria | 1246 |
| 224 | Ga0373924_0043622 | 3300035410 | Bacteria | 1842 |
| 225 | Ga0373931_0083630 | 3300035691 | Bacteria | 1766 |
| 226 | Ga0373935_0539601 | 3300035692 | Bacteria | 849 |
| 227 | Ga0373947_0472048 | 3300035725 | Bacteria | 851 |
| 228 | Ga0373937_0814442 | 3300036401 | Bacteria | 882 |
| 229 | Ga0372808_005661 | 3300036459 | Bacteria | 1656 |
| 230 | Ga0373925_0000101 | 3300037068 | Bacteria | 92997 |
| 231 | Ga0373925_0016708 | 3300037068 | Bacteria | 5314 |
| 232 | Ga0373925_0026933 | 3300037068 | Bacteria | 4208 |
| 233 | Ga0373925_0320429 | 3300037068 | Bacteria | 1254 |
| 234 | Ga0395900_0308999 | 3300037418 | Bacteria | 1565 |
| 235 | Ga0395905_0556059 | 3300037471 | Bacteria | 1049 |
| 236 | Ga0436361_0991054 | 3300039447 | Bacteria | 1543 |
| 237 | Ga0451793_0467648 | 3300041452 | Bacteria | 850 |
| 238 | Ga0451807_1482729 | 3300041486 | Bacteria | 855 |
| 239 | Ga0451843_0099427 | 3300041509 | Bacteria | 1008 |
| 240 | Ga0451853_0325620 | 3300041512 | Bacteria | 7501 |
| 241 | Ga0466968_0070735 | 3300044735 | Bacteria | 1519 |
| 242 | Ga0466960_0220887 | 3300044901 | Bacteria | 1043 |
| 243 | Ga0495617_060796 | 3300046452 | Bacteria | 1250 |
| 244 | Ga0495627_012618 | 3300046453 | Bacteria | 2993 |
| 245 | Ga0495592_0009428 | 3300046454 | Bacteria | 7339 |
| 246 | Ga0495592_0078488 | 3300046454 | Bacteria | 2391 |
| 247 | Ga0495592_0204218 | 3300046454 | Bacteria | 1331 |
| 248 | Ga0495603_0012178 | 3300046455 | Bacteria | 5208 |
| 249 | Ga0495603_0018918 | 3300046455 | Bacteria | 4168 |
| 250 | Ga0495603_0030542 | 3300046455 | Bacteria | 3244 |
| 251 | Ga0495629_0011173 | 3300046459 | Bacteria | 6519 |
| 252 | Ga0495629_0018578 | 3300046459 | Bacteria | 4972 |
| 253 | Ga0495629_0038123 | 3300046459 | Bacteria | 3386 |
| 254 | Ga0495629_0199901 | 3300046459 | Bacteria | 1382 |
| 255 | Ga0495638_0023029 | 3300046460 | Bacteria | 4080 |
| 256 | Ga0495638_0090222 | 3300046460 | Bacteria | 1848 |
| 257 | Ga0495638_0122447 | 3300046460 | Bacteria | 1535 |
| 258 | Ga0495651_0001042 | 3300046462 | Bacteria | 21445 |
| 259 | Ga0495651_0161204 | 3300046462 | Bacteria | 1606 |
| 260 | Ga0495651_0305234 | 3300046462 | Bacteria | 1066 |
| 261 | Ga0495580_0234560 | 3300046472 | Bacteria | 1259 |
| 262 | Ga0495605_0052376 | 3300046474 | Bacteria | 1983 |
| 263 | Ga0495639_0239535 | 3300046475 | Bacteria | 895 |
| 264 | Ga0495662_0009485 | 3300046476 | Bacteria | 4775 |
| 265 | Ga0495662_0082663 | 3300046476 | Bacteria | 1563 |
| 266 | Ga0495664_0000287 | 3300046477 | Bacteria | 24123 |
| 267 | Ga0495664_0015673 | 3300046477 | Bacteria | 4311 |
| 268 | Ga0495664_0294054 | 3300046477 | Bacteria | 981 |
| 269 | Ga0495584_0061044 | 3300046491 | Bacteria | 1895 |
| 270 | Ga0495594_0018231 | 3300046499 | Bacteria | 3716 |
| 271 | Ga0495594_0058148 | 3300046499 | Bacteria | 2135 |
| 272 | Ga0495594_0249448 | 3300046499 | Bacteria | 1011 |
| 273 | Ga0495596_0034238 | 3300046500 | Bacteria | 2018 |
| 274 | Ga0495607_0000003 | 3300046501 | Bacteria | 366900 |
| 275 | Ga0495607_0006428 | 3300046501 | Bacteria | 8275 |
| 276 | Ga0495583_0052521 | 3300046506 | Bacteria | 1853 |
| 277 | Ga0495606_0013143 | 3300046507 | Bacteria | 6571 |
| 278 | Ga0495606_0158149 | 3300046507 | Bacteria | 1324 |
| 279 | Ga0495610_0003962 | 3300046512 | Bacteria | 11204 |
| 280 | Ga0495610_0048209 | 3300046512 | Bacteria | 2092 |
| 281 | Ga0495620_0010680 | 3300046515 | Bacteria | 4833 |
| 282 | Ga0495620_0042467 | 3300046515 | Bacteria | 1986 |
| 283 | Ga0495628_0078892 | 3300046516 | Bacteria | 2560 |
| 284 | Ga0495628_0083641 | 3300046516 | Bacteria | 2477 |
| 285 | Ga0495628_0118907 | 3300046516 | Bacteria | 2028 |
| 286 | Ga0495631_0013587 | 3300046518 | Bacteria | 3948 |
| 287 | Ga0495632_0000011 | 3300046519 | Bacteria | 266804 |
| 288 | Ga0495632_0045284 | 3300046519 | Bacteria | 2192 |
| 289 | Ga0495637_0142884 | 3300046520 | Bacteria | 907 |
| 290 | Ga0495643_0064488 | 3300046522 | Bacteria | 1935 |
| 291 | Ga0495644_0084886 | 3300046523 | Bacteria | 1194 |
| 292 | Ga0495648_0015660 | 3300046524 | Bacteria | 5492 |
| 293 | Ga0495648_0021550 | 3300046524 | Bacteria | 4459 |
| 294 | Ga0495666_0007678 | 3300046526 | Bacteria | 5396 |
| 295 | Ga0495666_0011577 | 3300046526 | Bacteria | 4397 |
| 296 | Ga0495652_0008645 | 3300046529 | Bacteria | 9279 |
| 297 | Ga0495652_0162927 | 3300046529 | Bacteria | 1729 |
| 298 | Ga0495665_0007483 | 3300046531 | Bacteria | 5909 |
| 299 | Ga0495640_0039687 | 3300046533 | Bacteria | 3301 |
| 300 | Ga0495640_0085391 | 3300046533 | Bacteria | 2092 |
| 301 | Ga0495640_0133563 | 3300046533 | Bacteria | 1604 |
| 302 | Ga0495586_0108428 | 3300046535 | Bacteria | 1544 |
| 303 | Ga0495587_0002208 | 3300046536 | Bacteria | 13009 |
| 304 | Ga0495597_0082090 | 3300046542 | Bacteria | 1377 |
| 305 | Ga0495645_0017306 | 3300046543 | Bacteria | 5162 |
| 306 | Ga0495622_0005125 | 3300046557 | Bacteria | 6071 |
| 307 | Ga0495667_0082116 | 3300046559 | Bacteria | 2094 |
| 308 | Ga0495656_0083826 | 3300046615 | Bacteria | 1444 |
| 309 | Ga0495668_0086279 | 3300046616 | Bacteria | 1721 |
| 310 | Ga0495668_0139747 | 3300046616 | Bacteria | 1325 |
| 311 | Ga0495668_0224633 | 3300046616 | Bacteria | 1028 |
| 312 | Ga0495634_0002799 | 3300046642 | Bacteria | 14330 |
| 313 | Ga0495634_0015769 | 3300046642 | Bacteria | 5417 |
| 314 | Ga0495634_0352747 | 3300046642 | Bacteria | 881 |
| 315 | Ga0495611_0243369 | 3300046648 | Bacteria | 835 |
| 316 | Ga0495625_0070173 | 3300046660 | Bacteria | 2460 |
| 317 | Ga0495625_0131059 | 3300046660 | Bacteria | 1698 |
| 318 | Ga0495635_0018136 | 3300046663 | Bacteria | 4914 |
| 319 | Ga0495635_0027949 | 3300046663 | Bacteria | 3922 |
| 320 | Ga0495635_0028962 | 3300046663 | Bacteria | 3850 |
| 321 | Ga0495659_0128384 | 3300046664 | Bacteria | 1004 |
| 322 | Ga0495657_0003480 | 3300046675 | Bacteria | 12840 |
| 323 | Ga0495657_0149755 | 3300046675 | Bacteria | 1449 |
| 324 | Ga0495599_0052346 | 3300046678 | Bacteria | 2557 |
| 325 | Ga0495599_0151737 | 3300046678 | Bacteria | 1434 |
| 326 | Ga0495646_0020602 | 3300046680 | Bacteria | 4172 |
| 327 | Ga0495613_0000388 | 3300046689 | Bacteria | 37773 |
| 328 | Ga0495613_0004110 | 3300046689 | Bacteria | 10885 |
| 329 | Ga0495671_0007655 | 3300046692 | Bacteria | 6133 |
| 330 | Ga0495649_0036301 | 3300046694 | Bacteria | 2707 |
| 331 | Ga0495649_0068614 | 3300046694 | Bacteria | 1902 |
| 332 | Ga0495649_0070671 | 3300046694 | Bacteria | 1871 |
| 333 | Ga0495589_0015740 | 3300046794 | Bacteria | 3888 |
| 334 | Ga0495589_0059236 | 3300046794 | Bacteria | 1882 |
| 335 | Ga0495600_0010883 | 3300046809 | Bacteria | 5658 |
| 336 | Ga0495600_0011870 | 3300046809 | Bacteria | 5439 |
| 337 | Ga0495660_0004309 | 3300046810 | Bacteria | 8627 |
| 338 | Ga0495660_0142233 | 3300046810 | Bacteria | 1192 |
| 339 | Ga0495581_0069558 | 3300047315 | Bacteria | 2035 |
| 340 | Ga0495604_0000545 | 3300047317 | Bacteria | 33154 |
| 341 | Ga0495604_0005331 | 3300047317 | Bacteria | 10194 |
| 342 | Ga0495604_0180506 | 3300047317 | Bacteria | 1477 |
| 343 | Ga0495604_0244205 | 3300047317 | Bacteria | 1226 |
| 344 | Ga0495636_0064025 | 3300047318 | Bacteria | 1559 |
| 345 | Ga0495674_0079786 | 3300047319 | Bacteria | 2809 |
| 346 | Ga0495672_0003747 | 3300047320 | Bacteria | 12818 |
| 347 | Ga0495676_0000488 | 3300047321 | Bacteria | 32524 |
| 348 | Ga0495676_0000537 | 3300047321 | Bacteria | 31037 |
| 349 | Ga0495676_0051310 | 3300047321 | Bacteria | 3301 |
| 350 | Ga0495676_0105662 | 3300047321 | Bacteria | 2075 |
| 351 | Ga0495683_0002011 | 3300047323 | Bacteria | 12617 |
| 352 | Ga0495683_0092272 | 3300047323 | Bacteria | 1465 |
| 353 | Ga0495687_002019 | 3300047443 | Bacteria | 17185 |
| 354 | Ga0495687_015680 | 3300047443 | Bacteria | 3843 |
| 355 | Ga0495687_017402 | 3300047443 | Bacteria | 3588 |
| 356 | Ga0495687_047628 | 3300047443 | Bacteria | 1843 |
| 357 | Ga0495675_0044013 | 3300047444 | Bacteria | 2843 |
| 358 | Ga0495677_0018742 | 3300047445 | Bacteria | 2509 |
| 359 | Ga0495685_004037 | 3300047447 | Bacteria | 4720 |
| 360 | Ga0495685_006708 | 3300047447 | Bacteria | 3778 |
| 361 | Ga0495685_043554 | 3300047447 | Bacteria | 1531 |
| 362 | Ga0495673_0011418 | 3300047469 | Bacteria | 4775 |
| 363 | Ga0495681_0002530 | 3300047470 | Bacteria | 13023 |
| 364 | Ga0495681_0016827 | 3300047470 | Bacteria | 4080 |
| 365 | Ga0495686_0063234 | 3300047472 | Bacteria | 2294 |
| 366 | Ga0495686_0129789 | 3300047472 | Bacteria | 1495 |
| 367 | Ga0495593_0000258 | 3300047673 | Bacteria | 28592 |
| 368 | Ga0495602_0075504 | 3300048088 | Bacteria | 2860 |
| 369 | Ga0495614_0002843 | 3300048089 | Bacteria | 7703 |
| 370 | Ga0495614_0005593 | 3300048089 | Bacteria | 5666 |
| 371 | Ga0495614_0100204 | 3300048089 | Bacteria | 1265 |
| 372 | Ga0496100_0348756 | 3300048903 | Bacteria | 1117 |
| 373 | Ga0496101_0000130 | 3300048904 | Bacteria | 70026 |
| 374 | Ga0496101_0091574 | 3300048904 | Bacteria | 2263 |
