F471963

General Info

Members Datasets Scaffolds Average Seq Length
643 356 605 243

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10168115|Ga0307405_101681152
Length 273
Sequence LRPGRIFLYVTYTDPFTYERMSITGNGVIVGKLDGKVAVITGGSTGLALAGAKLFVDEGAYVFIQARRQEALDDAVKLIGRNVTAVQGDAAELDDLDRLFDTVKREKGSIDVLWASAGMGEPAVLGEITEEQFHRAFSLNARGTLFTVQKALPLINDNGSILMTGSNASLGAFPGWSLYAGSKAVQQAWARVWLNELRDRRIRVNVLTPGQVATAKQQELFDEATRSAFESLIPRGEMGRPEEIASIALFLASDDSSYVNGLELVADGGTTAL

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2517572101 Frankia sp. DC12 Isolate Nodule
3 2558860280 Kutzneria sp. 744 Isolate Unclassified
4 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
5 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
6 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
7 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
8 2643221607 Rhizobium sp. Root73 Isolate Unclassified
9 2643221647 Streptomyces sp. Root369 Isolate Unclassified
10 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
11 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
12 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
13 2687453737 Frankia sp. BMG5.36 Isolate Nodule
14 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
15 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
16 2738541293 Rhizobium sp. GV031 Isolate Unclassified
17 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
18 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
19 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
20 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
21 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
22 2862574272 Streptomyces sp. AcE210 Isolate Nodule
23 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
24 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
25 2919085039 Luteibacter sp. 1214 Isolate Unclassified
26 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
27 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
28 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
29 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
30 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
31 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
32 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
33 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
34 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
35 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
36 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
37 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
38 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
39 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
148 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
149 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
150 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
153 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
154 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
158 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
159 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
160 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
166 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
181 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
182 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
187 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
201 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
202 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
203 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
204 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
205 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
208 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
209 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
210 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
211 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
212 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
213 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
227 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
235 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
236 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
246 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
247 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
248 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
249 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
250 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
251 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
252 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
253 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
254 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
255 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
271 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
272 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
273 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
274 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
275 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
276 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
277 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
278 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
279 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
280 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
281 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
282 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
297 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
298 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
299 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
300 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
301 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
302 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
303 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
306 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
307 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
308 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
309 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
310 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
311 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
312 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
313 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
314 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
315 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
316 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
317 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
318 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
319 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
320 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
321 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
322 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
323 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
324 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
325 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
326 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
327 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
328 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
329 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
330 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
331 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
332 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
333 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
334 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
335 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
336 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
337 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
338 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
339 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
340 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
341 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
342 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
343 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
344 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
345 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
346 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
347 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
348 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
349 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
350 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
351 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
352 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
353 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
354 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
355 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
356 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.16
Metatranscriptomes 1.09
Isolates 5.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.95
Nodule 1.71
Rhizoplane 6.22
Rhizosphere 69.36
Stem 0
Stem Tuber 0
Unclassified 12.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10002752 3300001989 Bacteria 6762
2 JGI24737J22298_10027289 3300001990 Bacteria 1801
3 JGI24751J29686_10015835 3300002459 Bacteria 1555
4 JGI25151J46595_10098038 3300003187 Unclassified 797
5 rootH1_10079142 3300003316 Bacteria 7746
6 rootH2_10230140 3300003320 Unclassified 2291
7 rootH2_10267319 3300003320 Bacteria 1517
8 rootH1_10071420 3300003323 Bacteria 3528
9 rootH1_10165931 3300003323 Unclassified 3845
10 rootH1_10286776 3300003323 Bacteria 3651
11 Ga0007416J51690_1009241 3300003577 Bacteria 813
12 Ga0007411J51799_106219 3300003611 Bacteria 825
13 Ga0055542_1000439 3300003762 Bacteria 39835
14 Ga0065714_10030916 3300005288 Bacteria 1356
15 Ga0070683_100326623 3300005329 Bacteria 1460
16 Ga0070666_10010743 3300005335 Bacteria 5729
17 Ga0070671_100000949 3300005355 Bacteria 21211
18 Ga0070674_100409687 3300005356 Bacteria 1110
19 Ga0070667_100000308 3300005367 Bacteria 54638
20 Ga0070714_100019981 3300005435 Bacteria 5465
21 Ga0070714_100054094 3300005435 Bacteria 3429
22 Ga0070714_100063694 3300005435 Bacteria 3171
23 Ga0070714_100339925 3300005435 Bacteria 1408
24 Ga0070714_100497129 3300005435 Bacteria 1163
25 Ga0070713_100128517 3300005436 Bacteria 2232
26 Ga0070713_100576844 3300005436 Bacteria 1067
27 Ga0070710_10288389 3300005437 Bacteria 1067
28 Ga0070711_100111142 3300005439 Bacteria 2012
29 Ga0070700_100328262 3300005441 Bacteria 1127
30 Ga0070663_100118299 3300005455 Bacteria 1999
31 Ga0070663_100189552 3300005455 Bacteria 1599
32 Ga0070678_100516959 3300005456 Bacteria 1056
33 Ga0070679_100005317 3300005530 Bacteria 11917
34 Ga0070679_100136007 3300005530 Bacteria 2439
35 Ga0070679_100554525 3300005530 Bacteria 1093
36 Ga0070665_100108097 3300005548 Bacteria 2784
37 Ga0070665_100179527 3300005548 Bacteria 2118
38 Ga0068855_100042178 3300005563 Bacteria 5406
39 Ga0068855_100669726 3300005563 Bacteria 1113
40 Ga0070664_100136957 3300005564 Bacteria 2153
41 Ga0068856_100525393 3300005614 Bacteria 1205
42 Ga0068852_100050125 3300005616 Bacteria 3575
43 Ga0068852_100101469 3300005616 Bacteria 2598
44 Ga0068859_100006027 3300005617 Bacteria 12313
45 Ga0068864_100320816 3300005618 Bacteria 1455
46 Ga0068858_100002726 3300005842 Bacteria 17777
47 Ga0068860_100000155 3300005843 Bacteria 111737
48 Ga0068862_100000096 3300005844 Bacteria 104906
49 Ga0081540_1022853 3300005983 Bacteria 3680
50 Ga0070717_10136297 3300006028 Unclassified 2114
51 Ga0075365_10012747 3300006038 Bacteria 5004
52 Ga0075365_10032306 3300006038 Bacteria 3363
53 Ga0075363_100058089 3300006048 Bacteria 2077
54 Ga0075364_10037286 3300006051 Bacteria 3147
55 Ga0070716_100035357 3300006173 Bacteria 2746
56 Ga0070712_100033901 3300006175 Bacteria 3457
57 Ga0070712_100178141 3300006175 Bacteria 1654
58 Ga0075362_10013512 3300006177 Bacteria 3270
59 Ga0075369_10089581 3300006186 Bacteria 1372
60 Ga0075370_10014473 3300006353 Bacteria 4209
61 Ga0075434_100918859 3300006871 Bacteria 890
62 Ga0097620_100006027 3300006931 Bacteria 12313
63 Ga0099826_10268791 3300006948 Bacteria 888
64 Ga0099795_10010741 3300007788 Bacteria 2709
65 Ga0099795_10094914 3300007788 Bacteria 1161
66 Ga0105240_10201565 3300009093 Bacteria 2331
67 Ga0105240_10743114 3300009093 Bacteria 1067
68 Ga0105240_10780583 3300009093 Bacteria 1036
69 Ga0105245_10590819 3300009098 Bacteria 1136
70 Ga0105247_10000040 3300009101 Bacteria 158975
71 Ga0105241_10313280 3300009174 Bacteria 1351
72 Ga0105241_10406454 3300009174 Bacteria 1195
73 Ga0105248_10000095 3300009177 Bacteria 98093
74 Ga0105248_10137550 3300009177 Bacteria 2756
75 Ga0105248_10963290 3300009177 Bacteria 964