| 375 | Ga0496102_0000014 | 3300048905 | Bacteria | 310241 |
| 376 | Ga0496102_0000716 | 3300048905 | Bacteria | 32822 |
| 377 | Ga0496102_0027571 | 3300048905 | Bacteria | 5072 |
| 378 | Ga0496102_0284295 | 3300048905 | Bacteria | 1559 |
| 379 | Ga0496102_0523791 | 3300048905 | Bacteria | 1108 |
| 380 | Ga0496103_0000004 | 3300048906 | Bacteria | 510080 |
| 381 | Ga0496103_0000767 | 3300048906 | Bacteria | 23698 |
| 382 | Ga0496103_0148920 | 3300048906 | Bacteria | 1499 |
| 383 | Ga0496104_0133734 | 3300048907 | Bacteria | 2382 |
| 384 | Ga0496104_0387593 | 3300048907 | Bacteria | 1310 |
| 385 | Ga0496105_0056792 | 3300048908 | Bacteria | 3231 |
| 386 | Ga0496105_0073852 | 3300048908 | Bacteria | 2817 |
| 387 | Ga0496106_0058828 | 3300048909 | Bacteria | 2910 |
| 388 | Ga0496106_0090731 | 3300048909 | Bacteria | 2358 |
| 389 | Ga0496106_0640388 | 3300048909 | Bacteria | 850 |
| 390 | Ga0496106_0738621 | 3300048909 | Bacteria | 783 |
| 391 | Ga0496107_0019547 | 3300048910 | Bacteria | 4779 |
| 392 | Ga0496107_0066239 | 3300048910 | Bacteria | 2619 |
| 393 | Ga0496107_0088217 | 3300048910 | Bacteria | 2264 |
| 394 | Ga0496108_0024849 | 3300048911 | Bacteria | 4933 |
| 395 | Ga0496108_0140686 | 3300048911 | Bacteria | 2079 |
| 396 | Ga0496109_0092370 | 3300048912 | Bacteria | 2799 |
| 397 | Ga0496109_0345965 | 3300048912 | Bacteria | 1404 |
| 398 | Ga0496109_0372284 | 3300048912 | Bacteria | 1349 |
| 399 | Ga0496109_0377733 | 3300048912 | Bacteria | 1339 |
| 400 | Ga0496110_0162349 | 3300048913 | Bacteria | 2025 |
| 401 | Ga0496111_0006478 | 3300048914 | Bacteria | 7606 |
| 402 | Ga0496111_0176789 | 3300048914 | Bacteria | 1587 |
| 403 | Ga0496111_0246255 | 3300048914 | Bacteria | 1327 |
| 404 | Ga0496112_0005279 | 3300048915 | Bacteria | 11142 |
| 405 | Ga0496112_0121764 | 3300048915 | Bacteria | 2579 |
| 406 | Ga0496112_0158609 | 3300048915 | Bacteria | 2229 |
| 407 | Ga0496114_0119792 | 3300048917 | Bacteria | 2263 |
| 408 | Ga0496115_0010369 | 3300048918 | Bacteria | 6961 |
| 409 | Ga0496116_0000069 | 3300048919 | Bacteria | 252643 |
| 410 | Ga0496116_0069768 | 3300048919 | Bacteria | 2233 |
| 411 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 412 | Ga0496117_0000687 | 3300048920 | Bacteria | 54044 |
| 413 | Ga0496117_0001629 | 3300048920 | Bacteria | 31716 |
| 414 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 415 | Ga0496118_0001732 | 3300048921 | Bacteria | 31716 |
| 416 | Ga0496118_0003018 | 3300048921 | Bacteria | 21736 |
| 417 | Ga0496119_0000588 | 3300048922 | Bacteria | 49189 |
| 418 | Ga0496119_0031696 | 3300048922 | Bacteria | 3537 |
| 419 | Ga0496119_0038081 | 3300048922 | Bacteria | 3113 |
| 420 | Ga0496120_0000085 | 3300048923 | Bacteria | 155343 |
| 421 | Ga0496120_0014771 | 3300048923 | Bacteria | 5183 |
| 422 | Ga0496121_0000032 | 3300048924 | Bacteria | 378997 |
| 423 | Ga0496121_0006420 | 3300048924 | Bacteria | 14611 |
| 424 | Ga0496121_0058734 | 3300048924 | Bacteria | 3177 |
| 425 | Ga0496121_0120791 | 3300048924 | Bacteria | 1979 |
| 426 | Ga0496122_0000495 | 3300048925 | Bacteria | 81902 |
| 427 | Ga0496124_0001784 | 3300048927 | Bacteria | 29937 |
| 428 | Ga0496124_0096079 | 3300048927 | Bacteria | 2407 |
| 429 | Ga0496125_0090825 | 3300048928 | Bacteria | 2290 |
| 430 | Ga0496126_0000006 | 3300048929 | Bacteria | 798804 |
| 431 | Ga0496126_0000007 | 3300048929 | Bacteria | 787364 |
| 432 | Ga0496126_0000067 | 3300048929 | Bacteria | 249091 |
| 433 | Ga0496126_0044285 | 3300048929 | Bacteria | 4099 |
| 434 | Ga0496126_0143568 | 3300048929 | Bacteria | 2052 |
| 435 | Ga0496126_0243130 | 3300048929 | Bacteria | 1503 |
| 436 | Ga0496126_0268072 | 3300048929 | Bacteria | 1418 |
| 437 | Ga0495678_070981 | 3300049459 | Bacteria | 1277 |
| 438 | Ga0495678_083088 | 3300049459 | Bacteria | 1145 |
| 439 | Ga0501031_0001335 | 3300049568 | Bacteria | 15192 |
| 440 | Ga0501031_0017651 | 3300049568 | Bacteria | 4640 |
| 441 | Ga0501031_0018173 | 3300049568 | Bacteria | 4575 |
| 442 | Ga0501031_0025900 | 3300049568 | Bacteria | 3826 |
| 443 | Ga0501031_0105735 | 3300049568 | Bacteria | 1837 |
| 444 | Ga0501031_0113300 | 3300049568 | Bacteria | 1771 |
| 445 | Ga0501031_0126986 | 3300049568 | Bacteria | 1666 |
| 446 | Ga0501031_0149952 | 3300049568 | Bacteria | 1523 |
| 447 | Ga0501032_0003786 | 3300049569 | Bacteria | 11478 |
| 448 | Ga0501032_0005456 | 3300049569 | Bacteria | 9440 |
| 449 | Ga0501032_0049802 | 3300049569 | Bacteria | 2826 |
| 450 | Ga0501032_0070417 | 3300049569 | Bacteria | 2332 |
| 451 | Ga0501032_0083467 | 3300049569 | Bacteria | 2125 |
| 452 | Ga0501032_0123993 | 3300049569 | Bacteria | 1707 |
| 453 | Ga0501032_0158460 | 3300049569 | Bacteria | 1486 |
| 454 | Ga0501033_0001264 | 3300049570 | Bacteria | 22583 |
| 455 | Ga0501033_0003278 | 3300049570 | Bacteria | 13390 |
| 456 | Ga0501033_0006971 | 3300049570 | Bacteria | 8823 |
| 457 | Ga0501033_0036673 | 3300049570 | Bacteria | 3672 |
| 458 | Ga0501033_0044526 | 3300049570 | Bacteria | 3304 |
| 459 | Ga0501033_0103818 | 3300049570 | Bacteria | 2072 |
| 460 | Ga0501033_0265387 | 3300049570 | Bacteria | 1214 |
| 461 | Ga0501034_0005213 | 3300049571 | Bacteria | 14259 |
| 462 | Ga0501034_0006755 | 3300049571 | Bacteria | 12278 |
| 463 | Ga0501034_0010784 | 3300049571 | Bacteria | 9491 |
| 464 | Ga0501034_0012929 | 3300049571 | Bacteria | 8606 |
| 465 | Ga0501034_0083866 | 3300049571 | Bacteria | 3189 |
| 466 | Ga0501034_0205101 | 3300049571 | Bacteria | 1928 |
| 467 | Ga0501034_0315739 | 3300049571 | Bacteria | 1496 |
| 468 | Ga0501036_0001005 | 3300049572 | Bacteria | 21286 |
| 469 | Ga0501036_0006405 | 3300049572 | Bacteria | 9553 |
| 470 | Ga0501036_0011299 | 3300049572 | Bacteria | 7386 |
| 471 | Ga0501036_0017921 | 3300049572 | Bacteria | 5928 |
| 472 | Ga0501036_0273334 | 3300049572 | Bacteria | 1414 |
| 473 | Ga0501037_0005145 | 3300049573 | Bacteria | 9514 |
| 474 | Ga0501037_0008402 | 3300049573 | Bacteria | 7573 |
| 475 | Ga0501037_0056835 | 3300049573 | Bacteria | 2857 |
| 476 | Ga0501038_0005437 | 3300049574 | Bacteria | 11835 |
| 477 | Ga0501038_0007464 | 3300049574 | Bacteria | 10089 |
| 478 | Ga0501038_0007801 | 3300049574 | Bacteria | 9864 |
| 479 | Ga0501038_0024746 | 3300049574 | Bacteria | 5352 |
| 480 | Ga0501038_0082868 | 3300049574 | Bacteria | 2700 |
| 481 | Ga0501038_0103810 | 3300049574 | Bacteria | 2363 |
| 482 | Ga0501039_0057593 | 3300049575 | Bacteria | 3009 |
| 483 | Ga0501039_0113780 | 3300049575 | Bacteria | 2116 |
| 484 | Ga0501039_0155099 | 3300049575 | Bacteria | 1799 |
| 485 | Ga0501040_0145671 | 3300049576 | Bacteria | 1670 |
| 486 | Ga0501040_0173011 | 3300049576 | Bacteria | 1529 |
| 487 | Ga0501042_0001445 | 3300049578 | Bacteria | 13978 |
| 488 | Ga0501042_0026449 | 3300049578 | Bacteria | 4077 |
| 489 | Ga0501043_0006022 | 3300049579 | Bacteria | 9750 |
| 490 | Ga0501043_0007957 | 3300049579 | Bacteria | 8375 |
| 491 | Ga0501043_0010419 | 3300049579 | Bacteria | 7283 |
| 492 | Ga0501043_0067766 | 3300049579 | Bacteria | 2802 |
| 493 | Ga0501043_0084665 | 3300049579 | Bacteria | 2492 |
| 494 | Ga0501043_0134259 | 3300049579 | Bacteria | 1939 |
| 495 | Ga0501043_0287764 | 3300049579 | Bacteria | 1258 |
| 496 | Ga0501046_0000091 | 3300049580 | Bacteria | 98095 |
| 497 | Ga0501046_0002395 | 3300049580 | Bacteria | 17614 |
| 498 | Ga0501046_0007551 | 3300049580 | Bacteria | 9535 |
| 499 | Ga0501046_0037499 | 3300049580 | Bacteria | 3894 |
| 500 | Ga0501047_0000575 | 3300049581 | Bacteria | 39087 |
| 501 | Ga0501047_0002966 | 3300049581 | Bacteria | 16087 |
| 502 | Ga0501047_0003526 | 3300049581 | Bacteria | 14766 |
| 503 | Ga0501047_0004553 | 3300049581 | Bacteria | 13036 |
| 504 | Ga0501047_0007490 | 3300049581 | Bacteria | 10271 |
| 505 | Ga0501047_0013474 | 3300049581 | Bacteria | 7749 |
| 506 | Ga0501047_0111883 | 3300049581 | Bacteria | 2613 |
| 507 | Ga0501047_0180172 | 3300049581 | Bacteria | 1979 |
| 508 | Ga0501047_0236047 | 3300049581 | Bacteria | 1680 |
| 509 | Ga0501048_0003067 | 3300049582 | Bacteria | 12733 |
| 510 | Ga0501048_0005624 | 3300049582 | Bacteria | 9532 |
| 511 | Ga0501048_0031140 | 3300049582 | Bacteria | 3859 |
| 512 | Ga0501070_0007297 | 3300049586 | Bacteria | 9387 |
| 513 | Ga0501070_0061016 | 3300049586 | Bacteria | 3125 |
| 514 | Ga0501070_0118730 | 3300049586 | Bacteria | 2185 |
| 515 | Ga0501070_0220822 | 3300049586 | Bacteria | 1554 |
| 516 | Ga0501071_0519030 | 3300049587 | Bacteria | 914 |
| 517 | Ga0501073_0005674 | 3300049589 | Bacteria | 9336 |
| 518 | Ga0501073_0029923 | 3300049589 | Bacteria | 3889 |
| 519 | Ga0501073_0035832 | 3300049589 | Bacteria | 3525 |
| 520 | Ga0501073_0176902 | 3300049589 | Bacteria | 1477 |
| 521 | Ga0501074_0033129 | 3300049590 | Bacteria | 3744 |
| 522 | Ga0501074_0073364 | 3300049590 | Bacteria | 2458 |
| 523 | Ga0501074_0172377 | 3300049590 | Bacteria | 1544 |
| 524 | Ga0501079_0059947 | 3300049741 | Bacteria | 2935 |
| 525 | Ga0501079_0237167 | 3300049741 | Bacteria | 1425 |
| 526 | Ga0501080_0082989 | 3300049742 | Bacteria | 2977 |
| 527 | Ga0501080_0184073 | 3300049742 | Bacteria | 1921 |
| 528 | Ga0501080_0229752 | 3300049742 | Bacteria | 1696 |
| 529 | Ga0501083_0005021 | 3300049744 | Bacteria | 9373 |
| 530 | Ga0501083_0007399 | 3300049744 | Bacteria | 7788 |
| 531 | Ga0501083_0043593 | 3300049744 | Bacteria | 3039 |
| 532 | Ga0501083_0277868 | 3300049744 | Bacteria | 1089 |
| 533 | Ga0501035_0000248 | 3300049822 | Bacteria | 65046 |
| 534 | Ga0501035_0002666 | 3300049822 | Bacteria | 17365 |
| 535 | Ga0501035_0003898 | 3300049822 | Bacteria | 14232 |
| 536 | Ga0501035_0101308 | 3300049822 | Bacteria | 2527 |
| 537 | Ga0501035_0251519 | 3300049822 | Bacteria | 1500 |
| 538 | Ga0501044_0003376 | 3300049823 | Bacteria | 17996 |
| 539 | Ga0501044_0003625 | 3300049823 | Bacteria | 17374 |
| 540 | Ga0501044_0004950 | 3300049823 | Bacteria | 14901 |
| 541 | Ga0501044_0006686 | 3300049823 | Bacteria | 12711 |
| 542 | Ga0501044_0018070 | 3300049823 | Bacteria | 7562 |
| 543 | Ga0501044_0259717 | 3300049823 | Bacteria | 1675 |
| 544 | Ga0501044_0276307 | 3300049823 | Bacteria | 1614 |
| 545 | Ga0501044_0445345 | 3300049823 | Bacteria | 1202 |
| 546 | Ga0501044_0605383 | 3300049823 | Bacteria | 988 |
| 547 | Ga0501045_0291370 | 3300049824 | Bacteria | 1215 |
| 548 | nmdc:mga03n38_1856_c2 | 3300050490 | Bacteria | 5633 |
| 549 | nmdc:mga03n38_48390_c1 | 3300050490 | Bacteria | 1886 |
| 550 | nmdc:mga00v17_7166_c1 | 3300050491 | Bacteria | 5941 |
| 551 | nmdc:mga0yw44_5415_c1 | 3300050492 | Bacteria | 6026 |
| 552 | nmdc:mga06z11_420152_c1 | 3300050494 | Bacteria | 806 |
| 553 | nmdc:mga07m45_2025_c1 | 3300050496 | Bacteria | 4216 |
| 554 | nmdc:mga08y16_745885_c1 | 3300050511 | Bacteria | 975 |
| 555 | nmdc:mga0sz30_167564_c1 | 3300050516 | Bacteria | 974 |
| 556 | nmdc:mga0sz30_91566_c1 | 3300050516 | Bacteria | 1323 |
| 557 | Ga0495601_0000519 | 3300053077 | Bacteria | 20315 |
| 558 | Ga0500635_0004864 | 3300053080 | Bacteria | 3488 |
| 559 | Ga0495619_0044864 | 3300053085 | Bacteria | 2903 |
| 560 | Ga0500578_0062317 | 3300053086 | Bacteria | 2380 |
| 561 | Ga0500578_0227007 | 3300053086 | Bacteria | 1133 |
| 562 | Ga0500644_0102111 | 3300053088 | Bacteria | 1091 |
| 563 | Ga0500583_0101740 | 3300053092 | Bacteria | 1408 |
| 564 | Ga0500640_007318 | 3300053095 | Bacteria | 4286 |
| 565 | Ga0500650_0061242 | 3300053098 | Bacteria | 1757 |
| 566 | Ga0500650_0234462 | 3300053098 | Bacteria | 827 |
| 567 | Ga0500654_046623 | 3300053099 | Bacteria | 2388 |
| 568 | Ga0500654_112087 | 3300053099 | Bacteria | 1112 |
| 569 | Ga0500660_107726 | 3300053100 | Bacteria | 1197 |
| 570 | Ga0500553_030046 | 3300053101 | Bacteria | 2720 |
| 571 | Ga0500556_0000400 | 3300053104 | Bacteria | 31735 |
| 572 | Ga0500560_004220 | 3300053107 | Bacteria | 3027 |
| 573 | Ga0500569_012505 | 3300053109 | Bacteria | 2055 |
| 574 | Ga0500572_007340 | 3300053111 | Bacteria | 2552 |
| 575 | Ga0500594_0005978 | 3300053118 | Bacteria | 2716 |
| 576 | Ga0500594_0091823 | 3300053118 | Bacteria | 923 |
| 577 | Ga0500608_096599 | 3300053122 | Bacteria | 1374 |
| 578 | Ga0500614_047212 | 3300053123 | Bacteria | 1118 |
| 579 | Ga0500628_004523 | 3300053129 | Bacteria | 2303 |
| 580 | Ga0500652_000402 | 3300053131 | Bacteria | 15494 |
| 581 | Ga0500652_009669 | 3300053131 | Bacteria | 3272 |
| 582 | Ga0500652_115005 | 3300053131 | Bacteria | 1124 |
| 583 | Ga0500658_0037842 | 3300053134 | Bacteria | 1920 |
| 584 | Ga0500658_0245062 | 3300053134 | Bacteria | 823 |
| 585 | Ga0500559_0000719 | 3300053136 | Bacteria | 21761 |
| 586 | Ga0500561_0013747 | 3300053137 | Bacteria | 1761 |
| 587 | Ga0500568_0000579 | 3300053139 | Bacteria | 26786 |
| 588 | Ga0500579_048915 | 3300053143 | Bacteria | 2599 |
| 589 | Ga0500600_0029597 | 3300053149 | Bacteria | 3230 |
| 590 | Ga0500600_0151971 | 3300053149 | Bacteria | 1150 |
| 591 | Ga0500616_0000483 | 3300053153 | Bacteria | 51655 |
| 592 | Ga0500616_0000930 | 3300053153 | Bacteria | 32033 |
| 593 | Ga0500616_0002364 | 3300053153 | Bacteria | 15860 |
| 594 | Ga0500616_0007128 | 3300053153 | Bacteria | 7155 |
| 595 | Ga0500616_0035701 | 3300053153 | Bacteria | 2702 |
| 596 | Ga0500627_0003406 | 3300053158 | Bacteria | 4909 |
| 597 | Ga0500633_0020650 | 3300053160 | Bacteria | 1990 |
| 598 | Ga0500636_0208114 | 3300053177 | Bacteria | 1029 |
| 599 | Ga0500645_000017 | 3300053730 | Bacteria | 146045 |
| 600 | Ga0500656_000122 | 3300053732 | Bacteria | 4545 |
| 601 | Ga0500599_008279 | 3300053736 | Bacteria | 1347 |
| 602 | Ga0500587_002769 | 3300053739 | Bacteria | 2477 |
| 603 | Ga0501084_0422920 | 3300054114 | Bacteria | 1126 |
| 604 | Ga0501082_0029555 | 3300060353 | Bacteria | 4721 |
| 605 | Ga0501082_0161486 | 3300060353 | Bacteria | 1947 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048908 | Ga0496105_0073852 | Ga0496105_0073852_131_793 | 220 |
| 2 | 3300053104 | Ga0500556_0000400 | Ga0500556_0000400_51_734 | 221 |
| 3 | 3300053153 | Ga0500616_0000930 | Ga0500616_0000930_15717_16400 | 221 |
| 4 | 3300005441 | Ga0070700_100328262 | Ga0070700_1003282622 | 227 |
| 5 | 3300006173 | Ga0070716_100035357 | Ga0070716_1000353575 | 227 |
| 6 | 3300007788 | Ga0099795_10010741 | Ga0099795_100107413 | 227 |
| 7 | 3300009545 | Ga0105237_10232907 | Ga0105237_102329072 | 227 |
| 8 | 3300013306 | Ga0163162_10105490 | Ga0163162_101054902 | 227 |
| 9 | 3300013308 | Ga0157375_10077352 | Ga0157375_100773523 | 227 |
| 10 | 3300025898 | Ga0207692_10050411 | Ga0207692_100504112 | 227 |
| 11 | 3300025907 | Ga0207645_10113300 | Ga0207645_101133002 | 227 |
| 12 | 3300025935 | Ga0207709_10560423 | Ga0207709_105604232 | 227 |
| 13 | 3300025939 | Ga0207665_10051276 | Ga0207665_100512765 | 227 |
| 14 | 3300035691 | Ga0373931_0083630 | Ga0373931_0083630_629_1312 | 227 |
| 15 | 3300041509 | Ga0451843_0099427 | Ga0451843_0099427_294_977 | 227 |
| 16 | 3300046453 | Ga0495627_012618 | Ga0495627_012618_17_700 | 227 |
| 17 | 3300046459 | Ga0495629_0199901 | Ga0495629_0199901_127_810 | 227 |
| 18 | 3300046520 | Ga0495637_0142884 | Ga0495637_0142884_208_891 | 227 |
| 19 | 3300046524 | Ga0495648_0021550 | Ga0495648_0021550_3753_4436 | 227 |
| 20 | 3300046533 | Ga0495640_0085391 | Ga0495640_0085391_461_1144 | 227 |
| 21 | 3300048909 | Ga0496106_0090731 | Ga0496106_0090731_170_853 | 227 |
| 22 | 3300048910 | Ga0496107_0066239 | Ga0496107_0066239_1294_1977 | 227 |
| 23 | 3300049568 | Ga0501031_0025900 | Ga0501031_0025900_2857_3540 | 227 |
| 24 | 3300049570 | Ga0501033_0003278 | Ga0501033_0003278_12177_12860 | 227 |
| 25 | 3300049571 | Ga0501034_0083866 | Ga0501034_0083866_1606_2289 | 227 |
| 26 | 3300049574 | Ga0501038_0024746 | Ga0501038_0024746_36_719 | 227 |
| 27 | 3300049574 | Ga0501038_0082868 | Ga0501038_0082868_1277_1960 | 227 |
| 28 | 3300049580 | Ga0501046_0002395 | Ga0501046_0002395_16472_17155 | 227 |
| 29 | 3300049586 | Ga0501070_0118730 | Ga0501070_0118730_222_905 | 227 |
| 30 | 3300049589 | Ga0501073_0035832 | Ga0501073_0035832_444_1127 | 227 |
| 31 | 3300049742 | Ga0501080_0229752 | Ga0501080_0229752_721_1404 | 227 |
| 32 | 3300049744 | Ga0501083_0277868 | Ga0501083_0277868_19_702 | 227 |
| 33 | 3300049822 | Ga0501035_0002666 | Ga0501035_0002666_15935_16618 | 227 |
| 34 | 3300049823 | Ga0501044_0003625 | Ga0501044_0003625_546_1229 | 227 |
| 35 | 3300053131 | Ga0500652_115005 | Ga0500652_115005_131_814 | 227 |
| 36 | 3300053134 | Ga0500658_0245062 | Ga0500658_0245062_120_812 | 227 |
| 37 | 3300053158 | Ga0500627_0003406 | Ga0500627_0003406_3958_4641 | 227 |
| 38 | 3300060353 | Ga0501082_0161486 | Ga0501082_0161486_741_1424 | 227 |
| 39 | 3300041512 | Ga0451853_0325620 | Ga0451853_0325620_6662_7435 | 231 |
| 40 | 3300049744 | Ga0501083_0007399 | Ga0501083_0007399_5000_5734 | 232 |
| 41 | 3300049568 | Ga0501031_0149952 | Ga0501031_0149952_218_949 | 233 |
| 42 | 3300049569 | Ga0501032_0158460 | Ga0501032_0158460_127_858 | 233 |
| 43 | 3300049570 | Ga0501033_0036673 | Ga0501033_0036673_1186_1917 | 233 |
| 44 | 3300049571 | Ga0501034_0006755 | Ga0501034_0006755_1268_1999 | 233 |
| 45 | 3300049572 | Ga0501036_0001005 | Ga0501036_0001005_16619_17350 | 233 |
| 46 | 3300049573 | Ga0501037_0008402 | Ga0501037_0008402_6614_7345 | 233 |
| 47 | 3300049574 | Ga0501038_0005437 | Ga0501038_0005437_3775_4506 | 233 |
| 48 | 3300049575 | Ga0501039_0155099 | Ga0501039_0155099_99_830 | 233 |
| 49 | 3300049579 | Ga0501043_0010419 | Ga0501043_0010419_5689_6420 | 233 |
| 50 | 3300049580 | Ga0501046_0000091 | Ga0501046_0000091_52601_53332 | 233 |
| 51 | 3300049581 | Ga0501047_0007490 | Ga0501047_0007490_225_956 | 233 |
| 52 | 3300049590 | Ga0501074_0172377 | Ga0501074_0172377_181_912 | 233 |
| 53 | 3300049741 | Ga0501079_0237167 | Ga0501079_0237167_473_1204 | 233 |
| 54 | 3300049823 | Ga0501044_0276307 | Ga0501044_0276307_20_751 | 233 |
| 55 | 3300046460 | Ga0495638_0023029 | Ga0495638_0023029_3043_3816 | 235 |
| 56 | 3300053153 | Ga0500616_0007128 | Ga0500616_0007128_3609_4343 | 235 |