76 Ga0105237_10148880 3300009545 Bacteria 2336
77 Ga0105237_10232907 3300009545 Bacteria 1843
78 Ga0105237_10728712 3300009545 Bacteria 998
79 Ga0105238_10151181 3300009551 Bacteria 2297
80 Ga0105238_10152586 3300009551 Bacteria 2285
81 Ga0105238_10283619 3300009551 Bacteria 1638
82 Ga0105238_10714340 3300009551 Bacteria 1015
83 Ga0105249_10000069 3300009553 Bacteria 148118
84 Ga0099796_10066653 3300010159 Bacteria 1290
85 Ga0105239_10181186 3300010375 Bacteria 2357
86 Ga0105239_10363307 3300010375 Bacteria 1635
87 Ga0105239_10578964 3300010375 Bacteria 1280
88 Ga0105246_10033294 3300011119 Bacteria 3424
89 Ga0157342_1014844 3300012507 Bacteria 847
90 Ga0157370_10000317 3300013104 Bacteria 60594
91 Ga0157370_10026255 3300013104 Bacteria 5754
92 Ga0157370_10157873 3300013104 Bacteria 2110
93 Ga0157369_10407593 3300013105 Bacteria 1410
94 Ga0157369_10409534 3300013105 Bacteria 1406
95 Ga0157374_10278718 3300013296 Bacteria 1650
96 Ga0163162_10105490 3300013306 Bacteria 2913
97 Ga0163162_10170835 3300013306 Bacteria 2299
98 Ga0163162_10181355 3300013306 Bacteria 2232
99 Ga0157375_10077352 3300013308 Bacteria 3357
100 Ga0157375_10240458 3300013308 Bacteria 1970
101 Ga0163163_10014016 3300014325 Bacteria 7355
102 Ga0163163_10580939 3300014325 Bacteria 1184
103 Ga0157380_10835954 3300014326 Bacteria 941
104 Ga0157379_10025856 3300014968 Bacteria 5219
105 Ga0182005_1000004 3300015265 Bacteria 609645
106 Ga0206356_11243581 3300020070 Bacteria 861
107 Ga0206353_11300916 3300020082 Bacteria 818
108 Ga0224712_10193976 3300022467 Bacteria 921
109 Ga0209233_1008225 3300025261 Bacteria 3241
110 Ga0209025_1001389 3300025294 Bacteria 32297
111 Ga0207655_1032430 3300025728 Bacteria 2387
112 Ga0207692_10050411 3300025898 Bacteria 2105
113 Ga0207642_10320638 3300025899 Bacteria 905
114 Ga0207710_10000050 3300025900 Bacteria 186453
115 Ga0207688_10136566 3300025901 Bacteria 1440
116 Ga0207647_10025551 3300025904 Bacteria 3878
117 Ga0207647_10033454 3300025904 Bacteria 3292
118 Ga0207647_10124806 3300025904 Bacteria 1516
119 Ga0207699_10059943 3300025906 Bacteria 2283
120 Ga0207699_10499563 3300025906 Bacteria 878
121 Ga0207645_10113300 3300025907 Bacteria 1757
122 Ga0207705_10338020 3300025909 Bacteria 1159
123 Ga0207654_10002481 3300025911 Bacteria 9375
124 Ga0207707_10123483 3300025912 Bacteria 2264
125 Ga0207695_10014892 3300025913 Bacteria 9179
126 Ga0207671_10001125 3300025914 Bacteria 32185
127 Ga0207671_10122616 3300025914 Bacteria 1987
128 Ga0207671_10265473 3300025914 Bacteria 1351
129 Ga0207671_10594749 3300025914 Bacteria 882
130 Ga0207693_10043227 3300025915 Bacteria 3546
131 Ga0207693_10295167 3300025915 Bacteria 1270
132 Ga0207693_10533809 3300025915 Bacteria 915
133 Ga0207663_10077835 3300025916 Bacteria 2160
134 Ga0207663_10081704 3300025916 Bacteria 2117
135 Ga0207660_10580727 3300025917 Bacteria 912
136 Ga0207657_10606321 3300025919 Bacteria 854
137 Ga0207652_10067625 3300025921 Bacteria 3098
138 Ga0207652_10512592 3300025921 Bacteria 1079
139 Ga0207681_10002841 3300025923 Bacteria 10957
140 Ga0207694_10101413 3300025924 Bacteria 2281
141 Ga0207694_10288478 3300025924 Bacteria 1349
142 Ga0207650_10091927 3300025925 Bacteria 2320
143 Ga0207687_10069301 3300025927 Bacteria 2515
144 Ga0207687_10120347 3300025927 Bacteria 1962
145 Ga0207700_10280462 3300025928 Bacteria 1433
146 Ga0207664_10002394 3300025929 Bacteria 12407
147 Ga0207664_10022536 3300025929 Bacteria 4706
148 Ga0207664_10108015 3300025929 Bacteria 2310
149 Ga0207664_10190169 3300025929 Bacteria 1767
150 Ga0207664_10321894 3300025929 Bacteria 1365
151 Ga0207644_10089307 3300025931 Bacteria 2293
152 Ga0207709_10560423 3300025935 Bacteria 900
153 Ga0207665_10051276 3300025939 Bacteria 2776
154 Ga0207691_10080042 3300025940 Bacteria 2940
155 Ga0207691_10107009 3300025940 Bacteria 2490
156 Ga0207711_10000082 3300025941 Bacteria 102386
157 Ga0207689_10218716 3300025942 Bacteria 1574
158 Ga0207661_10477584 3300025944 Bacteria 1138
159 Ga0207679_10144966 3300025945 Bacteria 1925
160 Ga0207679_10608861 3300025945 Bacteria 985
161 Ga0207712_10000084 3300025961 Bacteria 107789
162 Ga0207640_10111051 3300025981 Bacteria 1943
163 Ga0207658_10000868 3300025986 Bacteria 25220
164 Ga0207703_11038697 3300026035 Bacteria 787
165 Ga0207678_10018048 3300026067 Bacteria 6199
166 Ga0207678_10195735 3300026067 Bacteria 1728
167 Ga0207678_10413101 3300026067 Bacteria 1170
168 Ga0207676_10513251 3300026095 Bacteria 1140
169 Ga0207674_10405816 3300026116 Bacteria 1317
170 Ga0207683_10121955 3300026121 Bacteria 2341
171 Ga0207698_10073403 3300026142 Bacteria 2724
172 Ga0268266_10059382 3300028379 Bacteria 3295
173 Ga0268266_10464642 3300028379 Bacteria 1204
174 Ga0268265_10000106 3300028380 Bacteria 104924
175 Ga0268264_10000219 3300028381 Bacteria 111751
176 Ga0268264_10700813 3300028381 Bacteria 1006
177 Ga0265319_1017014 3300028563 Bacteria 2776
178 Ga0265336_10005155 3300028666 Bacteria 4856
179 Ga0265336_10045147 3300028666 Bacteria 1340
180 Ga0265336_10049927 3300028666 Bacteria 1266
181 Ga0307517_10044770 3300028786 Bacteria 4670
182 Ga0307517_10113193 3300028786 Bacteria 2049
183 Ga0307515_10000846 3300028794 Bacteria 70343
184 Ga0307515_10049581 3300028794 Bacteria 6311
185 Ga0307515_10061669 3300028794 Bacteria 5313
186 Ga0265338_10003900 3300028800 Bacteria 20610
187 Ga0265338_10017188 3300028800 Bacteria 7813
188 Ga0265338_10021357 3300028800 Bacteria 6755
189 Ga0265338_10042925 3300028800 Bacteria 4203
190 Ga0265338_10107746 3300028800 Bacteria 2252
191 Ga0307511_10003090 3300030521 Bacteria 17155
192 Ga0307511_10141165 3300030521 Bacteria 1415
193 Ga0307512_10004311 3300030522 Bacteria 15692
194 Ga0307512_10007896 3300030522 Bacteria 10457
195 Ga0265760_10076694 3300031090 Bacteria 1031
196 Ga0265330_10027609 3300031235 Bacteria 2564
197 Ga0307513_10001603 3300031456 Bacteria 32478
198 Ga0307513_10069471 3300031456 Bacteria 3686
199 Ga0307513_10331367 3300031456 Bacteria 1276
200 Ga0307509_10013229 3300031507 Bacteria 9791
201 Ga0307509_10023765 3300031507 Bacteria 6872
202 Ga0307509_10093453 3300031507 Bacteria 3069
203 Ga0307508_10001782 3300031616 Bacteria 23942
204 Ga0307508_10009013 3300031616 Bacteria 9193
205 Ga0307508_10139501 3300031616 Bacteria 2028
206 Ga0307508_10156550 3300031616 Bacteria 1882
207 Ga0307508_10352832 3300031616 Bacteria 1062
208 Ga0307514_10023311 3300031649 Bacteria 5022
209 Ga0307516_10051225 3300031730 Bacteria 4047
210 Ga0307405_10168115 3300031731 Bacteria 1561
211 Ga0307507_10001954 3300033179 Bacteria 44758
212 Ga0307507_10027336 3300033179 Bacteria 6119
213 Ga0307507_10036156 3300033179 Bacteria 5055
214 Ga0307507_10053550 3300033179 Bacteria 3854
215 Ga0307510_10004939 3300033180 Bacteria 15782
216 Ga0307510_10049355 3300033180 Bacteria 4477
217 Ga0307510_10152891 3300033180 Bacteria 1922
218 Ga0373934_0096245 3300035086 Bacteria 1195
219 Ga0373951_0000086 3300035091 Bacteria 36308
220 Ga0373923_0201848 3300035111 Bacteria 919
221 Ga0373936_0005116 3300035113 Bacteria 4936
222 Ga0373954_0017921 3300035118 Bacteria 3185
223 Ga0373957_0085805 3300035120 Bacteria 1246
224 Ga0373924_0043622 3300035410 Bacteria 1842
225 Ga0373931_0083630 3300035691 Bacteria 1766
226 Ga0373935_0539601 3300035692 Bacteria 849
227 Ga0373947_0472048 3300035725 Bacteria 851
228 Ga0373937_0814442 3300036401 Bacteria 882
229 Ga0372808_005661 3300036459 Bacteria 1656
230 Ga0373925_0000101 3300037068 Bacteria 92997
231 Ga0373925_0016708 3300037068 Bacteria 5314
232 Ga0373925_0026933 3300037068 Bacteria 4208
233 Ga0373925_0320429 3300037068 Bacteria 1254
234 Ga0395900_0308999 3300037418 Bacteria 1565
235 Ga0395905_0556059 3300037471 Bacteria 1049
236 Ga0436361_0991054 3300039447 Bacteria 1543
237 Ga0451793_0467648 3300041452 Bacteria 850
238 Ga0451807_1482729 3300041486 Bacteria 855
239 Ga0451843_0099427 3300041509 Bacteria 1008
240 Ga0451853_0325620 3300041512 Bacteria 7501
241 Ga0466968_0070735 3300044735 Bacteria 1519
242 Ga0466960_0220887 3300044901 Bacteria 1043
243 Ga0495617_060796 3300046452 Bacteria 1250
244 Ga0495627_012618 3300046453 Bacteria 2993
245 Ga0495592_0009428 3300046454 Bacteria 7339
246 Ga0495592_0078488 3300046454 Bacteria 2391
247 Ga0495592_0204218 3300046454 Bacteria 1331
248 Ga0495603_0012178 3300046455 Bacteria 5208
249 Ga0495603_0018918 3300046455 Bacteria 4168
250 Ga0495603_0030542 3300046455 Bacteria 3244
251 Ga0495629_0011173 3300046459 Bacteria 6519
252 Ga0495629_0018578 3300046459 Bacteria 4972
253 Ga0495629_0038123 3300046459 Bacteria 3386
254 Ga0495629_0199901 3300046459 Bacteria 1382
255 Ga0495638_0023029 3300046460 Bacteria 4080
256 Ga0495638_0090222 3300046460 Bacteria 1848
257 Ga0495638_0122447 3300046460 Bacteria 1535
258 Ga0495651_0001042 3300046462 Bacteria 21445
259 Ga0495651_0161204 3300046462 Bacteria 1606
260 Ga0495651_0305234 3300046462 Bacteria 1066
261 Ga0495580_0234560 3300046472 Bacteria 1259
262 Ga0495605_0052376 3300046474 Bacteria 1983
263 Ga0495639_0239535 3300046475 Bacteria 895
264 Ga0495662_0009485 3300046476 Bacteria 4775
265 Ga0495662_0082663 3300046476 Bacteria 1563
266 Ga0495664_0000287 3300046477 Bacteria 24123
267 Ga0495664_0015673 3300046477 Bacteria 4311
268 Ga0495664_0294054 3300046477 Bacteria 981
269 Ga0495584_0061044 3300046491 Bacteria 1895
270 Ga0495594_0018231 3300046499 Bacteria 3716
271 Ga0495594_0058148 3300046499 Bacteria 2135
272 Ga0495594_0249448 3300046499 Bacteria 1011
273 Ga0495596_0034238 3300046500 Bacteria 2018
274 Ga0495607_0000003 3300046501 Bacteria 366900
275 Ga0495607_0006428 3300046501 Bacteria 8275
276 Ga0495583_0052521 3300046506 Bacteria 1853
277 Ga0495606_0013143 3300046507 Bacteria 6571
278 Ga0495606_0158149 3300046507 Bacteria 1324
279 Ga0495610_0003962 3300046512 Bacteria 11204
280 Ga0495610_0048209 3300046512 Bacteria 2092
281 Ga0495620_0010680 3300046515 Bacteria 4833
282 Ga0495620_0042467 3300046515 Bacteria 1986
283 Ga0495628_0078892 3300046516 Bacteria 2560
284 Ga0495628_0083641 3300046516 Bacteria 2477
285 Ga0495628_0118907 3300046516 Bacteria 2028
286 Ga0495631_0013587 3300046518 Bacteria 3948
287 Ga0495632_0000011 3300046519 Bacteria 266804
288 Ga0495632_0045284 3300046519 Bacteria 2192
289 Ga0495637_0142884 3300046520 Bacteria 907
290 Ga0495643_0064488 3300046522 Bacteria 1935
291 Ga0495644_0084886 3300046523 Bacteria 1194
292 Ga0495648_0015660 3300046524 Bacteria 5492
293 Ga0495648_0021550 3300046524 Bacteria 4459
294 Ga0495666_0007678 3300046526 Bacteria 5396
295 Ga0495666_0011577 3300046526 Bacteria 4397
296 Ga0495652_0008645 3300046529 Bacteria 9279
297 Ga0495652_0162927 3300046529 Bacteria 1729
298 Ga0495665_0007483 3300046531 Bacteria 5909
299 Ga0495640_0039687 3300046533 Bacteria 3301
300 Ga0495640_0085391 3300046533 Bacteria 2092
301 Ga0495640_0133563 3300046533 Bacteria 1604
302 Ga0495586_0108428 3300046535 Bacteria 1544
303 Ga0495587_0002208 3300046536 Bacteria 13009
304 Ga0495597_0082090 3300046542 Bacteria 1377
305 Ga0495645_0017306 3300046543 Bacteria 5162
306 Ga0495622_0005125 3300046557 Bacteria 6071
307 Ga0495667_0082116 3300046559 Bacteria 2094
308 Ga0495656_0083826 3300046615 Bacteria 1444
309 Ga0495668_0086279 3300046616 Bacteria 1721
310 Ga0495668_0139747 3300046616 Bacteria 1325
311 Ga0495668_0224633 3300046616 Bacteria 1028
312 Ga0495634_0002799 3300046642 Bacteria 14330
313 Ga0495634_0015769 3300046642 Bacteria 5417
314 Ga0495634_0352747 3300046642 Bacteria 881
315 Ga0495611_0243369 3300046648 Bacteria 835
316 Ga0495625_0070173 3300046660 Bacteria 2460
317 Ga0495625_0131059 3300046660 Bacteria 1698
318 Ga0495635_0018136 3300046663 Bacteria 4914
319 Ga0495635_0027949 3300046663 Bacteria 3922
320 Ga0495635_0028962 3300046663 Bacteria 3850
321 Ga0495659_0128384 3300046664 Bacteria 1004
322 Ga0495657_0003480 3300046675 Bacteria 12840
323 Ga0495657_0149755 3300046675 Bacteria 1449
324 Ga0495599_0052346 3300046678 Bacteria 2557
325 Ga0495599_0151737 3300046678 Bacteria 1434
326 Ga0495646_0020602 3300046680 Bacteria 4172
327 Ga0495613_0000388 3300046689 Bacteria 37773
328 Ga0495613_0004110 3300046689 Bacteria 10885
329 Ga0495671_0007655 3300046692 Bacteria 6133
330 Ga0495649_0036301 3300046694 Bacteria 2707
331 Ga0495649_0068614 3300046694 Bacteria 1902
332 Ga0495649_0070671 3300046694 Bacteria 1871
333 Ga0495589_0015740 3300046794 Bacteria 3888
334 Ga0495589_0059236 3300046794 Bacteria 1882
335 Ga0495600_0010883 3300046809 Bacteria 5658
336 Ga0495600_0011870 3300046809 Bacteria 5439
337 Ga0495660_0004309 3300046810 Bacteria 8627
338 Ga0495660_0142233 3300046810 Bacteria 1192
339 Ga0495581_0069558 3300047315 Bacteria 2035