| 57 | 3300028794 | Ga0307515_10061669 | Ga0307515_100616693 | 237 |
| 58 | 3300030522 | Ga0307512_10004311 | Ga0307512_100043114 | 237 |
| 59 | 3300031616 | Ga0307508_10156550 | Ga0307508_101565502 | 237 |
| 60 | 3300033180 | Ga0307510_10152891 | Ga0307510_101528912 | 237 |
| 61 | 3300053098 | Ga0500650_0061242 | Ga0500650_0061242_919_1659 | 237 |
| 62 | 3300053099 | Ga0500654_112087 | Ga0500654_112087_138_872 | 237 |
| 63 | 3300053118 | Ga0500594_0005978 | Ga0500594_0005978_1867_2607 | 237 |
| 64 | 3300053131 | Ga0500652_009669 | Ga0500652_009669_1084_1824 | 237 |
| 65 | 3300005355 | Ga0070671_100000949 | Ga0070671_1000009497 | 238 |
| 66 | 3300025925 | Ga0207650_10091927 | Ga0207650_100919271 | 238 |
| 67 | 3300025931 | Ga0207644_10089307 | Ga0207644_100893071 | 238 |
| 68 | iso_pu_bacteria | 2758568522 | 2760306631 | 238 |
| 69 | 3300049569 | Ga0501032_0083467 | Ga0501032_0083467_1201_1941 | 239 |
| 70 | 3300049581 | Ga0501047_0004553 | Ga0501047_0004553_11546_12286 | 239 |
| 71 | 3300049586 | Ga0501070_0220822 | Ga0501070_0220822_328_1068 | 239 |
| 72 | 3300049823 | Ga0501044_0006686 | Ga0501044_0006686_11401_12141 | 239 |
| 73 | iso_pu_bacteria | 2643221607 | 2644048953 | 239 |
| 74 | iso_pu_bacteria | 2643221686 | 2644481703 | 239 |
| 75 | iso_pu_bacteria | 2643221689 | 2644501022 | 239 |
| 76 | iso_pu_bacteria | 2738541293 | 2738805121 | 239 |
| 77 | iso_pu_bacteria | 2508501039 | 2508671208 | 240 |
| 78 | iso_pu_bacteria | 2517572101 | 2517760077 | 240 |
| 79 | iso_pu_bacteria | 2558860280 | 2559432358 | 240 |
| 80 | iso_pu_bacteria | 2582581314 | 2585315205 | 240 |
| 81 | iso_pu_bacteria | 2616644814 | 2616701626 | 240 |
| 82 | iso_pu_bacteria | 2643221562 | 2643830466 | 240 |
| 83 | iso_pu_bacteria | 2643221647 | 2644262429 | 240 |
| 84 | iso_pu_bacteria | 2675902999 | 2676204080 | 240 |
| 85 | iso_pu_bacteria | 2687453737 | 2689962453 | 240 |
| 86 | iso_pu_bacteria | 2687453737 | 2689963724 | 240 |
| 87 | iso_pu_bacteria | 2687453743 | 2689992796 | 240 |
| 88 | iso_pu_bacteria | 2728368998 | 2728748584 | 240 |
| 89 | iso_pu_bacteria | 2758568621 | 2760624490 | 240 |
| 90 | iso_pu_bacteria | 2773857921 | 2774848656 | 240 |
| 91 | iso_pu_bacteria | 2816332139 | 2816507448 | 240 |
| 92 | iso_pu_bacteria | 2858895516 | 2858901503 | 240 |
| 93 | iso_pu_bacteria | 2862574272 | 2862582216 | 240 |
| 94 | iso_pu_bacteria | 2880489317 | 2880491127 | 240 |
| 95 | iso_pu_bacteria | 2919085039 | 2919085189 | 240 |
| 96 | iso_pu_bacteria | 2945941187 | 2945945106 | 240 |
| 97 | iso_pu_bacteria | 2945968032 | 2945969394 | 240 |
| 98 | iso_pu_bacteria | 2954701450 | 2954709894 | 240 |
| 99 | iso_pu_bacteria | 8001781756 | 8001786280 | 240 |
| 100 | iso_pu_bacteria | 8023623736 | 8023630181 | 240 |
| 101 | iso_pu_bacteria | 8047710418 | 8047717869 | 240 |
| 102 | iso_pu_bacteria | 8048127548 | 8048136042 | 240 |
| 103 | iso_pu_bacteria | 8054302542 | 8054307023 | 240 |
| 104 | iso_pu_bacteria | 8054727385 | 8054728028 | 240 |
| 105 | iso_pu_bacteria | 8055066027 | 8055068609 | 240 |
| 106 | iso_pu_bacteria | 8056579771 | 8056583570 | 240 |
| 107 | iso_pu_bacteria | 2599185354 | 2600203789 | 241 |
| 108 | 3300005530 | Ga0070679_100005317 | Ga0070679_1000053174 | 242 |
| 109 | 3300025261 | Ga0209233_1008225 | Ga0209233_10082256 | 242 |
| 110 | 3300003187 | JGI25151J46595_10098038 | JGI25151J46595_100980381 | 243 |
| 111 | 3300003316 | rootH1_10079142 | rootH1_100791423 | 243 |
| 112 | 3300003320 | rootH2_10230140 | rootH2_102301403 | 243 |
| 113 | 3300003320 | rootH2_10267319 | rootH2_102673193 | 243 |
| 114 | 3300003323 | rootH1_10165931 | rootH1_101659314 | 243 |
| 115 | 3300003323 | rootH1_10286776 | rootH1_102867763 | 243 |
| 116 | 3300005329 | Ga0070683_100326623 | Ga0070683_1003266232 | 243 |
| 117 | 3300005335 | Ga0070666_10010743 | Ga0070666_100107433 | 243 |
| 118 | 3300009093 | Ga0105240_10201565 | Ga0105240_102015652 | 243 |
| 119 | 3300009093 | Ga0105240_10743114 | Ga0105240_107431142 | 243 |
| 120 | 3300013104 | Ga0157370_10026255 | Ga0157370_100262556 | 243 |
| 121 | 3300025294 | Ga0209025_1001389 | Ga0209025_100138911 | 243 |
| 122 | 3300039447 | Ga0436361_0991054 | Ga0436361_0991054_128_865 | 243 |
| 123 | 3300041486 | Ga0451807_1482729 | Ga0451807_1482729_34_765 | 243 |
| 124 | 3300048905 | Ga0496102_0027571 | Ga0496102_0027571_659_1405 | 243 |
| 125 | 3300048920 | Ga0496117_0001629 | Ga0496117_0001629_21619_22365 | 243 |
| 126 | 3300048921 | Ga0496118_0001732 | Ga0496118_0001732_21619_22365 | 243 |
| 127 | 3300001989 | JGI24739J22299_10002752 | JGI24739J22299_100027524 | 244 |
| 128 | 3300001990 | JGI24737J22298_10027289 | JGI24737J22298_100272893 | 244 |
| 129 | 3300002459 | JGI24751J29686_10015835 | JGI24751J29686_100158352 | 244 |
| 130 | 3300003323 | rootH1_10071420 | rootH1_100714203 | 244 |
| 131 | 3300003577 | Ga0007416J51690_1009241 | Ga0007416J51690_10092411 | 244 |
| 132 | 3300003611 | Ga0007411J51799_106219 | Ga0007411J51799_1062191 | 244 |
| 133 | 3300003762 | Ga0055542_1000439 | Ga0055542_100043932 | 244 |
| 134 | 3300005288 | Ga0065714_10030916 | Ga0065714_100309162 | 244 |
| 135 | 3300005356 | Ga0070674_100409687 | Ga0070674_1004096871 | 244 |
| 136 | 3300005367 | Ga0070667_100000308 | Ga0070667_10000030819 | 244 |
| 137 | 3300005435 | Ga0070714_100019981 | Ga0070714_1000199814 | 244 |
| 138 | 3300005435 | Ga0070714_100054094 | Ga0070714_1000540942 | 244 |
| 139 | 3300005435 | Ga0070714_100063694 | Ga0070714_1000636942 | 244 |
| 140 | 3300005435 | Ga0070714_100339925 | Ga0070714_1003399252 | 244 |
| 141 | 3300005435 | Ga0070714_100497129 | Ga0070714_1004971292 | 244 |
| 142 | 3300005436 | Ga0070713_100128517 | Ga0070713_1001285172 | 244 |
| 143 | 3300005436 | Ga0070713_100576844 | Ga0070713_1005768441 | 244 |
| 144 | 3300005437 | Ga0070710_10288389 | Ga0070710_102883892 | 244 |
| 145 | 3300005439 | Ga0070711_100111142 | Ga0070711_1001111422 | 244 |
| 146 | 3300005455 | Ga0070663_100118299 | Ga0070663_1001182994 | 244 |
| 147 | 3300005455 | Ga0070663_100189552 | Ga0070663_1001895522 | 244 |
| 148 | 3300005456 | Ga0070678_100516959 | Ga0070678_1005169592 | 244 |
| 149 | 3300005530 | Ga0070679_100136007 | Ga0070679_1001360072 | 244 |
| 150 | 3300005530 | Ga0070679_100554525 | Ga0070679_1005545251 | 244 |
| 151 | 3300005548 | Ga0070665_100108097 | Ga0070665_1001080972 | 244 |
| 152 | 3300005548 | Ga0070665_100179527 | Ga0070665_1001795271 | 244 |
| 153 | 3300005563 | Ga0068855_100042178 | Ga0068855_1000421785 | 244 |
| 154 | 3300005563 | Ga0068855_100669726 | Ga0068855_1006697261 | 244 |
| 155 | 3300005564 | Ga0070664_100136957 | Ga0070664_1001369572 | 244 |
| 156 | 3300005614 | Ga0068856_100525393 | Ga0068856_1005253931 | 244 |
| 157 | 3300005616 | Ga0068852_100050125 | Ga0068852_1000501255 | 244 |
| 158 | 3300005616 | Ga0068852_100101469 | Ga0068852_1001014693 | 244 |
| 159 | 3300005617 | Ga0068859_100006027 | Ga0068859_1000060274 | 244 |
| 160 | 3300005618 | Ga0068864_100320816 | Ga0068864_1003208162 | 244 |
| 161 | 3300005842 | Ga0068858_100002726 | Ga0068858_10000272610 | 244 |
| 162 | 3300005843 | Ga0068860_100000155 | Ga0068860_10000015519 | 244 |
| 163 | 3300005844 | Ga0068862_100000096 | Ga0068862_10000009614 | 244 |
| 164 | 3300005983 | Ga0081540_1022853 | Ga0081540_10228533 | 244 |
| 165 | 3300006028 | Ga0070717_10136297 | Ga0070717_101362972 | 244 |
| 166 | 3300006038 | Ga0075365_10012747 | Ga0075365_100127475 | 244 |
| 167 | 3300006038 | Ga0075365_10032306 | Ga0075365_100323063 | 244 |
| 168 | 3300006048 | Ga0075363_100058089 | Ga0075363_1000580892 | 244 |
| 169 | 3300006051 | Ga0075364_10037286 | Ga0075364_100372861 | 244 |
| 170 | 3300006175 | Ga0070712_100033901 | Ga0070712_1000339013 | 244 |
| 171 | 3300006175 | Ga0070712_100178141 | Ga0070712_1001781412 | 244 |
| 172 | 3300006177 | Ga0075362_10013512 | Ga0075362_100135122 | 244 |
| 173 | 3300006186 | Ga0075369_10089581 | Ga0075369_100895812 | 244 |
| 174 | 3300006353 | Ga0075370_10014473 | Ga0075370_100144732 | 244 |
| 175 | 3300006871 | Ga0075434_100918859 | Ga0075434_1009188591 | 244 |
| 176 | 3300006931 | Ga0097620_100006027 | Ga0097620_1000060274 | 244 |
| 177 | 3300006948 | Ga0099826_10268791 | Ga0099826_102687911 | 244 |
| 178 | 3300007788 | Ga0099795_10094914 | Ga0099795_100949142 | 244 |
| 179 | 3300009093 | Ga0105240_10780583 | Ga0105240_107805831 | 244 |
| 180 | 3300009098 | Ga0105245_10590819 | Ga0105245_105908192 | 244 |
| 181 | 3300009101 | Ga0105247_10000040 | Ga0105247_1000004071 | 244 |
| 182 | 3300009174 | Ga0105241_10313280 | Ga0105241_103132801 | 244 |
| 183 | 3300009174 | Ga0105241_10406454 | Ga0105241_104064541 | 244 |
| 184 | 3300009177 | Ga0105248_10000095 | Ga0105248_100000955 | 244 |
| 185 | 3300009177 | Ga0105248_10137550 | Ga0105248_101375503 | 244 |
| 186 | 3300009177 | Ga0105248_10963290 | Ga0105248_109632902 | 244 |
| 187 | 3300009545 | Ga0105237_10148880 | Ga0105237_101488802 | 244 |
| 188 | 3300009545 | Ga0105237_10728712 | Ga0105237_107287121 | 244 |