340 Ga0495604_0000545 3300047317 Bacteria 33154
341 Ga0495604_0005331 3300047317 Bacteria 10194
342 Ga0495604_0180506 3300047317 Bacteria 1477
343 Ga0495604_0244205 3300047317 Bacteria 1226
344 Ga0495636_0064025 3300047318 Bacteria 1559
345 Ga0495674_0079786 3300047319 Bacteria 2809
346 Ga0495672_0003747 3300047320 Bacteria 12818
347 Ga0495676_0000488 3300047321 Bacteria 32524
348 Ga0495676_0000537 3300047321 Bacteria 31037
349 Ga0495676_0051310 3300047321 Bacteria 3301
350 Ga0495676_0105662 3300047321 Bacteria 2075
351 Ga0495683_0002011 3300047323 Bacteria 12617
352 Ga0495683_0092272 3300047323 Bacteria 1465
353 Ga0495687_002019 3300047443 Bacteria 17185
354 Ga0495687_015680 3300047443 Bacteria 3843
355 Ga0495687_017402 3300047443 Bacteria 3588
356 Ga0495687_047628 3300047443 Bacteria 1843
357 Ga0495675_0044013 3300047444 Bacteria 2843
358 Ga0495677_0018742 3300047445 Bacteria 2509
359 Ga0495685_004037 3300047447 Bacteria 4720
360 Ga0495685_006708 3300047447 Bacteria 3778
361 Ga0495685_043554 3300047447 Bacteria 1531
362 Ga0495673_0011418 3300047469 Bacteria 4775
363 Ga0495681_0002530 3300047470 Bacteria 13023
364 Ga0495681_0016827 3300047470 Bacteria 4080
365 Ga0495686_0063234 3300047472 Bacteria 2294
366 Ga0495686_0129789 3300047472 Bacteria 1495
367 Ga0495593_0000258 3300047673 Bacteria 28592
368 Ga0495602_0075504 3300048088 Bacteria 2860
369 Ga0495614_0002843 3300048089 Bacteria 7703
370 Ga0495614_0005593 3300048089 Bacteria 5666
371 Ga0495614_0100204 3300048089 Bacteria 1265
372 Ga0496100_0348756 3300048903 Bacteria 1117
373 Ga0496101_0000130 3300048904 Bacteria 70026
374 Ga0496101_0091574 3300048904 Bacteria 2263
375 Ga0496102_0000014 3300048905 Bacteria 310241
376 Ga0496102_0000716 3300048905 Bacteria 32822
377 Ga0496102_0027571 3300048905 Bacteria 5072
378 Ga0496102_0284295 3300048905 Bacteria 1559
379 Ga0496102_0523791 3300048905 Bacteria 1108
380 Ga0496103_0000004 3300048906 Bacteria 510080
381 Ga0496103_0000767 3300048906 Bacteria 23698
382 Ga0496103_0148920 3300048906 Bacteria 1499
383 Ga0496104_0133734 3300048907 Bacteria 2382
384 Ga0496104_0387593 3300048907 Bacteria 1310
385 Ga0496105_0056792 3300048908 Bacteria 3231
386 Ga0496105_0073852 3300048908 Bacteria 2817
387 Ga0496106_0058828 3300048909 Bacteria 2910
388 Ga0496106_0090731 3300048909 Bacteria 2358
389 Ga0496106_0640388 3300048909 Bacteria 850
390 Ga0496106_0738621 3300048909 Bacteria 783
391 Ga0496107_0019547 3300048910 Bacteria 4779
392 Ga0496107_0066239 3300048910 Bacteria 2619
393 Ga0496107_0088217 3300048910 Bacteria 2264
394 Ga0496108_0024849 3300048911 Bacteria 4933
395 Ga0496108_0140686 3300048911 Bacteria 2079
396 Ga0496109_0092370 3300048912 Bacteria 2799
397 Ga0496109_0345965 3300048912 Bacteria 1404
398 Ga0496109_0372284 3300048912 Bacteria 1349
399 Ga0496109_0377733 3300048912 Bacteria 1339
400 Ga0496110_0162349 3300048913 Bacteria 2025
401 Ga0496111_0006478 3300048914 Bacteria 7606
402 Ga0496111_0176789 3300048914 Bacteria 1587
403 Ga0496111_0246255 3300048914 Bacteria 1327
404 Ga0496112_0005279 3300048915 Bacteria 11142
405 Ga0496112_0121764 3300048915 Bacteria 2579
406 Ga0496112_0158609 3300048915 Bacteria 2229
407 Ga0496114_0119792 3300048917 Bacteria 2263
408 Ga0496115_0010369 3300048918 Bacteria 6961
409 Ga0496116_0000069 3300048919 Bacteria 252643
410 Ga0496116_0069768 3300048919 Bacteria 2233
411 Ga0496117_0000003 3300048920 Bacteria 1881097
412 Ga0496117_0000687 3300048920 Bacteria 54044
413 Ga0496117_0001629 3300048920 Bacteria 31716
414 Ga0496118_0000001 3300048921 Bacteria 1881100
415 Ga0496118_0001732 3300048921 Bacteria 31716
416 Ga0496118_0003018 3300048921 Bacteria 21736
417 Ga0496119_0000588 3300048922 Bacteria 49189
418 Ga0496119_0031696 3300048922 Bacteria 3537
419 Ga0496119_0038081 3300048922 Bacteria 3113
420 Ga0496120_0000085 3300048923 Bacteria 155343
421 Ga0496120_0014771 3300048923 Bacteria 5183
422 Ga0496121_0000032 3300048924 Bacteria 378997
423 Ga0496121_0006420 3300048924 Bacteria 14611
424 Ga0496121_0058734 3300048924 Bacteria 3177
425 Ga0496121_0120791 3300048924 Bacteria 1979
426 Ga0496122_0000495 3300048925 Bacteria 81902
427 Ga0496124_0001784 3300048927 Bacteria 29937
428 Ga0496124_0096079 3300048927 Bacteria 2407
429 Ga0496125_0090825 3300048928 Bacteria 2290
430 Ga0496126_0000006 3300048929 Bacteria 798804
431 Ga0496126_0000007 3300048929 Bacteria 787364
432 Ga0496126_0000067 3300048929 Bacteria 249091
433 Ga0496126_0044285 3300048929 Bacteria 4099
434 Ga0496126_0143568 3300048929 Bacteria 2052
435 Ga0496126_0243130 3300048929 Bacteria 1503
436 Ga0496126_0268072 3300048929 Bacteria 1418
437 Ga0495678_070981 3300049459 Bacteria 1277
438 Ga0495678_083088 3300049459 Bacteria 1145
439 Ga0501031_0001335 3300049568 Bacteria 15192
440 Ga0501031_0017651 3300049568 Bacteria 4640
441 Ga0501031_0018173 3300049568 Bacteria 4575
442 Ga0501031_0025900 3300049568 Bacteria 3826
443 Ga0501031_0105735 3300049568 Bacteria 1837
444 Ga0501031_0113300 3300049568 Bacteria 1771
445 Ga0501031_0126986 3300049568 Bacteria 1666
446 Ga0501031_0149952 3300049568 Bacteria 1523
447 Ga0501032_0003786 3300049569 Bacteria 11478
448 Ga0501032_0005456 3300049569 Bacteria 9440
449 Ga0501032_0049802 3300049569 Bacteria 2826
450 Ga0501032_0070417 3300049569 Bacteria 2332
451 Ga0501032_0083467 3300049569 Bacteria 2125
452 Ga0501032_0123993 3300049569 Bacteria 1707
453 Ga0501032_0158460 3300049569 Bacteria 1486
454 Ga0501033_0001264 3300049570 Bacteria 22583
455 Ga0501033_0003278 3300049570 Bacteria 13390
456 Ga0501033_0006971 3300049570 Bacteria 8823
457 Ga0501033_0036673 3300049570 Bacteria 3672
458 Ga0501033_0044526 3300049570 Bacteria 3304
459 Ga0501033_0103818 3300049570 Bacteria 2072
460 Ga0501033_0265387 3300049570 Bacteria 1214
461 Ga0501034_0005213 3300049571 Bacteria 14259
462 Ga0501034_0006755 3300049571 Bacteria 12278
463 Ga0501034_0010784 3300049571 Bacteria 9491
464 Ga0501034_0012929 3300049571 Bacteria 8606
465 Ga0501034_0083866 3300049571 Bacteria 3189
466 Ga0501034_0205101 3300049571 Bacteria 1928
467 Ga0501034_0315739 3300049571 Bacteria 1496
468 Ga0501036_0001005 3300049572 Bacteria 21286
469 Ga0501036_0006405 3300049572 Bacteria 9553
470 Ga0501036_0011299 3300049572 Bacteria 7386
471 Ga0501036_0017921 3300049572 Bacteria 5928
472 Ga0501036_0273334 3300049572 Bacteria 1414
473 Ga0501037_0005145 3300049573 Bacteria 9514
474 Ga0501037_0008402 3300049573 Bacteria 7573
475 Ga0501037_0056835 3300049573 Bacteria 2857
476 Ga0501038_0005437 3300049574 Bacteria 11835
477 Ga0501038_0007464 3300049574 Bacteria 10089
478 Ga0501038_0007801 3300049574 Bacteria 9864
479 Ga0501038_0024746 3300049574 Bacteria 5352
480 Ga0501038_0082868 3300049574 Bacteria 2700
481 Ga0501038_0103810 3300049574 Bacteria 2363
482 Ga0501039_0057593 3300049575 Bacteria 3009
483 Ga0501039_0113780 3300049575 Bacteria 2116
484 Ga0501039_0155099 3300049575 Bacteria 1799
485 Ga0501040_0145671 3300049576 Bacteria 1670
486 Ga0501040_0173011 3300049576 Bacteria 1529
487 Ga0501042_0001445 3300049578 Bacteria 13978
488 Ga0501042_0026449 3300049578 Bacteria 4077
489 Ga0501043_0006022 3300049579 Bacteria 9750
490 Ga0501043_0007957 3300049579 Bacteria 8375
491 Ga0501043_0010419 3300049579 Bacteria 7283
492 Ga0501043_0067766 3300049579 Bacteria 2802
493 Ga0501043_0084665 3300049579 Bacteria 2492
494 Ga0501043_0134259 3300049579 Bacteria 1939
495 Ga0501043_0287764 3300049579 Bacteria 1258
496 Ga0501046_0000091 3300049580 Bacteria 98095
497 Ga0501046_0002395 3300049580 Bacteria 17614
498 Ga0501046_0007551 3300049580 Bacteria 9535
499 Ga0501046_0037499 3300049580 Bacteria 3894
500 Ga0501047_0000575 3300049581 Bacteria 39087
501 Ga0501047_0002966 3300049581 Bacteria 16087
502 Ga0501047_0003526 3300049581 Bacteria 14766
503 Ga0501047_0004553 3300049581 Bacteria 13036
504 Ga0501047_0007490 3300049581 Bacteria 10271
505 Ga0501047_0013474 3300049581 Bacteria 7749
506 Ga0501047_0111883 3300049581 Bacteria 2613
507 Ga0501047_0180172 3300049581 Bacteria 1979
508 Ga0501047_0236047 3300049581 Bacteria 1680
509 Ga0501048_0003067 3300049582 Bacteria 12733
510 Ga0501048_0005624 3300049582 Bacteria 9532
511 Ga0501048_0031140 3300049582 Bacteria 3859
512 Ga0501070_0007297 3300049586 Bacteria 9387
513 Ga0501070_0061016 3300049586 Bacteria 3125
514 Ga0501070_0118730 3300049586 Bacteria 2185
515 Ga0501070_0220822 3300049586 Bacteria 1554
516 Ga0501071_0519030 3300049587 Bacteria 914
517 Ga0501073_0005674 3300049589 Bacteria 9336
518 Ga0501073_0029923 3300049589 Bacteria 3889
519 Ga0501073_0035832 3300049589 Bacteria 3525
520 Ga0501073_0176902 3300049589 Bacteria 1477
521 Ga0501074_0033129 3300049590 Bacteria 3744
522 Ga0501074_0073364 3300049590 Bacteria 2458
523 Ga0501074_0172377 3300049590 Bacteria 1544
524 Ga0501079_0059947 3300049741 Bacteria 2935
525 Ga0501079_0237167 3300049741 Bacteria 1425
526 Ga0501080_0082989 3300049742 Bacteria 2977
527 Ga0501080_0184073 3300049742 Bacteria 1921
528 Ga0501080_0229752 3300049742 Bacteria 1696
529 Ga0501083_0005021 3300049744 Bacteria 9373
530 Ga0501083_0007399 3300049744 Bacteria 7788
531 Ga0501083_0043593 3300049744 Bacteria 3039
532 Ga0501083_0277868 3300049744 Bacteria 1089
533 Ga0501035_0000248 3300049822 Bacteria 65046
534 Ga0501035_0002666 3300049822 Bacteria 17365
535 Ga0501035_0003898 3300049822 Bacteria 14232
536 Ga0501035_0101308 3300049822 Bacteria 2527
537 Ga0501035_0251519 3300049822 Bacteria 1500
538 Ga0501044_0003376 3300049823 Bacteria 17996
539 Ga0501044_0003625 3300049823 Bacteria 17374
540 Ga0501044_0004950 3300049823 Bacteria 14901
541 Ga0501044_0006686 3300049823 Bacteria 12711
542 Ga0501044_0018070 3300049823 Bacteria 7562
543 Ga0501044_0259717 3300049823 Bacteria 1675
544 Ga0501044_0276307 3300049823 Bacteria 1614
545 Ga0501044_0445345 3300049823 Bacteria 1202
546 Ga0501044_0605383 3300049823 Bacteria 988
547 Ga0501045_0291370 3300049824 Bacteria 1215
548 nmdc:mga03n38_1856_c2 3300050490 Bacteria 5633
549 nmdc:mga03n38_48390_c1 3300050490 Bacteria 1886
550 nmdc:mga00v17_7166_c1 3300050491 Bacteria 5941
551 nmdc:mga0yw44_5415_c1 3300050492 Bacteria 6026
552 nmdc:mga06z11_420152_c1 3300050494 Bacteria 806
553 nmdc:mga07m45_2025_c1 3300050496 Bacteria 4216
554 nmdc:mga08y16_745885_c1 3300050511 Bacteria 975
555 nmdc:mga0sz30_167564_c1 3300050516 Bacteria 974
556 nmdc:mga0sz30_91566_c1 3300050516 Bacteria 1323
557 Ga0495601_0000519 3300053077 Bacteria 20315
558 Ga0500635_0004864 3300053080 Bacteria 3488
559 Ga0495619_0044864 3300053085 Bacteria 2903
560 Ga0500578_0062317 3300053086 Bacteria 2380
561 Ga0500578_0227007 3300053086 Bacteria 1133
562 Ga0500644_0102111 3300053088 Bacteria 1091
563 Ga0500583_0101740 3300053092 Bacteria 1408
564 Ga0500640_007318 3300053095 Bacteria 4286
565 Ga0500650_0061242 3300053098 Bacteria 1757
566 Ga0500650_0234462 3300053098 Bacteria 827
567 Ga0500654_046623 3300053099 Bacteria 2388
568 Ga0500654_112087 3300053099 Bacteria 1112
569 Ga0500660_107726 3300053100 Bacteria 1197
570 Ga0500553_030046 3300053101 Bacteria 2720
571 Ga0500556_0000400 3300053104 Bacteria 31735
572 Ga0500560_004220 3300053107 Bacteria 3027
573 Ga0500569_012505 3300053109 Bacteria 2055
574 Ga0500572_007340 3300053111 Bacteria 2552
575 Ga0500594_0005978 3300053118 Bacteria 2716
576 Ga0500594_0091823 3300053118 Bacteria 923
577 Ga0500608_096599 3300053122 Bacteria 1374
578 Ga0500614_047212 3300053123 Bacteria 1118
579 Ga0500628_004523 3300053129 Bacteria 2303
580 Ga0500652_000402 3300053131 Bacteria 15494
581 Ga0500652_009669 3300053131 Bacteria 3272
582 Ga0500652_115005 3300053131 Bacteria 1124
583 Ga0500658_0037842 3300053134 Bacteria 1920
584 Ga0500658_0245062 3300053134 Bacteria 823
585 Ga0500559_0000719 3300053136 Bacteria 21761
586 Ga0500561_0013747 3300053137 Bacteria 1761
587 Ga0500568_0000579 3300053139 Bacteria 26786
588 Ga0500579_048915 3300053143 Bacteria 2599
589 Ga0500600_0029597 3300053149 Bacteria 3230
590 Ga0500600_0151971 3300053149 Bacteria 1150
591 Ga0500616_0000483 3300053153 Bacteria 51655
592 Ga0500616_0000930 3300053153 Bacteria 32033
593 Ga0500616_0002364 3300053153 Bacteria 15860
594 Ga0500616_0007128 3300053153 Bacteria 7155
595 Ga0500616_0035701 3300053153 Bacteria 2702
596 Ga0500627_0003406 3300053158 Bacteria 4909
597 Ga0500633_0020650 3300053160 Bacteria 1990
598 Ga0500636_0208114 3300053177 Bacteria 1029
599 Ga0500645_000017 3300053730 Bacteria 146045
600 Ga0500656_000122 3300053732 Bacteria 4545
601 Ga0500599_008279 3300053736 Bacteria 1347
602 Ga0500587_002769 3300053739 Bacteria 2477
603 Ga0501084_0422920 3300054114 Bacteria 1126
604 Ga0501082_0029555 3300060353 Bacteria 4721
605 Ga0501082_0161486 3300060353 Bacteria 1947

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048908 Ga0496105_0073852 Ga0496105_0073852_131_793 220
2 3300053104 Ga0500556_0000400 Ga0500556_0000400_51_734 221
3 3300053153 Ga0500616_0000930 Ga0500616_0000930_15717_16400 221
4 3300005441 Ga0070700_100328262 Ga0070700_1003282622 227
5 3300006173 Ga0070716_100035357 Ga0070716_1000353575 227
6 3300007788 Ga0099795_10010741 Ga0099795_100107413 227
7 3300009545 Ga0105237_10232907 Ga0105237_102329072 227
8 3300013306 Ga0163162_10105490 Ga0163162_101054902 227
9 3300013308 Ga0157375_10077352 Ga0157375_100773523 227
10 3300025898 Ga0207692_10050411 Ga0207692_100504112 227
11 3300025907 Ga0207645_10113300 Ga0207645_101133002 227
12 3300025935 Ga0207709_10560423 Ga0207709_105604232 227
13 3300025939 Ga0207665_10051276 Ga0207665_100512765 227
14 3300035691 Ga0373931_0083630 Ga0373931_0083630_629_1312 227
15 3300041509 Ga0451843_0099427 Ga0451843_0099427_294_977 227
16 3300046453 Ga0495627_012618 Ga0495627_012618_17_700 227
17 3300046459 Ga0495629_0199901 Ga0495629_0199901_127_810 227
18 3300046520 Ga0495637_0142884 Ga0495637_0142884_208_891 227
19 3300046524 Ga0495648_0021550 Ga0495648_0021550_3753_4436 227
20 3300046533 Ga0495640_0085391 Ga0495640_0085391_461_1144 227
21 3300048909 Ga0496106_0090731 Ga0496106_0090731_170_853 227
22 3300048910 Ga0496107_0066239 Ga0496107_0066239_1294_1977 227
23 3300049568 Ga0501031_0025900 Ga0501031_0025900_2857_3540 227
24 3300049570 Ga0501033_0003278 Ga0501033_0003278_12177_12860 227
25 3300049571 Ga0501034_0083866 Ga0501034_0083866_1606_2289 227
26 3300049574 Ga0501038_0024746 Ga0501038_0024746_36_719 227
27 3300049574 Ga0501038_0082868 Ga0501038_0082868_1277_1960 227
28 3300049580 Ga0501046_0002395 Ga0501046_0002395_16472_17155 227
29 3300049586 Ga0501070_0118730 Ga0501070_0118730_222_905 227
30 3300049589 Ga0501073_0035832 Ga0501073_0035832_444_1127 227
31 3300049742 Ga0501080_0229752 Ga0501080_0229752_721_1404 227
32 3300049744 Ga0501083_0277868 Ga0501083_0277868_19_702 227
33 3300049822 Ga0501035_0002666 Ga0501035_0002666_15935_16618 227
34 3300049823 Ga0501044_0003625 Ga0501044_0003625_546_1229 227
35 3300053131 Ga0500652_115005 Ga0500652_115005_131_814 227
36 3300053134 Ga0500658_0245062 Ga0500658_0245062_120_812 227
37 3300053158 Ga0500627_0003406 Ga0500627_0003406_3958_4641 227
38 3300060353 Ga0501082_0161486 Ga0501082_0161486_741_1424 227
39 3300041512 Ga0451853_0325620 Ga0451853_0325620_6662_7435 231
40 3300049744 Ga0501083_0007399 Ga0501083_0007399_5000_5734 232
41 3300049568 Ga0501031_0149952 Ga0501031_0149952_218_949 233
42 3300049569 Ga0501032_0158460 Ga0501032_0158460_127_858 233
43 3300049570 Ga0501033_0036673 Ga0501033_0036673_1186_1917 233
44 3300049571 Ga0501034_0006755 Ga0501034_0006755_1268_1999 233
45 3300049572 Ga0501036_0001005 Ga0501036_0001005_16619_17350 233
46 3300049573 Ga0501037_0008402 Ga0501037_0008402_6614_7345 233
47 3300049574 Ga0501038_0005437 Ga0501038_0005437_3775_4506 233
48 3300049575 Ga0501039_0155099 Ga0501039_0155099_99_830 233
49 3300049579 Ga0501043_0010419 Ga0501043_0010419_5689_6420 233
50 3300049580 Ga0501046_0000091 Ga0501046_0000091_52601_53332 233
51 3300049581 Ga0501047_0007490 Ga0501047_0007490_225_956 233
52 3300049590 Ga0501074_0172377 Ga0501074_0172377_181_912 233
53 3300049741 Ga0501079_0237167 Ga0501079_0237167_473_1204 233
54 3300049823 Ga0501044_0276307 Ga0501044_0276307_20_751 233
55 3300046460 Ga0495638_0023029 Ga0495638_0023029_3043_3816 235
56 3300053153 Ga0500616_0007128 Ga0500616_0007128_3609_4343 235
57 3300028794 Ga0307515_10061669 Ga0307515_100616693 237
58 3300030522 Ga0307512_10004311 Ga0307512_100043114 237
59 3300031616 Ga0307508_10156550 Ga0307508_101565502 237
60 3300033180 Ga0307510_10152891 Ga0307510_101528912 237
61 3300053098 Ga0500650_0061242 Ga0500650_0061242_919_1659 237
62 3300053099 Ga0500654_112087 Ga0500654_112087_138_872 237
63 3300053118 Ga0500594_0005978 Ga0500594_0005978_1867_2607 237
64 3300053131 Ga0500652_009669 Ga0500652_009669_1084_1824 237
65 3300005355 Ga0070671_100000949 Ga0070671_1000009497 238
66 3300025925 Ga0207650_10091927 Ga0207650_100919271 238
67 3300025931 Ga0207644_10089307 Ga0207644_100893071 238
68 iso_pu_bacteria 2758568522 2760306631 238
69 3300049569 Ga0501032_0083467 Ga0501032_0083467_1201_1941 239
70 3300049581 Ga0501047_0004553 Ga0501047_0004553_11546_12286 239
71 3300049586 Ga0501070_0220822 Ga0501070_0220822_328_1068 239
72 3300049823 Ga0501044_0006686 Ga0501044_0006686_11401_12141 239
73 iso_pu_bacteria 2643221607 2644048953 239
74 iso_pu_bacteria 2643221686 2644481703 239
75 iso_pu_bacteria 2643221689 2644501022 239
76 iso_pu_bacteria 2738541293 2738805121 239
77 iso_pu_bacteria 2508501039 2508671208 240
78 iso_pu_bacteria 2517572101 2517760077 240
79 iso_pu_bacteria 2558860280 2559432358 240
80 iso_pu_bacteria 2582581314 2585315205 240
81 iso_pu_bacteria 2616644814 2616701626 240
82 iso_pu_bacteria 2643221562 2643830466 240
83 iso_pu_bacteria 2643221647 2644262429 240
84 iso_pu_bacteria 2675902999 2676204080 240
85 iso_pu_bacteria 2687453737 2689962453 240
86 iso_pu_bacteria 2687453737 2689963724 240
87 iso_pu_bacteria 2687453743 2689992796 240
88 iso_pu_bacteria 2728368998 2728748584 240
89 iso_pu_bacteria 2758568621 2760624490 240
90 iso_pu_bacteria 2773857921 2774848656 240
91 iso_pu_bacteria 2816332139 2816507448 240
92 iso_pu_bacteria 2858895516 2858901503 240
93 iso_pu_bacteria 2862574272 2862582216 240
94 iso_pu_bacteria 2880489317 2880491127 240
95 iso_pu_bacteria 2919085039 2919085189 240
96 iso_pu_bacteria 2945941187 2945945106 240
97 iso_pu_bacteria 2945968032 2945969394 240
98 iso_pu_bacteria 2954701450 2954709894 240
99 iso_pu_bacteria 8001781756 8001786280 240
100 iso_pu_bacteria 8023623736 8023630181 240
101 iso_pu_bacteria 8047710418 8047717869 240
102 iso_pu_bacteria 8048127548 8048136042 240
103 iso_pu_bacteria 8054302542 8054307023 240
104 iso_pu_bacteria 8054727385 8054728028 240
105 iso_pu_bacteria 8055066027 8055068609 240
106 iso_pu_bacteria 8056579771 8056583570 240
107 iso_pu_bacteria 2599185354 2600203789 241
108 3300005530 Ga0070679_100005317 Ga0070679_1000053174 242
109 3300025261 Ga0209233_1008225 Ga0209233_10082256 242
110 3300003187 JGI25151J46595_10098038 JGI25151J46595_100980381 243
111 3300003316 rootH1_10079142 rootH1_100791423 243
112 3300003320 rootH2_10230140 rootH2_102301403 243
113 3300003320 rootH2_10267319 rootH2_102673193 243
114 3300003323 rootH1_10165931 rootH1_101659314 243
115 3300003323 rootH1_10286776 rootH1_102867763 243
116 3300005329 Ga0070683_100326623 Ga0070683_1003266232 243
117 3300005335 Ga0070666_10010743 Ga0070666_100107433 243
118 3300009093 Ga0105240_10201565 Ga0105240_102015652 243
119 3300009093 Ga0105240_10743114 Ga0105240_107431142 243
120 3300013104 Ga0157370_10026255 Ga0157370_100262556 243
121 3300025294 Ga0209025_1001389 Ga0209025_100138911 243
122 3300039447 Ga0436361_0991054 Ga0436361_0991054_128_865 243
123 3300041486 Ga0451807_1482729 Ga0451807_1482729_34_765 243
124 3300048905 Ga0496102_0027571 Ga0496102_0027571_659_1405 243
125 3300048920 Ga0496117_0001629 Ga0496117_0001629_21619_22365 243
126 3300048921 Ga0496118_0001732 Ga0496118_0001732_21619_22365 243
127 3300001989 JGI24739J22299_10002752 JGI24739J22299_100027524 244
128 3300001990 JGI24737J22298_10027289 JGI24737J22298_100272893 244
129 3300002459 JGI24751J29686_10015835 JGI24751J29686_100158352 244
130 3300003323 rootH1_10071420 rootH1_100714203 244
131 3300003577 Ga0007416J51690_1009241 Ga0007416J51690_10092411 244
132 3300003611 Ga0007411J51799_106219 Ga0007411J51799_1062191 244
133 3300003762 Ga0055542_1000439 Ga0055542_100043932 244
134 3300005288 Ga0065714_10030916 Ga0065714_100309162 244
135 3300005356 Ga0070674_100409687 Ga0070674_1004096871 244
136 3300005367 Ga0070667_100000308 Ga0070667_10000030819 244
137 3300005435 Ga0070714_100019981 Ga0070714_1000199814 244
138 3300005435 Ga0070714_100054094 Ga0070714_1000540942 244
139 3300005435 Ga0070714_100063694 Ga0070714_1000636942 244
140 3300005435 Ga0070714_100339925 Ga0070714_1003399252 244
141 3300005435 Ga0070714_100497129 Ga0070714_1004971292 244
142 3300005436 Ga0070713_100128517 Ga0070713_1001285172 244
143 3300005436 Ga0070713_100576844 Ga0070713_1005768441 244
144 3300005437 Ga0070710_10288389 Ga0070710_102883892 244
145 3300005439 Ga0070711_100111142 Ga0070711_1001111422 244
146 3300005455 Ga0070663_100118299 Ga0070663_1001182994 244
147 3300005455 Ga0070663_100189552 Ga0070663_1001895522 244
148 3300005456 Ga0070678_100516959 Ga0070678_1005169592 244
149 3300005530 Ga0070679_100136007 Ga0070679_1001360072 244
150 3300005530 Ga0070679_100554525 Ga0070679_1005545251 244
151 3300005548 Ga0070665_100108097 Ga0070665_1001080972 244
152 3300005548 Ga0070665_100179527 Ga0070665_1001795271 244
153 3300005563 Ga0068855_100042178 Ga0068855_1000421785 244
154 3300005563 Ga0068855_100669726 Ga0068855_1006697261 244
155 3300005564 Ga0070664_100136957 Ga0070664_1001369572 244
156 3300005614 Ga0068856_100525393 Ga0068856_1005253931 244
157 3300005616 Ga0068852_100050125 Ga0068852_1000501255 244
158 3300005616 Ga0068852_100101469 Ga0068852_1001014693 244
159 3300005617 Ga0068859_100006027 Ga0068859_1000060274 244
160 3300005618 Ga0068864_100320816 Ga0068864_1003208162 244
161 3300005842 Ga0068858_100002726 Ga0068858_10000272610 244
162 3300005843 Ga0068860_100000155 Ga0068860_10000015519 244
163 3300005844 Ga0068862_100000096 Ga0068862_10000009614 244
164 3300005983 Ga0081540_1022853 Ga0081540_10228533 244
165 3300006028 Ga0070717_10136297 Ga0070717_101362972 244
166 3300006038 Ga0075365_10012747 Ga0075365_100127475 244
167 3300006038 Ga0075365_10032306 Ga0075365_100323063 244
168 3300006048 Ga0075363_100058089 Ga0075363_1000580892 244
169 3300006051 Ga0075364_10037286 Ga0075364_100372861 244
170 3300006175 Ga0070712_100033901 Ga0070712_1000339013 244
171 3300006175 Ga0070712_100178141 Ga0070712_1001781412 244