| 189 | 3300009551 | Ga0105238_10151181 | Ga0105238_101511812 | 244 |
| 190 | 3300009551 | Ga0105238_10152586 | Ga0105238_101525863 | 244 |
| 191 | 3300009551 | Ga0105238_10283619 | Ga0105238_102836192 | 244 |
| 192 | 3300009551 | Ga0105238_10714340 | Ga0105238_107143401 | 244 |
| 193 | 3300009553 | Ga0105249_10000069 | Ga0105249_1000006962 | 244 |
| 194 | 3300010159 | Ga0099796_10066653 | Ga0099796_100666532 | 244 |
| 195 | 3300010375 | Ga0105239_10181186 | Ga0105239_101811862 | 244 |
| 196 | 3300010375 | Ga0105239_10363307 | Ga0105239_103633072 | 244 |
| 197 | 3300010375 | Ga0105239_10578964 | Ga0105239_105789642 | 244 |
| 198 | 3300011119 | Ga0105246_10033294 | Ga0105246_100332942 | 244 |
| 199 | 3300012507 | Ga0157342_1014844 | Ga0157342_10148441 | 244 |
| 200 | 3300013104 | Ga0157370_10000317 | Ga0157370_1000031729 | 244 |
| 201 | 3300013104 | Ga0157370_10157873 | Ga0157370_101578732 | 244 |
| 202 | 3300013105 | Ga0157369_10407593 | Ga0157369_104075932 | 244 |
| 203 | 3300013105 | Ga0157369_10409534 | Ga0157369_104095342 | 244 |
| 204 | 3300013296 | Ga0157374_10278718 | Ga0157374_102787182 | 244 |
| 205 | 3300013306 | Ga0163162_10170835 | Ga0163162_101708351 | 244 |
| 206 | 3300013306 | Ga0163162_10181355 | Ga0163162_101813552 | 244 |
| 207 | 3300013308 | Ga0157375_10240458 | Ga0157375_102404583 | 244 |
| 208 | 3300014325 | Ga0163163_10014016 | Ga0163163_100140163 | 244 |
| 209 | 3300014325 | Ga0163163_10580939 | Ga0163163_105809392 | 244 |
| 210 | 3300014326 | Ga0157380_10835954 | Ga0157380_108359541 | 244 |
| 211 | 3300014968 | Ga0157379_10025856 | Ga0157379_100258563 | 244 |
| 212 | 3300015265 | Ga0182005_1000004 | Ga0182005_1000004420 | 244 |
| 213 | 3300020070 | Ga0206356_11243581 | Ga0206356_112435811 | 244 |
| 214 | 3300020082 | Ga0206353_11300916 | Ga0206353_113009161 | 244 |
| 215 | 3300022467 | Ga0224712_10193976 | Ga0224712_101939761 | 244 |
| 216 | 3300025728 | Ga0207655_1032430 | Ga0207655_10324303 | 244 |
| 217 | 3300025899 | Ga0207642_10320638 | Ga0207642_103206381 | 244 |
| 218 | 3300025900 | Ga0207710_10000050 | Ga0207710_10000050101 | 244 |
| 219 | 3300025901 | Ga0207688_10136566 | Ga0207688_101365662 | 244 |
| 220 | 3300025904 | Ga0207647_10025551 | Ga0207647_100255512 | 244 |
| 221 | 3300025904 | Ga0207647_10033454 | Ga0207647_100334542 | 244 |
| 222 | 3300025904 | Ga0207647_10124806 | Ga0207647_101248062 | 244 |
| 223 | 3300025906 | Ga0207699_10059943 | Ga0207699_100599433 | 244 |
| 224 | 3300025906 | Ga0207699_10499563 | Ga0207699_104995631 | 244 |
| 225 | 3300025909 | Ga0207705_10338020 | Ga0207705_103380201 | 244 |
| 226 | 3300025911 | Ga0207654_10002481 | Ga0207654_1000248110 | 244 |
| 227 | 3300025912 | Ga0207707_10123483 | Ga0207707_101234831 | 244 |
| 228 | 3300025913 | Ga0207695_10014892 | Ga0207695_100148929 | 244 |
| 229 | 3300025914 | Ga0207671_10001125 | Ga0207671_1000112526 | 244 |
| 230 | 3300025914 | Ga0207671_10122616 | Ga0207671_101226162 | 244 |
| 231 | 3300025914 | Ga0207671_10265473 | Ga0207671_102654731 | 244 |
| 232 | 3300025914 | Ga0207671_10594749 | Ga0207671_105947491 | 244 |
| 233 | 3300025915 | Ga0207693_10043227 | Ga0207693_100432273 | 244 |
| 234 | 3300025915 | Ga0207693_10295167 | Ga0207693_102951671 | 244 |
| 235 | 3300025915 | Ga0207693_10533809 | Ga0207693_105338091 | 244 |
| 236 | 3300025916 | Ga0207663_10077835 | Ga0207663_100778352 | 244 |
| 237 | 3300025916 | Ga0207663_10081704 | Ga0207663_100817042 | 244 |
| 238 | 3300025917 | Ga0207660_10580727 | Ga0207660_105807272 | 244 |
| 239 | 3300025919 | Ga0207657_10606321 | Ga0207657_106063211 | 244 |
| 240 | 3300025921 | Ga0207652_10067625 | Ga0207652_100676252 | 244 |
| 241 | 3300025921 | Ga0207652_10512592 | Ga0207652_105125921 | 244 |
| 242 | 3300025923 | Ga0207681_10002841 | Ga0207681_100028417 | 244 |
| 243 | 3300025924 | Ga0207694_10101413 | Ga0207694_101014133 | 244 |
| 244 | 3300025924 | Ga0207694_10288478 | Ga0207694_102884781 | 244 |
| 245 | 3300025927 | Ga0207687_10069301 | Ga0207687_100693013 | 244 |
| 246 | 3300025927 | Ga0207687_10120347 | Ga0207687_101203472 | 244 |
| 247 | 3300025928 | Ga0207700_10280462 | Ga0207700_102804622 | 244 |
| 248 | 3300025929 | Ga0207664_10002394 | Ga0207664_1000239411 | 244 |
| 249 | 3300025929 | Ga0207664_10022536 | Ga0207664_100225363 | 244 |
| 250 | 3300025929 | Ga0207664_10108015 | Ga0207664_101080153 | 244 |
| 251 | 3300025929 | Ga0207664_10190169 | Ga0207664_101901692 | 244 |
| 252 | 3300025929 | Ga0207664_10321894 | Ga0207664_103218942 | 244 |
| 253 | 3300025940 | Ga0207691_10080042 | Ga0207691_100800422 | 244 |
| 254 | 3300025940 | Ga0207691_10107009 | Ga0207691_101070092 | 244 |
| 255 | 3300025941 | Ga0207711_10000082 | Ga0207711_1000008279 | 244 |
| 256 | 3300025942 | Ga0207689_10218716 | Ga0207689_102187162 | 244 |
| 257 | 3300025944 | Ga0207661_10477584 | Ga0207661_104775841 | 244 |
| 258 | 3300025945 | Ga0207679_10144966 | Ga0207679_101449662 | 244 |
| 259 | 3300025945 | Ga0207679_10608861 | Ga0207679_106088611 | 244 |
| 260 | 3300025961 | Ga0207712_10000084 | Ga0207712_1000008461 | 244 |
| 261 | 3300025981 | Ga0207640_10111051 | Ga0207640_101110513 | 244 |
| 262 | 3300025986 | Ga0207658_10000868 | Ga0207658_1000086819 | 244 |
| 263 | 3300026035 | Ga0207703_11038697 | Ga0207703_110386971 | 244 |
| 264 | 3300026067 | Ga0207678_10018048 | Ga0207678_100180483 | 244 |
| 265 | 3300026067 | Ga0207678_10195735 | Ga0207678_101957352 | 244 |
| 266 | 3300026067 | Ga0207678_10413101 | Ga0207678_104131011 | 244 |
| 267 | 3300026095 | Ga0207676_10513251 | Ga0207676_105132511 | 244 |
| 268 | 3300026116 | Ga0207674_10405816 | Ga0207674_104058161 | 244 |
| 269 | 3300026121 | Ga0207683_10121955 | Ga0207683_101219554 | 244 |
| 270 | 3300026142 | Ga0207698_10073403 | Ga0207698_100734033 | 244 |
| 271 | 3300028379 | Ga0268266_10059382 | Ga0268266_100593824 | 244 |
| 272 | 3300028379 | Ga0268266_10464642 | Ga0268266_104646421 | 244 |
| 273 | 3300028380 | Ga0268265_10000106 | Ga0268265_1000010687 | 244 |
| 274 | 3300028381 | Ga0268264_10000219 | Ga0268264_1000021919 | 244 |
| 275 | 3300028381 | Ga0268264_10700813 | Ga0268264_107008132 | 244 |
| 276 | 3300028563 | Ga0265319_1017014 | Ga0265319_10170144 | 244 |
| 277 | 3300028666 | Ga0265336_10005155 | Ga0265336_100051553 | 244 |
| 278 | 3300028666 | Ga0265336_10045147 | Ga0265336_100451472 | 244 |
| 279 | 3300028666 | Ga0265336_10049927 | Ga0265336_100499272 | 244 |
| 280 | 3300028786 | Ga0307517_10044770 | Ga0307517_100447706 | 244 |
| 281 | 3300028786 | Ga0307517_10113193 | Ga0307517_101131933 | 244 |
| 282 | 3300028794 | Ga0307515_10000846 | Ga0307515_1000084650 | 244 |
| 283 | 3300028794 | Ga0307515_10049581 | Ga0307515_100495815 | 244 |
| 284 | 3300028800 | Ga0265338_10003900 | Ga0265338_1000390014 | 244 |
| 285 | 3300028800 | Ga0265338_10017188 | Ga0265338_100171889 | 244 |
| 286 | 3300028800 | Ga0265338_10021357 | Ga0265338_100213577 | 244 |
| 287 | 3300028800 | Ga0265338_10042925 | Ga0265338_100429253 | 244 |
| 288 | 3300028800 | Ga0265338_10107746 | Ga0265338_101077462 | 244 |
| 289 | 3300030521 | Ga0307511_10003090 | Ga0307511_1000309010 | 244 |
| 290 | 3300030521 | Ga0307511_10141165 | Ga0307511_101411651 | 244 |
| 291 | 3300030522 | Ga0307512_10007896 | Ga0307512_100078963 | 244 |
| 292 | 3300031090 | Ga0265760_10076694 | Ga0265760_100766941 | 244 |
| 293 | 3300031235 | Ga0265330_10027609 | Ga0265330_100276091 | 244 |
| 294 | 3300031456 | Ga0307513_10001603 | Ga0307513_100016037 | 244 |
| 295 | 3300031456 | Ga0307513_10069471 | Ga0307513_100694712 | 244 |
| 296 | 3300031456 | Ga0307513_10331367 | Ga0307513_103313671 | 244 |
| 297 | 3300031507 | Ga0307509_10013229 | Ga0307509_100132293 | 244 |
| 298 | 3300031507 | Ga0307509_10023765 | Ga0307509_100237656 | 244 |
| 299 | 3300031507 | Ga0307509_10093453 | Ga0307509_100934532 | 244 |
| 300 | 3300031616 | Ga0307508_10001782 | Ga0307508_100017822 | 244 |
| 301 | 3300031616 | Ga0307508_10009013 | Ga0307508_1000901310 | 244 |
| 302 | 3300031616 | Ga0307508_10139501 | Ga0307508_101395011 | 244 |
| 303 | 3300031616 | Ga0307508_10352832 | Ga0307508_103528322 | 244 |
| 304 | 3300031649 | Ga0307514_10023311 | Ga0307514_100233116 | 244 |
| 305 | 3300031730 | Ga0307516_10051225 | Ga0307516_100512251 | 244 |
| 306 | 3300031731 | Ga0307405_10168115 | Ga0307405_101681152 | 244 |
| 307 | 3300033179 | Ga0307507_10001954 | Ga0307507_1000195421 | 244 |
| 308 | 3300033179 | Ga0307507_10027336 | Ga0307507_100273364 | 244 |
| 309 | 3300033179 | Ga0307507_10036156 | Ga0307507_100361562 | 244 |
| 310 | 3300033179 | Ga0307507_10053550 | Ga0307507_100535504 | 244 |
| 311 | 3300033180 | Ga0307510_10004939 | Ga0307510_1000493914 | 244 |
| 312 | 3300033180 | Ga0307510_10049355 | Ga0307510_100493556 | 244 |
| 313 | 3300035086 | Ga0373934_0096245 | Ga0373934_0096245_397_1131 | 244 |
| 314 | 3300035091 | Ga0373951_0000086 | Ga0373951_0000086_287_1033 | 244 |
| 315 | 3300035111 | Ga0373923_0201848 | Ga0373923_0201848_17_751 | 244 |