172 3300006177 Ga0075362_10013512 Ga0075362_100135122 244
173 3300006186 Ga0075369_10089581 Ga0075369_100895812 244
174 3300006353 Ga0075370_10014473 Ga0075370_100144732 244
175 3300006871 Ga0075434_100918859 Ga0075434_1009188591 244
176 3300006931 Ga0097620_100006027 Ga0097620_1000060274 244
177 3300006948 Ga0099826_10268791 Ga0099826_102687911 244
178 3300007788 Ga0099795_10094914 Ga0099795_100949142 244
179 3300009093 Ga0105240_10780583 Ga0105240_107805831 244
180 3300009098 Ga0105245_10590819 Ga0105245_105908192 244
181 3300009101 Ga0105247_10000040 Ga0105247_1000004071 244
182 3300009174 Ga0105241_10313280 Ga0105241_103132801 244
183 3300009174 Ga0105241_10406454 Ga0105241_104064541 244
184 3300009177 Ga0105248_10000095 Ga0105248_100000955 244
185 3300009177 Ga0105248_10137550 Ga0105248_101375503 244
186 3300009177 Ga0105248_10963290 Ga0105248_109632902 244
187 3300009545 Ga0105237_10148880 Ga0105237_101488802 244
188 3300009545 Ga0105237_10728712 Ga0105237_107287121 244
189 3300009551 Ga0105238_10151181 Ga0105238_101511812 244
190 3300009551 Ga0105238_10152586 Ga0105238_101525863 244
191 3300009551 Ga0105238_10283619 Ga0105238_102836192 244
192 3300009551 Ga0105238_10714340 Ga0105238_107143401 244
193 3300009553 Ga0105249_10000069 Ga0105249_1000006962 244
194 3300010159 Ga0099796_10066653 Ga0099796_100666532 244
195 3300010375 Ga0105239_10181186 Ga0105239_101811862 244
196 3300010375 Ga0105239_10363307 Ga0105239_103633072 244
197 3300010375 Ga0105239_10578964 Ga0105239_105789642 244
198 3300011119 Ga0105246_10033294 Ga0105246_100332942 244
199 3300012507 Ga0157342_1014844 Ga0157342_10148441 244
200 3300013104 Ga0157370_10000317 Ga0157370_1000031729 244
201 3300013104 Ga0157370_10157873 Ga0157370_101578732 244
202 3300013105 Ga0157369_10407593 Ga0157369_104075932 244
203 3300013105 Ga0157369_10409534 Ga0157369_104095342 244
204 3300013296 Ga0157374_10278718 Ga0157374_102787182 244
205 3300013306 Ga0163162_10170835 Ga0163162_101708351 244
206 3300013306 Ga0163162_10181355 Ga0163162_101813552 244
207 3300013308 Ga0157375_10240458 Ga0157375_102404583 244
208 3300014325 Ga0163163_10014016 Ga0163163_100140163 244
209 3300014325 Ga0163163_10580939 Ga0163163_105809392 244
210 3300014326 Ga0157380_10835954 Ga0157380_108359541 244
211 3300014968 Ga0157379_10025856 Ga0157379_100258563 244
212 3300015265 Ga0182005_1000004 Ga0182005_1000004420 244
213 3300020070 Ga0206356_11243581 Ga0206356_112435811 244
214 3300020082 Ga0206353_11300916 Ga0206353_113009161 244
215 3300022467 Ga0224712_10193976 Ga0224712_101939761 244
216 3300025728 Ga0207655_1032430 Ga0207655_10324303 244
217 3300025899 Ga0207642_10320638 Ga0207642_103206381 244
218 3300025900 Ga0207710_10000050 Ga0207710_10000050101 244
219 3300025901 Ga0207688_10136566 Ga0207688_101365662 244
220 3300025904 Ga0207647_10025551 Ga0207647_100255512 244
221 3300025904 Ga0207647_10033454 Ga0207647_100334542 244
222 3300025904 Ga0207647_10124806 Ga0207647_101248062 244
223 3300025906 Ga0207699_10059943 Ga0207699_100599433 244
224 3300025906 Ga0207699_10499563 Ga0207699_104995631 244
225 3300025909 Ga0207705_10338020 Ga0207705_103380201 244
226 3300025911 Ga0207654_10002481 Ga0207654_1000248110 244
227 3300025912 Ga0207707_10123483 Ga0207707_101234831 244
228 3300025913 Ga0207695_10014892 Ga0207695_100148929 244
229 3300025914 Ga0207671_10001125 Ga0207671_1000112526 244
230 3300025914 Ga0207671_10122616 Ga0207671_101226162 244
231 3300025914 Ga0207671_10265473 Ga0207671_102654731 244
232 3300025914 Ga0207671_10594749 Ga0207671_105947491 244
233 3300025915 Ga0207693_10043227 Ga0207693_100432273 244
234 3300025915 Ga0207693_10295167 Ga0207693_102951671 244
235 3300025915 Ga0207693_10533809 Ga0207693_105338091 244
236 3300025916 Ga0207663_10077835 Ga0207663_100778352 244
237 3300025916 Ga0207663_10081704 Ga0207663_100817042 244
238 3300025917 Ga0207660_10580727 Ga0207660_105807272 244
239 3300025919 Ga0207657_10606321 Ga0207657_106063211 244
240 3300025921 Ga0207652_10067625 Ga0207652_100676252 244
241 3300025921 Ga0207652_10512592 Ga0207652_105125921 244
242 3300025923 Ga0207681_10002841 Ga0207681_100028417 244
243 3300025924 Ga0207694_10101413 Ga0207694_101014133 244
244 3300025924 Ga0207694_10288478 Ga0207694_102884781 244
245 3300025927 Ga0207687_10069301 Ga0207687_100693013 244
246 3300025927 Ga0207687_10120347 Ga0207687_101203472 244
247 3300025928 Ga0207700_10280462 Ga0207700_102804622 244
248 3300025929 Ga0207664_10002394 Ga0207664_1000239411 244
249 3300025929 Ga0207664_10022536 Ga0207664_100225363 244
250 3300025929 Ga0207664_10108015 Ga0207664_101080153 244
251 3300025929 Ga0207664_10190169 Ga0207664_101901692 244
252 3300025929 Ga0207664_10321894 Ga0207664_103218942 244
253 3300025940 Ga0207691_10080042 Ga0207691_100800422 244
254 3300025940 Ga0207691_10107009 Ga0207691_101070092 244
255 3300025941 Ga0207711_10000082 Ga0207711_1000008279 244
256 3300025942 Ga0207689_10218716 Ga0207689_102187162 244
257 3300025944 Ga0207661_10477584 Ga0207661_104775841 244
258 3300025945 Ga0207679_10144966 Ga0207679_101449662 244
259 3300025945 Ga0207679_10608861 Ga0207679_106088611 244
260 3300025961 Ga0207712_10000084 Ga0207712_1000008461 244
261 3300025981 Ga0207640_10111051 Ga0207640_101110513 244
262 3300025986 Ga0207658_10000868 Ga0207658_1000086819 244
263 3300026035 Ga0207703_11038697 Ga0207703_110386971 244
264 3300026067 Ga0207678_10018048 Ga0207678_100180483 244
265 3300026067 Ga0207678_10195735 Ga0207678_101957352 244
266 3300026067 Ga0207678_10413101 Ga0207678_104131011 244
267 3300026095 Ga0207676_10513251 Ga0207676_105132511 244
268 3300026116 Ga0207674_10405816 Ga0207674_104058161 244
269 3300026121 Ga0207683_10121955 Ga0207683_101219554 244
270 3300026142 Ga0207698_10073403 Ga0207698_100734033 244
271 3300028379 Ga0268266_10059382 Ga0268266_100593824 244
272 3300028379 Ga0268266_10464642 Ga0268266_104646421 244
273 3300028380 Ga0268265_10000106 Ga0268265_1000010687 244
274 3300028381 Ga0268264_10000219 Ga0268264_1000021919 244
275 3300028381 Ga0268264_10700813 Ga0268264_107008132 244
276 3300028563 Ga0265319_1017014 Ga0265319_10170144 244
277 3300028666 Ga0265336_10005155 Ga0265336_100051553 244
278 3300028666 Ga0265336_10045147 Ga0265336_100451472 244
279 3300028666 Ga0265336_10049927 Ga0265336_100499272 244
280 3300028786 Ga0307517_10044770 Ga0307517_100447706 244
281 3300028786 Ga0307517_10113193 Ga0307517_101131933 244
282 3300028794 Ga0307515_10000846 Ga0307515_1000084650 244
283 3300028794 Ga0307515_10049581 Ga0307515_100495815 244
284 3300028800 Ga0265338_10003900 Ga0265338_1000390014 244
285 3300028800 Ga0265338_10017188 Ga0265338_100171889 244
286 3300028800 Ga0265338_10021357 Ga0265338_100213577 244
287 3300028800 Ga0265338_10042925 Ga0265338_100429253 244
288 3300028800 Ga0265338_10107746 Ga0265338_101077462 244
289 3300030521 Ga0307511_10003090 Ga0307511_1000309010 244
290 3300030521 Ga0307511_10141165 Ga0307511_101411651 244
291 3300030522 Ga0307512_10007896 Ga0307512_100078963 244
292 3300031090 Ga0265760_10076694 Ga0265760_100766941 244
293 3300031235 Ga0265330_10027609 Ga0265330_100276091 244
294 3300031456 Ga0307513_10001603 Ga0307513_100016037 244
295 3300031456 Ga0307513_10069471 Ga0307513_100694712 244
296 3300031456 Ga0307513_10331367 Ga0307513_103313671 244
297 3300031507 Ga0307509_10013229 Ga0307509_100132293 244
298 3300031507 Ga0307509_10023765 Ga0307509_100237656 244
299 3300031507 Ga0307509_10093453 Ga0307509_100934532 244
300 3300031616 Ga0307508_10001782 Ga0307508_100017822 244
301 3300031616 Ga0307508_10009013 Ga0307508_1000901310 244
302 3300031616 Ga0307508_10139501 Ga0307508_101395011 244
303 3300031616 Ga0307508_10352832 Ga0307508_103528322 244
304 3300031649 Ga0307514_10023311 Ga0307514_100233116 244
305 3300031730 Ga0307516_10051225 Ga0307516_100512251 244
306 3300031731 Ga0307405_10168115 Ga0307405_101681152 244
307 3300033179 Ga0307507_10001954 Ga0307507_1000195421 244
308 3300033179 Ga0307507_10027336 Ga0307507_100273364 244
309 3300033179 Ga0307507_10036156 Ga0307507_100361562 244
310 3300033179 Ga0307507_10053550 Ga0307507_100535504 244
311 3300033180 Ga0307510_10004939 Ga0307510_1000493914 244
312 3300033180 Ga0307510_10049355 Ga0307510_100493556 244
313 3300035086 Ga0373934_0096245 Ga0373934_0096245_397_1131 244
314 3300035091 Ga0373951_0000086 Ga0373951_0000086_287_1033 244
315 3300035111 Ga0373923_0201848 Ga0373923_0201848_17_751 244
316 3300035113 Ga0373936_0005116 Ga0373936_0005116_2415_3149 244
317 3300035118 Ga0373954_0017921 Ga0373954_0017921_248_982 244
318 3300035120 Ga0373957_0085805 Ga0373957_0085805_297_1031 244
319 3300035410 Ga0373924_0043622 Ga0373924_0043622_1010_1744 244
320 3300035692 Ga0373935_0539601 Ga0373935_0539601_86_820 244
321 3300035725 Ga0373947_0472048 Ga0373947_0472048_48_782 244
322 3300036401 Ga0373937_0814442 Ga0373937_0814442_59_799 244
323 3300036459 Ga0372808_005661 Ga0372808_005661_95_835 244
324 3300037068 Ga0373925_0000101 Ga0373925_0000101_2351_3091 244
325 3300037068 Ga0373925_0016708 Ga0373925_0016708_2893_3633 244
326 3300037068 Ga0373925_0026933 Ga0373925_0026933_2231_2971 244
327 3300037068 Ga0373925_0320429 Ga0373925_0320429_131_877 244
328 3300037418 Ga0395900_0308999 Ga0395900_0308999_370_1104 244
329 3300037471 Ga0395905_0556059 Ga0395905_0556059_40_774 244
330 3300041452 Ga0451793_0467648 Ga0451793_0467648_72_806 244
331 3300044735 Ga0466968_0070735 Ga0466968_0070735_174_908 244
332 3300044901 Ga0466960_0220887 Ga0466960_0220887_181_915 244
333 3300046452 Ga0495617_060796 Ga0495617_060796_468_1202 244
334 3300046454 Ga0495592_0009428 Ga0495592_0009428_4607_5341 244
335 3300046454 Ga0495592_0078488 Ga0495592_0078488_1546_2280 244
336 3300046454 Ga0495592_0204218 Ga0495592_0204218_152_886 244
337 3300046455 Ga0495603_0012178 Ga0495603_0012178_1545_2279 244
338 3300046455 Ga0495603_0018918 Ga0495603_0018918_1346_2086 244
339 3300046455 Ga0495603_0030542 Ga0495603_0030542_366_1100 244
340 3300046459 Ga0495629_0011173 Ga0495629_0011173_3802_4536 244
341 3300046459 Ga0495629_0018578 Ga0495629_0018578_372_1106 244
342 3300046459 Ga0495629_0038123 Ga0495629_0038123_208_942 244
343 3300046460 Ga0495638_0090222 Ga0495638_0090222_791_1531 244
344 3300046460 Ga0495638_0122447 Ga0495638_0122447_33_767 244
345 3300046462 Ga0495651_0001042 Ga0495651_0001042_16414_17148 244
346 3300046462 Ga0495651_0161204 Ga0495651_0161204_61_795 244
347 3300046462 Ga0495651_0305234 Ga0495651_0305234_47_781 244
348 3300046472 Ga0495580_0234560 Ga0495580_0234560_201_941 244
349 3300046474 Ga0495605_0052376 Ga0495605_0052376_378_1118 244
350 3300046475 Ga0495639_0239535 Ga0495639_0239535_61_795 244
351 3300046476 Ga0495662_0009485 Ga0495662_0009485_3779_4513 244
352 3300046476 Ga0495662_0082663 Ga0495662_0082663_134_886 244
353 3300046477 Ga0495664_0000287 Ga0495664_0000287_16470_17204 244
354 3300046477 Ga0495664_0015673 Ga0495664_0015673_1569_2303 244
355 3300046477 Ga0495664_0294054 Ga0495664_0294054_68_808 244
356 3300046491 Ga0495584_0061044 Ga0495584_0061044_457_1197 244
357 3300046499 Ga0495594_0018231 Ga0495594_0018231_1826_2560 244
358 3300046499 Ga0495594_0058148 Ga0495594_0058148_783_1523 244
359 3300046499 Ga0495594_0249448 Ga0495594_0249448_34_798 244
360 3300046500 Ga0495596_0034238 Ga0495596_0034238_32_772 244
361 3300046501 Ga0495607_0000003 Ga0495607_0000003_145138_145872 244
362 3300046501 Ga0495607_0006428 Ga0495607_0006428_1540_2274 244
363 3300046506 Ga0495583_0052521 Ga0495583_0052521_170_910 244
364 3300046507 Ga0495606_0013143 Ga0495606_0013143_1701_2441 244
365 3300046507 Ga0495606_0158149 Ga0495606_0158149_183_923 244
366 3300046512 Ga0495610_0003962 Ga0495610_0003962_9524_10258 244
367 3300046512 Ga0495610_0048209 Ga0495610_0048209_886_1626 244
368 3300046515 Ga0495620_0010680 Ga0495620_0010680_2822_3562 244
369 3300046515 Ga0495620_0042467 Ga0495620_0042467_641_1375 244
370 3300046516 Ga0495628_0078892 Ga0495628_0078892_739_1479 244
371 3300046516 Ga0495628_0083641 Ga0495628_0083641_642_1376 244
372 3300046516 Ga0495628_0118907 Ga0495628_0118907_1156_1890 244
373 3300046518 Ga0495631_0013587 Ga0495631_0013587_2662_3402 244
374 3300046519 Ga0495632_0000011 Ga0495632_0000011_53812_54546 244
375 3300046519 Ga0495632_0045284 Ga0495632_0045284_1206_1991 244
376 3300046522 Ga0495643_0064488 Ga0495643_0064488_778_1512 244
377 3300046523 Ga0495644_0084886 Ga0495644_0084886_190_924 244
378 3300046524 Ga0495648_0015660 Ga0495648_0015660_1947_2681 244
379 3300046526 Ga0495666_0007678 Ga0495666_0007678_3959_4693 244
380 3300046526 Ga0495666_0011577 Ga0495666_0011577_1519_2259 244
381 3300046529 Ga0495652_0008645 Ga0495652_0008645_1629_2363 244
382 3300046529 Ga0495652_0162927 Ga0495652_0162927_867_1607 244
383 3300046531 Ga0495665_0007483 Ga0495665_0007483_5094_5828 244
384 3300046533 Ga0495640_0039687 Ga0495640_0039687_417_1151 244
385 3300046533 Ga0495640_0133563 Ga0495640_0133563_601_1335 244
386 3300046535 Ga0495586_0108428 Ga0495586_0108428_142_876 244
387 3300046536 Ga0495587_0002208 Ga0495587_0002208_12168_12902 244
388 3300046542 Ga0495597_0082090 Ga0495597_0082090_393_1169 244
389 3300046543 Ga0495645_0017306 Ga0495645_0017306_2725_3459 244
390 3300046557 Ga0495622_0005125 Ga0495622_0005125_2652_3392 244
391 3300046559 Ga0495667_0082116 Ga0495667_0082116_295_1029 244
392 3300046615 Ga0495656_0083826 Ga0495656_0083826_631_1365 244
393 3300046616 Ga0495668_0086279 Ga0495668_0086279_42_782 244
394 3300046616 Ga0495668_0139747 Ga0495668_0139747_402_1142 244
395 3300046616 Ga0495668_0224633 Ga0495668_0224633_17_751 244
396 3300046642 Ga0495634_0002799 Ga0495634_0002799_1966_2700 244
397 3300046642 Ga0495634_0015769 Ga0495634_0015769_1764_2498 244
398 3300046642 Ga0495634_0352747 Ga0495634_0352747_18_758 244
399 3300046648 Ga0495611_0243369 Ga0495611_0243369_78_812 244
400 3300046660 Ga0495625_0070173 Ga0495625_0070173_1584_2318 244
401 3300046660 Ga0495625_0131059 Ga0495625_0131059_621_1355 244
402 3300046663 Ga0495635_0018136 Ga0495635_0018136_1923_2657 244
403 3300046663 Ga0495635_0027949 Ga0495635_0027949_2875_3615 244
404 3300046663 Ga0495635_0028962 Ga0495635_0028962_2442_3176 244
405 3300046664 Ga0495659_0128384 Ga0495659_0128384_62_796 244
406 3300046675 Ga0495657_0003480 Ga0495657_0003480_9692_10426 244
407 3300046675 Ga0495657_0149755 Ga0495657_0149755_672_1406 244
408 3300046678 Ga0495599_0052346 Ga0495599_0052346_884_1618 244
409 3300046678 Ga0495599_0151737 Ga0495599_0151737_513_1253 244
410 3300046680 Ga0495646_0020602 Ga0495646_0020602_23_757 244
411 3300046689 Ga0495613_0000388 Ga0495613_0000388_24185_24925 244
412 3300046689 Ga0495613_0004110 Ga0495613_0004110_4913_5647 244
413 3300046692 Ga0495671_0007655 Ga0495671_0007655_3449_4183 244
414 3300046694 Ga0495649_0036301 Ga0495649_0036301_1280_2020 244
415 3300046694 Ga0495649_0068614 Ga0495649_0068614_356_1096 244
416 3300046694 Ga0495649_0070671 Ga0495649_0070671_449_1183 244
417 3300046794 Ga0495589_0015740 Ga0495589_0015740_1818_2558 244
418 3300046794 Ga0495589_0059236 Ga0495589_0059236_1133_1867 244
419 3300046809 Ga0495600_0010883 Ga0495600_0010883_4462_5196 244
420 3300046809 Ga0495600_0011870 Ga0495600_0011870_387_1121 244
421 3300046810 Ga0495660_0004309 Ga0495660_0004309_2823_3563 244
422 3300046810 Ga0495660_0142233 Ga0495660_0142233_400_1134 244
423 3300047315 Ga0495581_0069558 Ga0495581_0069558_1268_2002 244
424 3300047317 Ga0495604_0000545 Ga0495604_0000545_1377_2111 244
425 3300047317 Ga0495604_0005331 Ga0495604_0005331_1688_2422 244
426 3300047317 Ga0495604_0180506 Ga0495604_0180506_574_1308 244
427 3300047317 Ga0495604_0244205 Ga0495604_0244205_268_1002 244
428 3300047318 Ga0495636_0064025 Ga0495636_0064025_632_1366 244
429 3300047319 Ga0495674_0079786 Ga0495674_0079786_770_1504 244
430 3300047320 Ga0495672_0003747 Ga0495672_0003747_7416_8150 244
431 3300047321 Ga0495676_0000488 Ga0495676_0000488_11266_12000 244
432 3300047321 Ga0495676_0000537 Ga0495676_0000537_29828_30562 244
433 3300047321 Ga0495676_0051310 Ga0495676_0051310_1779_2519 244
434 3300047321 Ga0495676_0105662 Ga0495676_0105662_538_1272 244
435 3300047323 Ga0495683_0002011 Ga0495683_0002011_6273_7013 244
436 3300047323 Ga0495683_0092272 Ga0495683_0092272_681_1415 244
437 3300047443 Ga0495687_002019 Ga0495687_002019_43_777 244
438 3300047443 Ga0495687_015680 Ga0495687_015680_2159_2899 244
439 3300047443 Ga0495687_017402 Ga0495687_017402_236_976 244
440 3300047443 Ga0495687_047628 Ga0495687_047628_158_898 244
441 3300047444 Ga0495675_0044013 Ga0495675_0044013_1783_2517 244
442 3300047445 Ga0495677_0018742 Ga0495677_0018742_954_1694 244
443 3300047447 Ga0495685_004037 Ga0495685_004037_863_1603 244
444 3300047447 Ga0495685_006708 Ga0495685_006708_128_862 244
445 3300047447 Ga0495685_043554 Ga0495685_043554_196_930 244
446 3300047469 Ga0495673_0011418 Ga0495673_0011418_3981_4715 244
447 3300047470 Ga0495681_0002530 Ga0495681_0002530_2184_2918 244
448 3300047470 Ga0495681_0016827 Ga0495681_0016827_3208_3942 244
449 3300047472 Ga0495686_0063234 Ga0495686_0063234_197_937 244
450 3300047472 Ga0495686_0129789 Ga0495686_0129789_373_1107 244
451 3300047673 Ga0495593_0000258 Ga0495593_0000258_15261_15995 244
452 3300048088 Ga0495602_0075504 Ga0495602_0075504_1485_2219 244
453 3300048089 Ga0495614_0002843 Ga0495614_0002843_3644_4378 244
454 3300048089 Ga0495614_0005593 Ga0495614_0005593_2834_3568 244
455 3300048089 Ga0495614_0100204 Ga0495614_0100204_436_1176 244
456 3300048903 Ga0496100_0348756 Ga0496100_0348756_38_772 244
457 3300048904 Ga0496101_0000130 Ga0496101_0000130_26665_27432 244
458 3300048904 Ga0496101_0091574 Ga0496101_0091574_1079_1813 244
459 3300048905 Ga0496102_0000014 Ga0496102_0000014_75792_76559 244
460 3300048905 Ga0496102_0000716 Ga0496102_0000716_14952_15686 244
461 3300048905 Ga0496102_0284295 Ga0496102_0284295_532_1266 244
462 3300048905 Ga0496102_0523791 Ga0496102_0523791_300_1034 244
463 3300048906 Ga0496103_0000004 Ga0496103_0000004_76298_77065 244
464 3300048906 Ga0496103_0000767 Ga0496103_0000767_6104_6838 244
465 3300048906 Ga0496103_0148920 Ga0496103_0148920_382_1116 244
466 3300048907 Ga0496104_0133734 Ga0496104_0133734_160_894 244
467 3300048907 Ga0496104_0387593 Ga0496104_0387593_284_1024 244
468 3300048908 Ga0496105_0056792 Ga0496105_0056792_682_1431 244
469 3300048909 Ga0496106_0058828 Ga0496106_0058828_1480_2229 244
470 3300048909 Ga0496106_0640388 Ga0496106_0640388_12_746 244
471 3300048909 Ga0496106_0738621 Ga0496106_0738621_23_757 244
472 3300048910 Ga0496107_0019547 Ga0496107_0019547_2089_2856 244
473 3300048910 Ga0496107_0088217 Ga0496107_0088217_962_1711 244
474 3300048911 Ga0496108_0024849 Ga0496108_0024849_2705_3454 244
475 3300048911 Ga0496108_0140686 Ga0496108_0140686_972_1706 244
476 3300048912 Ga0496109_0092370 Ga0496109_0092370_1254_2003 244
477 3300048912 Ga0496109_0345965 Ga0496109_0345965_218_958 244
478 3300048912 Ga0496109_0372284 Ga0496109_0372284_126_860 244
479 3300048912 Ga0496109_0377733 Ga0496109_0377733_182_940 244
480 3300048913 Ga0496110_0162349 Ga0496110_0162349_1234_1983 244
481 3300048914 Ga0496111_0006478 Ga0496111_0006478_682_1431 244
482 3300048914 Ga0496111_0176789 Ga0496111_0176789_213_953 244
483 3300048914 Ga0496111_0246255 Ga0496111_0246255_453_1187 244
484 3300048915 Ga0496112_0005279 Ga0496112_0005279_6467_7201 244
485 3300048915 Ga0496112_0121764 Ga0496112_0121764_52_801 244
486 3300048915 Ga0496112_0158609 Ga0496112_0158609_839_1573 244
487 3300048917 Ga0496114_0119792 Ga0496114_0119792_1417_2151 244
488 3300048918 Ga0496115_0010369 Ga0496115_0010369_3627_4367 244
489 3300048919 Ga0496116_0000069 Ga0496116_0000069_77249_78016 244
490 3300048919 Ga0496116_0069768 Ga0496116_0069768_57_791 244
491 3300048920 Ga0496117_0000003 Ga0496117_0000003_1274701_1275468 244