| 316 | 3300035113 | Ga0373936_0005116 | Ga0373936_0005116_2415_3149 | 244 |
| 317 | 3300035118 | Ga0373954_0017921 | Ga0373954_0017921_248_982 | 244 |
| 318 | 3300035120 | Ga0373957_0085805 | Ga0373957_0085805_297_1031 | 244 |
| 319 | 3300035410 | Ga0373924_0043622 | Ga0373924_0043622_1010_1744 | 244 |
| 320 | 3300035692 | Ga0373935_0539601 | Ga0373935_0539601_86_820 | 244 |
| 321 | 3300035725 | Ga0373947_0472048 | Ga0373947_0472048_48_782 | 244 |
| 322 | 3300036401 | Ga0373937_0814442 | Ga0373937_0814442_59_799 | 244 |
| 323 | 3300036459 | Ga0372808_005661 | Ga0372808_005661_95_835 | 244 |
| 324 | 3300037068 | Ga0373925_0000101 | Ga0373925_0000101_2351_3091 | 244 |
| 325 | 3300037068 | Ga0373925_0016708 | Ga0373925_0016708_2893_3633 | 244 |
| 326 | 3300037068 | Ga0373925_0026933 | Ga0373925_0026933_2231_2971 | 244 |
| 327 | 3300037068 | Ga0373925_0320429 | Ga0373925_0320429_131_877 | 244 |
| 328 | 3300037418 | Ga0395900_0308999 | Ga0395900_0308999_370_1104 | 244 |
| 329 | 3300037471 | Ga0395905_0556059 | Ga0395905_0556059_40_774 | 244 |
| 330 | 3300041452 | Ga0451793_0467648 | Ga0451793_0467648_72_806 | 244 |
| 331 | 3300044735 | Ga0466968_0070735 | Ga0466968_0070735_174_908 | 244 |
| 332 | 3300044901 | Ga0466960_0220887 | Ga0466960_0220887_181_915 | 244 |
| 333 | 3300046452 | Ga0495617_060796 | Ga0495617_060796_468_1202 | 244 |
| 334 | 3300046454 | Ga0495592_0009428 | Ga0495592_0009428_4607_5341 | 244 |
| 335 | 3300046454 | Ga0495592_0078488 | Ga0495592_0078488_1546_2280 | 244 |
| 336 | 3300046454 | Ga0495592_0204218 | Ga0495592_0204218_152_886 | 244 |
| 337 | 3300046455 | Ga0495603_0012178 | Ga0495603_0012178_1545_2279 | 244 |
| 338 | 3300046455 | Ga0495603_0018918 | Ga0495603_0018918_1346_2086 | 244 |
| 339 | 3300046455 | Ga0495603_0030542 | Ga0495603_0030542_366_1100 | 244 |
| 340 | 3300046459 | Ga0495629_0011173 | Ga0495629_0011173_3802_4536 | 244 |
| 341 | 3300046459 | Ga0495629_0018578 | Ga0495629_0018578_372_1106 | 244 |
| 342 | 3300046459 | Ga0495629_0038123 | Ga0495629_0038123_208_942 | 244 |
| 343 | 3300046460 | Ga0495638_0090222 | Ga0495638_0090222_791_1531 | 244 |
| 344 | 3300046460 | Ga0495638_0122447 | Ga0495638_0122447_33_767 | 244 |
| 345 | 3300046462 | Ga0495651_0001042 | Ga0495651_0001042_16414_17148 | 244 |
| 346 | 3300046462 | Ga0495651_0161204 | Ga0495651_0161204_61_795 | 244 |
| 347 | 3300046462 | Ga0495651_0305234 | Ga0495651_0305234_47_781 | 244 |
| 348 | 3300046472 | Ga0495580_0234560 | Ga0495580_0234560_201_941 | 244 |
| 349 | 3300046474 | Ga0495605_0052376 | Ga0495605_0052376_378_1118 | 244 |
| 350 | 3300046475 | Ga0495639_0239535 | Ga0495639_0239535_61_795 | 244 |
| 351 | 3300046476 | Ga0495662_0009485 | Ga0495662_0009485_3779_4513 | 244 |
| 352 | 3300046476 | Ga0495662_0082663 | Ga0495662_0082663_134_886 | 244 |
| 353 | 3300046477 | Ga0495664_0000287 | Ga0495664_0000287_16470_17204 | 244 |
| 354 | 3300046477 | Ga0495664_0015673 | Ga0495664_0015673_1569_2303 | 244 |
| 355 | 3300046477 | Ga0495664_0294054 | Ga0495664_0294054_68_808 | 244 |
| 356 | 3300046491 | Ga0495584_0061044 | Ga0495584_0061044_457_1197 | 244 |
| 357 | 3300046499 | Ga0495594_0018231 | Ga0495594_0018231_1826_2560 | 244 |
| 358 | 3300046499 | Ga0495594_0058148 | Ga0495594_0058148_783_1523 | 244 |
| 359 | 3300046499 | Ga0495594_0249448 | Ga0495594_0249448_34_798 | 244 |
| 360 | 3300046500 | Ga0495596_0034238 | Ga0495596_0034238_32_772 | 244 |
| 361 | 3300046501 | Ga0495607_0000003 | Ga0495607_0000003_145138_145872 | 244 |
| 362 | 3300046501 | Ga0495607_0006428 | Ga0495607_0006428_1540_2274 | 244 |
| 363 | 3300046506 | Ga0495583_0052521 | Ga0495583_0052521_170_910 | 244 |
| 364 | 3300046507 | Ga0495606_0013143 | Ga0495606_0013143_1701_2441 | 244 |
| 365 | 3300046507 | Ga0495606_0158149 | Ga0495606_0158149_183_923 | 244 |
| 366 | 3300046512 | Ga0495610_0003962 | Ga0495610_0003962_9524_10258 | 244 |
| 367 | 3300046512 | Ga0495610_0048209 | Ga0495610_0048209_886_1626 | 244 |
| 368 | 3300046515 | Ga0495620_0010680 | Ga0495620_0010680_2822_3562 | 244 |
| 369 | 3300046515 | Ga0495620_0042467 | Ga0495620_0042467_641_1375 | 244 |
| 370 | 3300046516 | Ga0495628_0078892 | Ga0495628_0078892_739_1479 | 244 |
| 371 | 3300046516 | Ga0495628_0083641 | Ga0495628_0083641_642_1376 | 244 |
| 372 | 3300046516 | Ga0495628_0118907 | Ga0495628_0118907_1156_1890 | 244 |
| 373 | 3300046518 | Ga0495631_0013587 | Ga0495631_0013587_2662_3402 | 244 |
| 374 | 3300046519 | Ga0495632_0000011 | Ga0495632_0000011_53812_54546 | 244 |
| 375 | 3300046519 | Ga0495632_0045284 | Ga0495632_0045284_1206_1991 | 244 |
| 376 | 3300046522 | Ga0495643_0064488 | Ga0495643_0064488_778_1512 | 244 |
| 377 | 3300046523 | Ga0495644_0084886 | Ga0495644_0084886_190_924 | 244 |
| 378 | 3300046524 | Ga0495648_0015660 | Ga0495648_0015660_1947_2681 | 244 |
| 379 | 3300046526 | Ga0495666_0007678 | Ga0495666_0007678_3959_4693 | 244 |
| 380 | 3300046526 | Ga0495666_0011577 | Ga0495666_0011577_1519_2259 | 244 |
| 381 | 3300046529 | Ga0495652_0008645 | Ga0495652_0008645_1629_2363 | 244 |
| 382 | 3300046529 | Ga0495652_0162927 | Ga0495652_0162927_867_1607 | 244 |
| 383 | 3300046531 | Ga0495665_0007483 | Ga0495665_0007483_5094_5828 | 244 |
| 384 | 3300046533 | Ga0495640_0039687 | Ga0495640_0039687_417_1151 | 244 |
| 385 | 3300046533 | Ga0495640_0133563 | Ga0495640_0133563_601_1335 | 244 |
| 386 | 3300046535 | Ga0495586_0108428 | Ga0495586_0108428_142_876 | 244 |
| 387 | 3300046536 | Ga0495587_0002208 | Ga0495587_0002208_12168_12902 | 244 |
| 388 | 3300046542 | Ga0495597_0082090 | Ga0495597_0082090_393_1169 | 244 |
| 389 | 3300046543 | Ga0495645_0017306 | Ga0495645_0017306_2725_3459 | 244 |
| 390 | 3300046557 | Ga0495622_0005125 | Ga0495622_0005125_2652_3392 | 244 |
| 391 | 3300046559 | Ga0495667_0082116 | Ga0495667_0082116_295_1029 | 244 |
| 392 | 3300046615 | Ga0495656_0083826 | Ga0495656_0083826_631_1365 | 244 |
| 393 | 3300046616 | Ga0495668_0086279 | Ga0495668_0086279_42_782 | 244 |
| 394 | 3300046616 | Ga0495668_0139747 | Ga0495668_0139747_402_1142 | 244 |
| 395 | 3300046616 | Ga0495668_0224633 | Ga0495668_0224633_17_751 | 244 |
| 396 | 3300046642 | Ga0495634_0002799 | Ga0495634_0002799_1966_2700 | 244 |
| 397 | 3300046642 | Ga0495634_0015769 | Ga0495634_0015769_1764_2498 | 244 |
| 398 | 3300046642 | Ga0495634_0352747 | Ga0495634_0352747_18_758 | 244 |
| 399 | 3300046648 | Ga0495611_0243369 | Ga0495611_0243369_78_812 | 244 |
| 400 | 3300046660 | Ga0495625_0070173 | Ga0495625_0070173_1584_2318 | 244 |
| 401 | 3300046660 | Ga0495625_0131059 | Ga0495625_0131059_621_1355 | 244 |
| 402 | 3300046663 | Ga0495635_0018136 | Ga0495635_0018136_1923_2657 | 244 |
| 403 | 3300046663 | Ga0495635_0027949 | Ga0495635_0027949_2875_3615 | 244 |
| 404 | 3300046663 | Ga0495635_0028962 | Ga0495635_0028962_2442_3176 | 244 |
| 405 | 3300046664 | Ga0495659_0128384 | Ga0495659_0128384_62_796 | 244 |
| 406 | 3300046675 | Ga0495657_0003480 | Ga0495657_0003480_9692_10426 | 244 |
| 407 | 3300046675 | Ga0495657_0149755 | Ga0495657_0149755_672_1406 | 244 |
| 408 | 3300046678 | Ga0495599_0052346 | Ga0495599_0052346_884_1618 | 244 |
| 409 | 3300046678 | Ga0495599_0151737 | Ga0495599_0151737_513_1253 | 244 |
| 410 | 3300046680 | Ga0495646_0020602 | Ga0495646_0020602_23_757 | 244 |
| 411 | 3300046689 | Ga0495613_0000388 | Ga0495613_0000388_24185_24925 | 244 |
| 412 | 3300046689 | Ga0495613_0004110 | Ga0495613_0004110_4913_5647 | 244 |
| 413 | 3300046692 | Ga0495671_0007655 | Ga0495671_0007655_3449_4183 | 244 |
| 414 | 3300046694 | Ga0495649_0036301 | Ga0495649_0036301_1280_2020 | 244 |
| 415 | 3300046694 | Ga0495649_0068614 | Ga0495649_0068614_356_1096 | 244 |
| 416 | 3300046694 | Ga0495649_0070671 | Ga0495649_0070671_449_1183 | 244 |
| 417 | 3300046794 | Ga0495589_0015740 | Ga0495589_0015740_1818_2558 | 244 |
| 418 | 3300046794 | Ga0495589_0059236 | Ga0495589_0059236_1133_1867 | 244 |
| 419 | 3300046809 | Ga0495600_0010883 | Ga0495600_0010883_4462_5196 | 244 |
| 420 | 3300046809 | Ga0495600_0011870 | Ga0495600_0011870_387_1121 | 244 |
| 421 | 3300046810 | Ga0495660_0004309 | Ga0495660_0004309_2823_3563 | 244 |
| 422 | 3300046810 | Ga0495660_0142233 | Ga0495660_0142233_400_1134 | 244 |
| 423 | 3300047315 | Ga0495581_0069558 | Ga0495581_0069558_1268_2002 | 244 |
| 424 | 3300047317 | Ga0495604_0000545 | Ga0495604_0000545_1377_2111 | 244 |
| 425 | 3300047317 | Ga0495604_0005331 | Ga0495604_0005331_1688_2422 | 244 |
| 426 | 3300047317 | Ga0495604_0180506 | Ga0495604_0180506_574_1308 | 244 |
| 427 | 3300047317 | Ga0495604_0244205 | Ga0495604_0244205_268_1002 | 244 |
| 428 | 3300047318 | Ga0495636_0064025 | Ga0495636_0064025_632_1366 | 244 |
| 429 | 3300047319 | Ga0495674_0079786 | Ga0495674_0079786_770_1504 | 244 |
| 430 | 3300047320 | Ga0495672_0003747 | Ga0495672_0003747_7416_8150 | 244 |
| 431 | 3300047321 | Ga0495676_0000488 | Ga0495676_0000488_11266_12000 | 244 |
| 432 | 3300047321 | Ga0495676_0000537 | Ga0495676_0000537_29828_30562 | 244 |