492 3300048920 Ga0496117_0000687 Ga0496117_0000687_4323_5057 244
493 3300048921 Ga0496118_0000001 Ga0496118_0000001_1274704_1275471 244
494 3300048921 Ga0496118_0003018 Ga0496118_0003018_3989_4723 244
495 3300048922 Ga0496119_0000588 Ga0496119_0000588_2485_3252 244
496 3300048922 Ga0496119_0031696 Ga0496119_0031696_1611_2345 244
497 3300048922 Ga0496119_0038081 Ga0496119_0038081_733_1467 244
498 3300048923 Ga0496120_0000085 Ga0496120_0000085_78672_79439 244
499 3300048923 Ga0496120_0014771 Ga0496120_0014771_2215_2949 244
500 3300048924 Ga0496121_0000032 Ga0496121_0000032_165083_165850 244
501 3300048924 Ga0496121_0006420 Ga0496121_0006420_13270_14004 244
502 3300048924 Ga0496121_0058734 Ga0496121_0058734_329_1078 244
503 3300048924 Ga0496121_0120791 Ga0496121_0120791_722_1456 244
504 3300048925 Ga0496122_0000495 Ga0496122_0000495_74205_74966 244
505 3300048927 Ga0496124_0001784 Ga0496124_0001784_4892_5626 244
506 3300048927 Ga0496124_0096079 Ga0496124_0096079_173_907 244
507 3300048928 Ga0496125_0090825 Ga0496125_0090825_716_1450 244
508 3300048929 Ga0496126_0000006 Ga0496126_0000006_719928_720662 244
509 3300048929 Ga0496126_0000007 Ga0496126_0000007_476026_476760 244
510 3300048929 Ga0496126_0000067 Ga0496126_0000067_235947_236714 244
511 3300048929 Ga0496126_0044285 Ga0496126_0044285_1420_2154 244
512 3300048929 Ga0496126_0143568 Ga0496126_0143568_316_1050 244
513 3300048929 Ga0496126_0243130 Ga0496126_0243130_429_1172 244
514 3300048929 Ga0496126_0268072 Ga0496126_0268072_598_1332 244
515 3300049459 Ga0495678_070981 Ga0495678_070981_213_989 244
516 3300049459 Ga0495678_083088 Ga0495678_083088_80_814 244
517 3300049568 Ga0501031_0001335 Ga0501031_0001335_10630_11364 244
518 3300049568 Ga0501031_0017651 Ga0501031_0017651_1650_2390 244
519 3300049568 Ga0501031_0018173 Ga0501031_0018173_3144_3878 244
520 3300049568 Ga0501031_0105735 Ga0501031_0105735_984_1733 244
521 3300049568 Ga0501031_0113300 Ga0501031_0113300_444_1178 244
522 3300049568 Ga0501031_0126986 Ga0501031_0126986_452_1186 244
523 3300049569 Ga0501032_0003786 Ga0501032_0003786_988_1722 244
524 3300049569 Ga0501032_0005456 Ga0501032_0005456_1697_2437 244
525 3300049569 Ga0501032_0049802 Ga0501032_0049802_1431_2165 244
526 3300049569 Ga0501032_0070417 Ga0501032_0070417_1264_1998 244
527 3300049569 Ga0501032_0123993 Ga0501032_0123993_633_1367 244
528 3300049570 Ga0501033_0001264 Ga0501033_0001264_20148_20888 244
529 3300049570 Ga0501033_0006971 Ga0501033_0006971_820_1554 244
530 3300049570 Ga0501033_0044526 Ga0501033_0044526_1585_2319 244
531 3300049570 Ga0501033_0103818 Ga0501033_0103818_500_1234 244
532 3300049570 Ga0501033_0265387 Ga0501033_0265387_220_954 244
533 3300049571 Ga0501034_0005213 Ga0501034_0005213_10646_11380 244
534 3300049571 Ga0501034_0010784 Ga0501034_0010784_7075_7815 244
535 3300049571 Ga0501034_0012929 Ga0501034_0012929_2691_3425 244
536 3300049571 Ga0501034_0205101 Ga0501034_0205101_656_1390 244
537 3300049571 Ga0501034_0315739 Ga0501034_0315739_61_810 244
538 3300049572 Ga0501036_0006405 Ga0501036_0006405_1651_2391 244
539 3300049572 Ga0501036_0011299 Ga0501036_0011299_5580_6314 244
540 3300049572 Ga0501036_0017921 Ga0501036_0017921_4593_5327 244
541 3300049572 Ga0501036_0273334 Ga0501036_0273334_214_948 244
542 3300049573 Ga0501037_0005145 Ga0501037_0005145_1673_2413 244
543 3300049573 Ga0501037_0056835 Ga0501037_0056835_190_924 244
544 3300049574 Ga0501038_0007464 Ga0501038_0007464_7418_8152 244
545 3300049574 Ga0501038_0007801 Ga0501038_0007801_7252_7992 244
546 3300049574 Ga0501038_0103810 Ga0501038_0103810_1533_2267 244
547 3300049575 Ga0501039_0057593 Ga0501039_0057593_642_1382 244
548 3300049575 Ga0501039_0113780 Ga0501039_0113780_1308_2063 244
549 3300049576 Ga0501040_0145671 Ga0501040_0145671_212_946 244
550 3300049576 Ga0501040_0173011 Ga0501040_0173011_82_822 244
551 3300049578 Ga0501042_0001445 Ga0501042_0001445_3075_3809 244
552 3300049578 Ga0501042_0026449 Ga0501042_0026449_2940_3674 244
553 3300049579 Ga0501043_0006022 Ga0501043_0006022_7141_7881 244
554 3300049579 Ga0501043_0007957 Ga0501043_0007957_839_1573 244
555 3300049579 Ga0501043_0067766 Ga0501043_0067766_1703_2437 244
556 3300049579 Ga0501043_0084665 Ga0501043_0084665_1212_1946 244
557 3300049579 Ga0501043_0134259 Ga0501043_0134259_140_946 244
558 3300049579 Ga0501043_0287764 Ga0501043_0287764_424_1158 244
559 3300049580 Ga0501046_0007551 Ga0501046_0007551_1838_2578 244
560 3300049580 Ga0501046_0037499 Ga0501046_0037499_1678_2412 244
561 3300049581 Ga0501047_0000575 Ga0501047_0000575_36495_37235 244
562 3300049581 Ga0501047_0002966 Ga0501047_0002966_10920_11654 244
563 3300049581 Ga0501047_0003526 Ga0501047_0003526_3379_4113 244
564 3300049581 Ga0501047_0013474 Ga0501047_0013474_2777_3511 244
565 3300049581 Ga0501047_0111883 Ga0501047_0111883_465_1199 244
566 3300049581 Ga0501047_0180172 Ga0501047_0180172_227_961 244
567 3300049581 Ga0501047_0236047 Ga0501047_0236047_323_1072 244
568 3300049582 Ga0501048_0003067 Ga0501048_0003067_1678_2412 244
569 3300049582 Ga0501048_0005624 Ga0501048_0005624_1693_2433 244
570 3300049582 Ga0501048_0031140 Ga0501048_0031140_987_1721 244
571 3300049586 Ga0501070_0007297 Ga0501070_0007297_6969_7709 244
572 3300049586 Ga0501070_0061016 Ga0501070_0061016_1918_2652 244
573 3300049587 Ga0501071_0519030 Ga0501071_0519030_165_899 244
574 3300049589 Ga0501073_0005674 Ga0501073_0005674_6927_7667 244
575 3300049589 Ga0501073_0029923 Ga0501073_0029923_1554_2288 244
576 3300049589 Ga0501073_0176902 Ga0501073_0176902_391_1125 244
577 3300049590 Ga0501074_0033129 Ga0501074_0033129_2991_3725 244
578 3300049590 Ga0501074_0073364 Ga0501074_0073364_72_812 244
579 3300049741 Ga0501079_0059947 Ga0501079_0059947_1726_2466 244
580 3300049742 Ga0501080_0082989 Ga0501080_0082989_1571_2311 244
581 3300049742 Ga0501080_0184073 Ga0501080_0184073_647_1381 244
582 3300049744 Ga0501083_0005021 Ga0501083_0005021_6952_7692 244
583 3300049744 Ga0501083_0043593 Ga0501083_0043593_119_853 244
584 3300049822 Ga0501035_0000248 Ga0501035_0000248_1731_2471 244
585 3300049822 Ga0501035_0003898 Ga0501035_0003898_10619_11353 244
586 3300049822 Ga0501035_0101308 Ga0501035_0101308_35_775 244
587 3300049822 Ga0501035_0251519 Ga0501035_0251519_449_1183 244
588 3300049823 Ga0501044_0003376 Ga0501044_0003376_1731_2471 244
589 3300049823 Ga0501044_0004950 Ga0501044_0004950_3520_4254 244
590 3300049823 Ga0501044_0018070 Ga0501044_0018070_1019_1753 244
591 3300049823 Ga0501044_0259717 Ga0501044_0259717_78_812 244
592 3300049823 Ga0501044_0445345 Ga0501044_0445345_441_1175 244
593 3300049823 Ga0501044_0605383 Ga0501044_0605383_170_904 244
594 3300049824 Ga0501045_0291370 Ga0501045_0291370_412_1152 244
595 3300050490 nmdc:mga03n38_1856_c2 nmdc:mga03n38_1856_c2_3673_4407 244
596 3300050490 nmdc:mga03n38_48390_c1 nmdc:mga03n38_48390_c1_94_828 244
597 3300050491 nmdc:mga00v17_7166_c1 nmdc:mga00v17_7166_c1_537_1271 244
598 3300050492 nmdc:mga0yw44_5415_c1 nmdc:mga0yw44_5415_c1_2604_3344 244
599 3300050494 nmdc:mga06z11_420152_c1 nmdc:mga06z11_420152_c1_51_791 244
600 3300050496 nmdc:mga07m45_2025_c1 nmdc:mga07m45_2025_c1_441_1175 244
601 3300050511 nmdc:mga08y16_745885_c1 nmdc:mga08y16_745885_c1_225_965 244
602 3300050516 nmdc:mga0sz30_167564_c1 nmdc:mga0sz30_167564_c1_161_895 244
603 3300050516 nmdc:mga0sz30_91566_c1 nmdc:mga0sz30_91566_c1_256_990 244
604 3300053077 Ga0495601_0000519 Ga0495601_0000519_15596_16336 244
605 3300053080 Ga0500635_0004864 Ga0500635_0004864_80_823 244
606 3300053085 Ga0495619_0044864 Ga0495619_0044864_623_1357 244
607 3300053086 Ga0500578_0062317 Ga0500578_0062317_58_792 244
608 3300053086 Ga0500578_0227007 Ga0500578_0227007_342_1082 244
609 3300053088 Ga0500644_0102111 Ga0500644_0102111_144_878 244
610 3300053092 Ga0500583_0101740 Ga0500583_0101740_47_781 244
611 3300053095 Ga0500640_007318 Ga0500640_007318_2344_3078 244
612 3300053098 Ga0500650_0234462 Ga0500650_0234462_22_762 244
613 3300053099 Ga0500654_046623 Ga0500654_046623_523_1257 244
614 3300053100 Ga0500660_107726 Ga0500660_107726_170_904 244
615 3300053101 Ga0500553_030046 Ga0500553_030046_840_1574 244
616 3300053107 Ga0500560_004220 Ga0500560_004220_2268_3002 244
617 3300053109 Ga0500569_012505 Ga0500569_012505_559_1293 244
618 3300053111 Ga0500572_007340 Ga0500572_007340_1231_1965 244
619 3300053118 Ga0500594_0091823 Ga0500594_0091823_20_754 244
620 3300053122 Ga0500608_096599 Ga0500608_096599_311_1045 244
621 3300053123 Ga0500614_047212 Ga0500614_047212_113_847 244
622 3300053129 Ga0500628_004523 Ga0500628_004523_758_1492 244
623 3300053131 Ga0500652_000402 Ga0500652_000402_13245_13988 244
624 3300053134 Ga0500658_0037842 Ga0500658_0037842_524_1258 244
625 3300053136 Ga0500559_0000719 Ga0500559_0000719_2601_3335 244
626 3300053137 Ga0500561_0013747 Ga0500561_0013747_916_1650 244
627 3300053139 Ga0500568_0000579 Ga0500568_0000579_4251_5003 244
628 3300053143 Ga0500579_048915 Ga0500579_048915_1707_2441 244
629 3300053149 Ga0500600_0029597 Ga0500600_0029597_1647_2381 244
630 3300053149 Ga0500600_0151971 Ga0500600_0151971_308_1048 244
631 3300053153 Ga0500616_0000483 Ga0500616_0000483_42095_42847 244
632 3300053153 Ga0500616_0002364 Ga0500616_0002364_6523_7257 244
633 3300053153 Ga0500616_0035701 Ga0500616_0035701_311_1045 244
634 3300053160 Ga0500633_0020650 Ga0500633_0020650_450_1184 244
635 3300053177 Ga0500636_0208114 Ga0500636_0208114_222_956 244
636 3300053730 Ga0500645_000017 Ga0500645_000017_49686_50429 244
637 3300053730 Ga0500645_000017 Ga0500645_000017_51252_51986 244
638 3300053732 Ga0500656_000122 Ga0500656_000122_458_1192 244
639 3300053736 Ga0500599_008279 Ga0500599_008279_48_788 244
640 3300053739 Ga0500587_002769 Ga0500587_002769_558_1292 244
641 3300054114 Ga0501084_0422920 Ga0501084_0422920_144_899 244
642 3300060353 Ga0501082_0029555 Ga0501082_0029555_2142_2882 244
643 iso_pu_bacteria 2870721527 2870725419 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

36

225

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

42

271

0.94

PF08659

KR

KR domain

37

208

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bmn-assembly1.cif.gz_B apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9824 4 243
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.9789 1 243
4i5f-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s 0.9787 1 243
6ihi-assembly1.cif.gz_B crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.9776 3 243
4bmn-assembly1.cif.gz_D apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.976 3 243
ID Description Score Start End Superfamily
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9655 3 243 3.40.50.720
3rihC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9571 3 241 3.40.50.720
af_Q0JBH4_12_100_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9532 7 84 3.40.50.720
af_I1LJY0_35_302_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9526 4 242 3.40.50.720
af_I6YCF0_1_258_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9499 1 235 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A832MUH5-F1-model_v4 SDR family oxidoreductase 0.9832 1 184 GO:0016491
AF-A0A7Y3J8K4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9781 3 185 GO:0016491
AF-A0A328AS06-F1-model_v4 Oxidoreductase 0.9627 3 243 GO:0006633
GO:0016616
GO:0048038
AF-A0A4R7MS84-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9605 2 243 GO:0006633
GO:0016616
GO:0048038
AF-A0A2U1T022-F1-model_v4 Short-chain dehydrogenase 0.9601 2 243 GO:0016616
GO:0030497

Feature Viewer

pLDDT pTM Quality
95.04 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map