| 433 | 3300047321 | Ga0495676_0051310 | Ga0495676_0051310_1779_2519 | 244 |
| 434 | 3300047321 | Ga0495676_0105662 | Ga0495676_0105662_538_1272 | 244 |
| 435 | 3300047323 | Ga0495683_0002011 | Ga0495683_0002011_6273_7013 | 244 |
| 436 | 3300047323 | Ga0495683_0092272 | Ga0495683_0092272_681_1415 | 244 |
| 437 | 3300047443 | Ga0495687_002019 | Ga0495687_002019_43_777 | 244 |
| 438 | 3300047443 | Ga0495687_015680 | Ga0495687_015680_2159_2899 | 244 |
| 439 | 3300047443 | Ga0495687_017402 | Ga0495687_017402_236_976 | 244 |
| 440 | 3300047443 | Ga0495687_047628 | Ga0495687_047628_158_898 | 244 |
| 441 | 3300047444 | Ga0495675_0044013 | Ga0495675_0044013_1783_2517 | 244 |
| 442 | 3300047445 | Ga0495677_0018742 | Ga0495677_0018742_954_1694 | 244 |
| 443 | 3300047447 | Ga0495685_004037 | Ga0495685_004037_863_1603 | 244 |
| 444 | 3300047447 | Ga0495685_006708 | Ga0495685_006708_128_862 | 244 |
| 445 | 3300047447 | Ga0495685_043554 | Ga0495685_043554_196_930 | 244 |
| 446 | 3300047469 | Ga0495673_0011418 | Ga0495673_0011418_3981_4715 | 244 |
| 447 | 3300047470 | Ga0495681_0002530 | Ga0495681_0002530_2184_2918 | 244 |
| 448 | 3300047470 | Ga0495681_0016827 | Ga0495681_0016827_3208_3942 | 244 |
| 449 | 3300047472 | Ga0495686_0063234 | Ga0495686_0063234_197_937 | 244 |
| 450 | 3300047472 | Ga0495686_0129789 | Ga0495686_0129789_373_1107 | 244 |
| 451 | 3300047673 | Ga0495593_0000258 | Ga0495593_0000258_15261_15995 | 244 |
| 452 | 3300048088 | Ga0495602_0075504 | Ga0495602_0075504_1485_2219 | 244 |
| 453 | 3300048089 | Ga0495614_0002843 | Ga0495614_0002843_3644_4378 | 244 |
| 454 | 3300048089 | Ga0495614_0005593 | Ga0495614_0005593_2834_3568 | 244 |
| 455 | 3300048089 | Ga0495614_0100204 | Ga0495614_0100204_436_1176 | 244 |
| 456 | 3300048903 | Ga0496100_0348756 | Ga0496100_0348756_38_772 | 244 |
| 457 | 3300048904 | Ga0496101_0000130 | Ga0496101_0000130_26665_27432 | 244 |
| 458 | 3300048904 | Ga0496101_0091574 | Ga0496101_0091574_1079_1813 | 244 |
| 459 | 3300048905 | Ga0496102_0000014 | Ga0496102_0000014_75792_76559 | 244 |
| 460 | 3300048905 | Ga0496102_0000716 | Ga0496102_0000716_14952_15686 | 244 |
| 461 | 3300048905 | Ga0496102_0284295 | Ga0496102_0284295_532_1266 | 244 |
| 462 | 3300048905 | Ga0496102_0523791 | Ga0496102_0523791_300_1034 | 244 |
| 463 | 3300048906 | Ga0496103_0000004 | Ga0496103_0000004_76298_77065 | 244 |
| 464 | 3300048906 | Ga0496103_0000767 | Ga0496103_0000767_6104_6838 | 244 |
| 465 | 3300048906 | Ga0496103_0148920 | Ga0496103_0148920_382_1116 | 244 |
| 466 | 3300048907 | Ga0496104_0133734 | Ga0496104_0133734_160_894 | 244 |
| 467 | 3300048907 | Ga0496104_0387593 | Ga0496104_0387593_284_1024 | 244 |
| 468 | 3300048908 | Ga0496105_0056792 | Ga0496105_0056792_682_1431 | 244 |
| 469 | 3300048909 | Ga0496106_0058828 | Ga0496106_0058828_1480_2229 | 244 |
| 470 | 3300048909 | Ga0496106_0640388 | Ga0496106_0640388_12_746 | 244 |
| 471 | 3300048909 | Ga0496106_0738621 | Ga0496106_0738621_23_757 | 244 |
| 472 | 3300048910 | Ga0496107_0019547 | Ga0496107_0019547_2089_2856 | 244 |
| 473 | 3300048910 | Ga0496107_0088217 | Ga0496107_0088217_962_1711 | 244 |
| 474 | 3300048911 | Ga0496108_0024849 | Ga0496108_0024849_2705_3454 | 244 |
| 475 | 3300048911 | Ga0496108_0140686 | Ga0496108_0140686_972_1706 | 244 |
| 476 | 3300048912 | Ga0496109_0092370 | Ga0496109_0092370_1254_2003 | 244 |
| 477 | 3300048912 | Ga0496109_0345965 | Ga0496109_0345965_218_958 | 244 |
| 478 | 3300048912 | Ga0496109_0372284 | Ga0496109_0372284_126_860 | 244 |
| 479 | 3300048912 | Ga0496109_0377733 | Ga0496109_0377733_182_940 | 244 |
| 480 | 3300048913 | Ga0496110_0162349 | Ga0496110_0162349_1234_1983 | 244 |
| 481 | 3300048914 | Ga0496111_0006478 | Ga0496111_0006478_682_1431 | 244 |
| 482 | 3300048914 | Ga0496111_0176789 | Ga0496111_0176789_213_953 | 244 |
| 483 | 3300048914 | Ga0496111_0246255 | Ga0496111_0246255_453_1187 | 244 |
| 484 | 3300048915 | Ga0496112_0005279 | Ga0496112_0005279_6467_7201 | 244 |
| 485 | 3300048915 | Ga0496112_0121764 | Ga0496112_0121764_52_801 | 244 |
| 486 | 3300048915 | Ga0496112_0158609 | Ga0496112_0158609_839_1573 | 244 |
| 487 | 3300048917 | Ga0496114_0119792 | Ga0496114_0119792_1417_2151 | 244 |
| 488 | 3300048918 | Ga0496115_0010369 | Ga0496115_0010369_3627_4367 | 244 |
| 489 | 3300048919 | Ga0496116_0000069 | Ga0496116_0000069_77249_78016 | 244 |
| 490 | 3300048919 | Ga0496116_0069768 | Ga0496116_0069768_57_791 | 244 |
| 491 | 3300048920 | Ga0496117_0000003 | Ga0496117_0000003_1274701_1275468 | 244 |
| 492 | 3300048920 | Ga0496117_0000687 | Ga0496117_0000687_4323_5057 | 244 |
| 493 | 3300048921 | Ga0496118_0000001 | Ga0496118_0000001_1274704_1275471 | 244 |
| 494 | 3300048921 | Ga0496118_0003018 | Ga0496118_0003018_3989_4723 | 244 |
| 495 | 3300048922 | Ga0496119_0000588 | Ga0496119_0000588_2485_3252 | 244 |
| 496 | 3300048922 | Ga0496119_0031696 | Ga0496119_0031696_1611_2345 | 244 |
| 497 | 3300048922 | Ga0496119_0038081 | Ga0496119_0038081_733_1467 | 244 |
| 498 | 3300048923 | Ga0496120_0000085 | Ga0496120_0000085_78672_79439 | 244 |
| 499 | 3300048923 | Ga0496120_0014771 | Ga0496120_0014771_2215_2949 | 244 |
| 500 | 3300048924 | Ga0496121_0000032 | Ga0496121_0000032_165083_165850 | 244 |
| 501 | 3300048924 | Ga0496121_0006420 | Ga0496121_0006420_13270_14004 | 244 |
| 502 | 3300048924 | Ga0496121_0058734 | Ga0496121_0058734_329_1078 | 244 |
| 503 | 3300048924 | Ga0496121_0120791 | Ga0496121_0120791_722_1456 | 244 |
| 504 | 3300048925 | Ga0496122_0000495 | Ga0496122_0000495_74205_74966 | 244 |
| 505 | 3300048927 | Ga0496124_0001784 | Ga0496124_0001784_4892_5626 | 244 |
| 506 | 3300048927 | Ga0496124_0096079 | Ga0496124_0096079_173_907 | 244 |
| 507 | 3300048928 | Ga0496125_0090825 | Ga0496125_0090825_716_1450 | 244 |
| 508 | 3300048929 | Ga0496126_0000006 | Ga0496126_0000006_719928_720662 | 244 |
| 509 | 3300048929 | Ga0496126_0000007 | Ga0496126_0000007_476026_476760 | 244 |
| 510 | 3300048929 | Ga0496126_0000067 | Ga0496126_0000067_235947_236714 | 244 |
| 511 | 3300048929 | Ga0496126_0044285 | Ga0496126_0044285_1420_2154 | 244 |
| 512 | 3300048929 | Ga0496126_0143568 | Ga0496126_0143568_316_1050 | 244 |
| 513 | 3300048929 | Ga0496126_0243130 | Ga0496126_0243130_429_1172 | 244 |
| 514 | 3300048929 | Ga0496126_0268072 | Ga0496126_0268072_598_1332 | 244 |
| 515 | 3300049459 | Ga0495678_070981 | Ga0495678_070981_213_989 | 244 |
| 516 | 3300049459 | Ga0495678_083088 | Ga0495678_083088_80_814 | 244 |
| 517 | 3300049568 | Ga0501031_0001335 | Ga0501031_0001335_10630_11364 | 244 |
| 518 | 3300049568 | Ga0501031_0017651 | Ga0501031_0017651_1650_2390 | 244 |
| 519 | 3300049568 | Ga0501031_0018173 | Ga0501031_0018173_3144_3878 | 244 |
| 520 | 3300049568 | Ga0501031_0105735 | Ga0501031_0105735_984_1733 | 244 |
| 521 | 3300049568 | Ga0501031_0113300 | Ga0501031_0113300_444_1178 | 244 |
| 522 | 3300049568 | Ga0501031_0126986 | Ga0501031_0126986_452_1186 | 244 |
| 523 | 3300049569 | Ga0501032_0003786 | Ga0501032_0003786_988_1722 | 244 |
| 524 | 3300049569 | Ga0501032_0005456 | Ga0501032_0005456_1697_2437 | 244 |
| 525 | 3300049569 | Ga0501032_0049802 | Ga0501032_0049802_1431_2165 | 244 |
| 526 | 3300049569 | Ga0501032_0070417 | Ga0501032_0070417_1264_1998 | 244 |
| 527 | 3300049569 | Ga0501032_0123993 | Ga0501032_0123993_633_1367 | 244 |
| 528 | 3300049570 | Ga0501033_0001264 | Ga0501033_0001264_20148_20888 | 244 |
| 529 | 3300049570 | Ga0501033_0006971 | Ga0501033_0006971_820_1554 | 244 |
| 530 | 3300049570 | Ga0501033_0044526 | Ga0501033_0044526_1585_2319 | 244 |
| 531 | 3300049570 | Ga0501033_0103818 | Ga0501033_0103818_500_1234 | 244 |
| 532 | 3300049570 | Ga0501033_0265387 | Ga0501033_0265387_220_954 | 244 |
| 533 | 3300049571 | Ga0501034_0005213 | Ga0501034_0005213_10646_11380 | 244 |
| 534 | 3300049571 | Ga0501034_0010784 | Ga0501034_0010784_7075_7815 | 244 |
| 535 | 3300049571 | Ga0501034_0012929 | Ga0501034_0012929_2691_3425 | 244 |
| 536 | 3300049571 | Ga0501034_0205101 | Ga0501034_0205101_656_1390 | 244 |
| 537 | 3300049571 | Ga0501034_0315739 | Ga0501034_0315739_61_810 | 244 |
| 538 | 3300049572 | Ga0501036_0006405 | Ga0501036_0006405_1651_2391 | 244 |
| 539 | 3300049572 | Ga0501036_0011299 | Ga0501036_0011299_5580_6314 | 244 |
| 540 | 3300049572 | Ga0501036_0017921 | Ga0501036_0017921_4593_5327 | 244 |
| 541 | 3300049572 | Ga0501036_0273334 | Ga0501036_0273334_214_948 | 244 |
| 542 | 3300049573 | Ga0501037_0005145 | Ga0501037_0005145_1673_2413 | 244 |
| 543 | 3300049573 | Ga0501037_0056835 | Ga0501037_0056835_190_924 | 244 |
| 544 | 3300049574 | Ga0501038_0007464 | Ga0501038_0007464_7418_8152 | 244 |
| 545 | 3300049574 | Ga0501038_0007801 | Ga0501038_0007801_7252_7992 | 244 |
| 546 | 3300049574 | Ga0501038_0103810 | Ga0501038_0103810_1533_2267 | 244 |
| 547 | 3300049575 | Ga0501039_0057593 | Ga0501039_0057593_642_1382 | 244 |
| 548 | 3300049575 | Ga0501039_0113780 | Ga0501039_0113780_1308_2063 | 244 |
| 549 | 3300049576 | Ga0501040_0145671 | Ga0501040_0145671_212_946 | 244 |
| 550 | 3300049576 | Ga0501040_0173011 | Ga0501040_0173011_82_822 | 244 |
| 551 | 3300049578 | Ga0501042_0001445 | Ga0501042_0001445_3075_3809 | 244 |
| 552 | 3300049578 | Ga0501042_0026449 | Ga0501042_0026449_2940_3674 | 244 |
| 553 | 3300049579 | Ga0501043_0006022 | Ga0501043_0006022_7141_7881 | 244 |
| 554 | 3300049579 | Ga0501043_0007957 | Ga0501043_0007957_839_1573 | 244 |
| 555 | 3300049579 | Ga0501043_0067766 | Ga0501043_0067766_1703_2437 | 244 |
| 556 | 3300049579 | Ga0501043_0084665 | Ga0501043_0084665_1212_1946 | 244 |
| 557 | 3300049579 | Ga0501043_0134259 | Ga0501043_0134259_140_946 | 244 |
| 558 | 3300049579 | Ga0501043_0287764 | Ga0501043_0287764_424_1158 | 244 |
| 559 | 3300049580 | Ga0501046_0007551 | Ga0501046_0007551_1838_2578 | 244 |
| 560 | 3300049580 | Ga0501046_0037499 | Ga0501046_0037499_1678_2412 | 244 |
| 561 | 3300049581 | Ga0501047_0000575 | Ga0501047_0000575_36495_37235 | 244 |
| 562 | 3300049581 | Ga0501047_0002966 | Ga0501047_0002966_10920_11654 | 244 |
| 563 | 3300049581 | Ga0501047_0003526 | Ga0501047_0003526_3379_4113 | 244 |
| 564 | 3300049581 | Ga0501047_0013474 | Ga0501047_0013474_2777_3511 | 244 |
| 565 | 3300049581 | Ga0501047_0111883 | Ga0501047_0111883_465_1199 | 244 |
| 566 | 3300049581 | Ga0501047_0180172 | Ga0501047_0180172_227_961 | 244 |
| 567 | 3300049581 | Ga0501047_0236047 | Ga0501047_0236047_323_1072 | 244 |
| 568 | 3300049582 | Ga0501048_0003067 | Ga0501048_0003067_1678_2412 | 244 |
| 569 | 3300049582 | Ga0501048_0005624 | Ga0501048_0005624_1693_2433 | 244 |
| 570 | 3300049582 | Ga0501048_0031140 | Ga0501048_0031140_987_1721 | 244 |
| 571 | 3300049586 | Ga0501070_0007297 | Ga0501070_0007297_6969_7709 | 244 |
| 572 | 3300049586 | Ga0501070_0061016 | Ga0501070_0061016_1918_2652 | 244 |
| 573 | 3300049587 | Ga0501071_0519030 | Ga0501071_0519030_165_899 | 244 |
| 574 | 3300049589 | Ga0501073_0005674 | Ga0501073_0005674_6927_7667 | 244 |
| 575 | 3300049589 | Ga0501073_0029923 | Ga0501073_0029923_1554_2288 | 244 |
| 576 | 3300049589 | Ga0501073_0176902 | Ga0501073_0176902_391_1125 | 244 |
| 577 | 3300049590 | Ga0501074_0033129 | Ga0501074_0033129_2991_3725 | 244 |
| 578 | 3300049590 | Ga0501074_0073364 | Ga0501074_0073364_72_812 | 244 |
| 579 | 3300049741 | Ga0501079_0059947 | Ga0501079_0059947_1726_2466 | 244 |
| 580 | 3300049742 | Ga0501080_0082989 | Ga0501080_0082989_1571_2311 | 244 |
| 581 | 3300049742 | Ga0501080_0184073 | Ga0501080_0184073_647_1381 | 244 |
| 582 | 3300049744 | Ga0501083_0005021 | Ga0501083_0005021_6952_7692 | 244 |
| 583 | 3300049744 | Ga0501083_0043593 | Ga0501083_0043593_119_853 | 244 |
| 584 | 3300049822 | Ga0501035_0000248 | Ga0501035_0000248_1731_2471 | 244 |
| 585 | 3300049822 | Ga0501035_0003898 | Ga0501035_0003898_10619_11353 | 244 |
| 586 | 3300049822 | Ga0501035_0101308 | Ga0501035_0101308_35_775 | 244 |
| 587 | 3300049822 | Ga0501035_0251519 | Ga0501035_0251519_449_1183 | 244 |
| 588 | 3300049823 | Ga0501044_0003376 | Ga0501044_0003376_1731_2471 | 244 |
| 589 | 3300049823 | Ga0501044_0004950 | Ga0501044_0004950_3520_4254 | 244 |
| 590 | 3300049823 | Ga0501044_0018070 | Ga0501044_0018070_1019_1753 | 244 |
| 591 | 3300049823 | Ga0501044_0259717 | Ga0501044_0259717_78_812 | 244 |
| 592 | 3300049823 | Ga0501044_0445345 | Ga0501044_0445345_441_1175 | 244 |
| 593 | 3300049823 | Ga0501044_0605383 | Ga0501044_0605383_170_904 | 244 |
| 594 | 3300049824 | Ga0501045_0291370 | Ga0501045_0291370_412_1152 | 244 |
| 595 | 3300050490 | nmdc:mga03n38_1856_c2 | nmdc:mga03n38_1856_c2_3673_4407 | 244 |
| 596 | 3300050490 | nmdc:mga03n38_48390_c1 | nmdc:mga03n38_48390_c1_94_828 | 244 |
| 597 | 3300050491 | nmdc:mga00v17_7166_c1 | nmdc:mga00v17_7166_c1_537_1271 | 244 |
| 598 | 3300050492 | nmdc:mga0yw44_5415_c1 | nmdc:mga0yw44_5415_c1_2604_3344 | 244 |
| 599 | 3300050494 | nmdc:mga06z11_420152_c1 | nmdc:mga06z11_420152_c1_51_791 | 244 |
| 600 | 3300050496 | nmdc:mga07m45_2025_c1 | nmdc:mga07m45_2025_c1_441_1175 | 244 |
| 601 | 3300050511 | nmdc:mga08y16_745885_c1 | nmdc:mga08y16_745885_c1_225_965 | 244 |
| 602 | 3300050516 | nmdc:mga0sz30_167564_c1 | nmdc:mga0sz30_167564_c1_161_895 | 244 |
| 603 | 3300050516 | nmdc:mga0sz30_91566_c1 | nmdc:mga0sz30_91566_c1_256_990 | 244 |
| 604 | 3300053077 | Ga0495601_0000519 | Ga0495601_0000519_15596_16336 | 244 |
| 605 | 3300053080 | Ga0500635_0004864 | Ga0500635_0004864_80_823 | 244 |
| 606 | 3300053085 | Ga0495619_0044864 | Ga0495619_0044864_623_1357 | 244 |
| 607 | 3300053086 | Ga0500578_0062317 | Ga0500578_0062317_58_792 | 244 |
| 608 | 3300053086 | Ga0500578_0227007 | Ga0500578_0227007_342_1082 | 244 |
| 609 | 3300053088 | Ga0500644_0102111 | Ga0500644_0102111_144_878 | 244 |
| 610 | 3300053092 | Ga0500583_0101740 | Ga0500583_0101740_47_781 | 244 |
| 611 | 3300053095 | Ga0500640_007318 | Ga0500640_007318_2344_3078 | 244 |
| 612 | 3300053098 | Ga0500650_0234462 | Ga0500650_0234462_22_762 | 244 |
| 613 | 3300053099 | Ga0500654_046623 | Ga0500654_046623_523_1257 | 244 |
| 614 | 3300053100 | Ga0500660_107726 | Ga0500660_107726_170_904 | 244 |
| 615 | 3300053101 | Ga0500553_030046 | Ga0500553_030046_840_1574 | 244 |
| 616 | 3300053107 | Ga0500560_004220 | Ga0500560_004220_2268_3002 | 244 |
| 617 | 3300053109 | Ga0500569_012505 | Ga0500569_012505_559_1293 | 244 |
| 618 | 3300053111 | Ga0500572_007340 | Ga0500572_007340_1231_1965 | 244 |
| 619 | 3300053118 | Ga0500594_0091823 | Ga0500594_0091823_20_754 | 244 |
| 620 | 3300053122 | Ga0500608_096599 | Ga0500608_096599_311_1045 | 244 |
| 621 | 3300053123 | Ga0500614_047212 | Ga0500614_047212_113_847 | 244 |
| 622 | 3300053129 | Ga0500628_004523 | Ga0500628_004523_758_1492 | 244 |
| 623 | 3300053131 | Ga0500652_000402 | Ga0500652_000402_13245_13988 | 244 |
| 624 | 3300053134 | Ga0500658_0037842 | Ga0500658_0037842_524_1258 | 244 |
| 625 | 3300053136 | Ga0500559_0000719 | Ga0500559_0000719_2601_3335 | 244 |
| 626 | 3300053137 | Ga0500561_0013747 | Ga0500561_0013747_916_1650 | 244 |
| 627 | 3300053139 | Ga0500568_0000579 | Ga0500568_0000579_4251_5003 | 244 |
| 628 | 3300053143 | Ga0500579_048915 | Ga0500579_048915_1707_2441 | 244 |
| 629 | 3300053149 | Ga0500600_0029597 | Ga0500600_0029597_1647_2381 | 244 |
| 630 | 3300053149 | Ga0500600_0151971 | Ga0500600_0151971_308_1048 | 244 |
| 631 | 3300053153 | Ga0500616_0000483 | Ga0500616_0000483_42095_42847 | 244 |
| 632 | 3300053153 | Ga0500616_0002364 | Ga0500616_0002364_6523_7257 | 244 |
| 633 | 3300053153 | Ga0500616_0035701 | Ga0500616_0035701_311_1045 | 244 |
| 634 | 3300053160 | Ga0500633_0020650 | Ga0500633_0020650_450_1184 | 244 |
| 635 | 3300053177 | Ga0500636_0208114 | Ga0500636_0208114_222_956 | 244 |
| 636 | 3300053730 | Ga0500645_000017 | Ga0500645_000017_49686_50429 | 244 |
| 637 | 3300053730 | Ga0500645_000017 | Ga0500645_000017_51252_51986 | 244 |
| 638 | 3300053732 | Ga0500656_000122 | Ga0500656_000122_458_1192 | 244 |
| 639 | 3300053736 | Ga0500599_008279 | Ga0500599_008279_48_788 | 244 |
| 640 | 3300053739 | Ga0500587_002769 | Ga0500587_002769_558_1292 | 244 |
| 641 | 3300054114 | Ga0501084_0422920 | Ga0501084_0422920_144_899 | 244 |
| 642 | 3300060353 | Ga0501082_0029555 | Ga0501082_0029555_2142_2882 | 244 |
| 643 | iso_pu_bacteria | 2870721527 | 2870725419 | 244 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4bmn-assembly1.cif.gz_B | apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 | 0.9824 | 4 | 243 |
| 4i5d-assembly1.cif.gz_A | crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form | 0.9789 | 1 | 243 |
| 4i5f-assembly1.cif.gz_A | crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s | 0.9787 | 1 | 243 |
| 6ihi-assembly1.cif.gz_B | crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o | 0.9776 | 3 | 243 |
| 4bmn-assembly1.cif.gz_D | apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 | 0.976 | 3 | 243 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4bmnA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9655 | 3 | 243 | 3.40.50.720 |
| 3rihC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9571 | 3 | 241 | 3.40.50.720 |
| af_Q0JBH4_12_100_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9532 | 7 | 84 | 3.40.50.720 |
| af_I1LJY0_35_302_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9526 | 4 | 242 | 3.40.50.720 |
| af_I6YCF0_1_258_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9499 | 1 | 235 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A832MUH5-F1-model_v4 | SDR family oxidoreductase | 0.9832 | 1 | 184 |
GO:0016491
|
| AF-A0A7Y3J8K4-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9781 | 3 | 185 |
GO:0016491
|
| AF-A0A328AS06-F1-model_v4 | Oxidoreductase | 0.9627 | 3 | 243 |
GO:0006633
GO:0016616 GO:0048038 |
| AF-A0A4R7MS84-F1-model_v4 | NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) | 0.9605 | 2 | 243 |
GO:0006633
GO:0016616 GO:0048038 |
| AF-A0A2U1T022-F1-model_v4 | Short-chain dehydrogenase | 0.9601 | 2 | 243 |
GO:0016616
GO:0030497 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar