F471782

General Info

Members Datasets Scaffolds Average Seq Length
641 309 559 200

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10009294|Ga0157369_1000929411
Length 234
Sequence MIEIPSGLPSELVPLSWLIGVWEGTGVIDYQVGDETVTREFGQRVSFSHDGLPYLNYNSYTWLLPEQPPRDAEGASSTDEDALSDDTAADVAPEAHPVDESGVPEPLVTETGYWRLERPLIEGDPGPGMLPGQGPRPFGTAQSVETLRTSTGAFPLQVSIVHPNGVSELYLGQIDGPRIDLATDAVVRTAGAKEYAAATRLYGLVENHLLWAWDIAALGQDLRTHASARLAKAD

Samples

Sample ID Description Type Environment
1 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
2 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
3 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
4 2643221546 Microbacterium sp. Root53 Isolate Unclassified
5 2643221549 Agromyces sp. Root1464 Isolate Unclassified
6 2643221553 Microbacterium sp. Root553 Isolate Unclassified
7 2643221566 Microbacterium sp. Root166 Isolate Unclassified
8 2643221572 Leifsonia sp. Root60 Isolate Unclassified
9 2643221597 Microbacterium sp. Root180 Isolate Unclassified
10 2643221616 Leifsonia sp. Root227 Isolate Unclassified
11 2643221619 Agromyces sp. Root81 Isolate Unclassified
12 2643221630 Microbacterium sp. Root322 Isolate Unclassified
13 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
14 2643221649 Leifsonia sp. Root4 Isolate Unclassified
15 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
16 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
17 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
18 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
19 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
20 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
21 2773857759 Microbacterium sp. 1294 Isolate Unclassified
22 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
23 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
24 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
25 2808606372 Agromyces sp. 23-23 Isolate Unclassified
26 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
27 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
28 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
29 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
30 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
31 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
32 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
33 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
34 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
35 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
36 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
37 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
38 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
39 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
40 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
41 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
42 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
43 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
44 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
45 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
46 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
47 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
48 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
49 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
50 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
51 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
52 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
53 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
54 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
55 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
56 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
57 2919395869 Microbacterium resistens 2980 Isolate Unclassified
58 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
59 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
60 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
61 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
62 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
63 2928153084 Leifsonia sp. 563 Isolate Unclassified
64 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
65 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
66 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
67 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
68 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
69 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
70 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
71 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
72 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
73 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
74 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
75 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
76 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
77 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
78 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
79 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
80 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
81 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
82 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
83 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
84 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
85 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
86 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
87 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
88 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
89 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
90 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
91 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
92 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
93 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
94 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
95 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
96 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
97 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
98 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
99 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
100 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
101 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
102 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
103 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
104 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
105 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
106 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
107 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
108 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
109 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
110 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
111 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
112 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
113 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
114 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
115 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
116 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
117 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
118 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
119 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
120 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
121 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
122 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
123 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
152 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
154 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
157 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
202 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
203 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
204 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
205 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
206 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
207 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
208 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
211 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
212 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
213 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
214 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
218 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
226 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
227 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
228 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
229 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
230 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
231 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
232 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
233 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
234 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
250 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
251 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
252 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
253 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
254 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
255 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
256 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
257 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
275 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
276 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
277 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
280 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
287 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
290 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
291 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
292 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
293 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
294 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
295 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
296 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
297 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
298 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
299 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
300 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
301 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
302 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
303 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
304 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
305 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
306 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
307 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
308 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
309 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.65
Metatranscriptomes 1.56
Isolates 12.79

Biome Distribution

Category Percentage (%)
Aerial Root 0.31
Bulb 0
Endosphere 13.1
Nodule 0
Rhizoplane 7.96
Rhizosphere 58.81
Stem 0
Stem Tuber 0.16
Unclassified 19.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001187 3300001979 Bacteria 11742
2 JGI24735J21928_10000949 3300002067 Bacteria 10348
3 JGI25164J39214_1000221 3300002772 Bacteria 45392
4 JGI25165J46597_1000332 3300003214 Bacteria 56112
5 rootH1_10080781 3300003316 Bacteria 1652
6 rootH2_10097482 3300003320 Bacteria 2410
7 rootH1_10019641 3300003323 Bacteria 2128
8 Ga0006562J51391_1008124 3300003578 Bacteria 25634
9 Ga0006562J51391_1008125 3300003578 Bacteria 24266
10 Ga0006562J51391_1023978 3300003578 Bacteria 13390
11 Ga0006562J51391_1023979 3300003578 Bacteria 3530
12 Ga0055539_1000005 3300003752 Bacteria 609598
13 Ga0055533_1000001 3300003756 Bacteria 1863437
14 Ga0055525_1000290 3300003759 Bacteria 45300
15 Ga0055525_1003999 3300003759 Bacteria 1281
16 Ga0055527_1000017 3300003760 Bacteria 242362
17 Ga0055542_1000044 3300003762 Bacteria 206982
18 Ga0055529_1000093 3300003763 Bacteria 137160
19 Ga0055541_1001300 3300003841 Bacteria 5474
20 Ga0065714_10076428 3300005288 Bacteria 2792
21 Ga0070658_10000242 3300005327 Bacteria 48504
22 Ga0070658_10009630 3300005327 Bacteria 7757
23 Ga0070658_10066751 3300005327 Bacteria 2939
24 Ga0068868_100016511 3300005338 Bacteria 5484
25 Ga0070660_100009493 3300005339 Bacteria 6846
26 Ga0070660_100428178 3300005339 Bacteria 1096
27 Ga0070660_100880850 3300005339 Bacteria 754
28 Ga0070675_100202895 3300005354 Bacteria 1721
29 Ga0070671_100150166 3300005355 Bacteria 1967
30 Ga0070659_100003188 3300005366 Bacteria 11679
31 Ga0070667_100064057 3300005367 Bacteria 3118
32 Ga0070714_100843946 3300005435 Bacteria 888
33 Ga0070710_10113730 3300005437 Bacteria 1629
34 Ga0070663_100094154 3300005455 Bacteria 2224
35 Ga0070663_101015798 3300005455 Bacteria 722
36 Ga0070662_100420868 3300005457 Bacteria 1105
37 Ga0070685_10002096 3300005466 Bacteria 10301
38 Ga0070679_100216383 3300005530 Bacteria 1878
39 Ga0070684_100349454 3300005535 Bacteria 1360
40 Ga0068853_100214117 3300005539 Bacteria 1757
41 Ga0070672_100002268 3300005543 Bacteria 12135
42 Ga0068855_100001410 3300005563 Bacteria 29846
43 Ga0068855_100352282 3300005563 Bacteria 1621
44 Ga0068855_100370070 3300005563 Bacteria 1575
45 Ga0068855_100518004 3300005563 Bacteria 1294
46 Ga0068856_100162895 3300005614 Bacteria 2241
47 Ga0068852_100033847 3300005616 Bacteria 4247
48 Ga0068864_100039667 3300005618 Bacteria 4024
49 Ga0068864_100356062 3300005618 Bacteria 1382
50 Ga0068870_10089760 3300005840 Bacteria 1716
51 Ga0068863_100185860 3300005841 Bacteria 1996
52 Ga0068858_100000023 3300005842 Bacteria 167824
53 Ga0075365_10002264 3300006038 Bacteria 9333
54 Ga0075365_10016097 3300006038 Bacteria 4539
55 Ga0075365_10029912 3300006038 Bacteria 3484
56 Ga0075365_10304126 3300006038 Bacteria 1122
57 Ga0075363_100026400 3300006048 Bacteria 2971
58 Ga0075363_100253286 3300006048 Bacteria 1014
59 Ga0075364_10005896 3300006051 Bacteria 7157
60 Ga0075364_10007603 3300006051 Bacteria 6443
61 Ga0075364_10017368 3300006051 Bacteria 4494
62 Ga0075364_10019310 3300006051 Bacteria 4277
63 Ga0075364_10122135 3300006051 Bacteria 1744
64 Ga0075367_10001326 3300006178 Bacteria 10498
65 Ga0075369_10016635 3300006186 Bacteria 2971
66 Ga0075369_10039246 3300006186 Bacteria 2022
67 Ga0075369_10212643 3300006186 Bacteria 894
68 Ga0075370_10004060 3300006353 Bacteria 7039
69 Ga0105251_10248385 3300009011 Bacteria 802
70 Ga0105244_10017100 3300009036 Bacteria 4110
71 Ga0105244_10068730 3300009036 Bacteria 1770
72 Ga0105240_10156128 3300009093 Bacteria 2713
73 Ga0111539_11952035 3300009094 Bacteria 681
74 Ga0105245_10004311 3300009098 Bacteria 12593
75 Ga0105245_10282540 3300009098 Bacteria 1623
76 Ga0105243_10001650 3300009148 Bacteria 19335
77 Ga0105243_10330156 3300009148 Bacteria 1393
78 Ga0105248_10000424 3300009177 Bacteria 48349
79 Ga0105248_10077758 3300009177 Bacteria 3730
80 Ga0105248_10191194 3300009177 Bacteria 2306
81 Ga0105237_10074674 3300009545 Bacteria 3382
82 Ga0105237_10250699 3300009545 Bacteria 1772
83 Ga0105238_10003710 3300009551 Bacteria 15197
84 Ga0105238_10528942 3300009551 Bacteria 1182
85 Ga0105239_10787350 3300010375 Bacteria 1089
86 Ga0105239_11174227 3300010375 Bacteria 884
87 Ga0157371_10001468 3300013102 Bacteria 24466
88 Ga0157371_10211189 3300013102 Bacteria 1393
89 Ga0157371_10305818 3300013102 Bacteria 1152
90 Ga0157370_10035185 3300013104 Bacteria 4871
91 Ga0157370_10125266 3300013104 Bacteria 2398
92 Ga0157370_10162974 3300013104 Bacteria 2074
93 Ga0157370_10198313 3300013104 Bacteria 1862
94 Ga0157369_10001655 3300013105 Bacteria 27181
95 Ga0157369_10009294 3300013105 Bacteria 11244
96 Ga0157369_10022781 3300013105 Bacteria 6985
97 Ga0157369_10179443 3300013105 Bacteria 2228
98 Ga0157369_10190543 3300013105 Bacteria 2155
99 Ga0157369_10294494 3300013105 Bacteria 1689
100 Ga0157369_10318378 3300013105 Bacteria 1617
101 Ga0157369_10930617 3300013105 Bacteria 891
102 Ga0171462_1004 3300013250 Bacteria 678877
103 Ga0163162_10298489 3300013306 Bacteria 1743
104 Ga0163162_10573119 3300013306 Bacteria 1256
105 Ga0157375_10358230 3300013308 Bacteria 1625
106 Ga0163163_10476093 3300014325 Bacteria 1309
107 Ga0163163_10835155 3300014325 Bacteria 985
108 Ga0157380_10002067 3300014326 Bacteria 13444
109 Ga0197907_11172585 3300020069 Bacteria 863
110 Ga0206356_10767943 3300020070 Bacteria 2561
111 Ga0206354_11038418 3300020081 Bacteria 1696
112 Ga0206353_10979951 3300020082 Bacteria 1214
113 Ga0206353_11859887 3300020082 Bacteria 2980
114 Ga0224712_10048179 3300022467 Bacteria 1644
115 Ga0209566_100053 3300025225 Bacteria 224436
116 Ga0209674_100001 3300025226 Bacteria 4013750
117 Ga0209672_100039 3300025228 Bacteria 283064
118 Ga0209147_100651 3300025229 Bacteria 18119
119 Ga0209563_100001 3300025230 Bacteria 4013775
120 Ga0209563_100314 3300025230 Bacteria 19197
121 Ga0207427_100042 3300025231 Bacteria 254170
122 Ga0209437_100883 3300025233 Bacteria 12120
123 Ga0209258_100996 3300025242 Bacteria 13076
124 Ga0209646_1000013 3300025246 Bacteria 565830
125 Ga0209677_100001 3300025253 Bacteria 4013787
126 Ga0209677_100767 3300025253 Bacteria 16274
127 Ga0209148_1000004 3300025254 Bacteria 1844481
128 Ga0209233_1000001 3300025261 Bacteria 2992747
129 Ga0209455_1000117 3300025272 Bacteria 176940
130 Ga0209455_1001672 3300025272 Bacteria 9560
131 Ga0207655_1017153 3300025728 Bacteria 3918
132 Ga0207655_1025611 3300025728 Bacteria 2858
133 Ga0207692_10052701 3300025898 Bacteria 2069
134 Ga0207647_10018242 3300025904 Bacteria 4753
135 Ga0207647_10103309 3300025904 Bacteria 1690
136 Ga0207647_10111676 3300025904 Bacteria 1616
137 Ga0207643_10107185 3300025908 Bacteria 1643
138 Ga0207705_10000001 3300025909 Bacteria 2061880
139 Ga0207705_10044136 3300025909 Bacteria 3203
140 Ga0207705_10192387 3300025909 Bacteria 1543
141 Ga0207705_10334607 3300025909 Bacteria 1165
142 Ga0207695_10017263 3300025913 Bacteria 8403
143 Ga0207671_10041954 3300025914 Bacteria 3386
144 Ga0207657_10054893 3300025919 Bacteria 3443
145 Ga0207657_10141957 3300025919 Bacteria 1962
146 Ga0207657_10191700 3300025919 Bacteria 1648
147 Ga0207652_10350399 3300025921 Bacteria 1332
148 Ga0207694_10000052 3300025924 Bacteria 157700
149 Ga0207687_10020338 3300025927 Bacteria 4403
150 Ga0207690_10000618 3300025932 Bacteria 22985
151 Ga0207709_10005233 3300025935 Bacteria 7381
152 Ga0207709_10044868 3300025935 Bacteria 2674
153 Ga0207709_10072755 3300025935 Bacteria 2187
154 Ga0207670_10547981 3300025936 Bacteria 945
155 Ga0207691_10099205 3300025940 Bacteria 2601
156 Ga0207711_10000299 3300025941 Bacteria 53150
157 Ga0207711_10008167 3300025941 Bacteria 8762
158 Ga0207711_10333224 3300025941 Bacteria 1404
159 Ga0207667_10004099 3300025949 Bacteria 17907
160 Ga0207667_10007622 3300025949 Bacteria 12968
161 Ga0207667_10203245 3300025949 Bacteria 2032
162 Ga0207668_10250022 3300025972 Bacteria 1439
163 Ga0207658_10021098 3300025986 Bacteria 4517
164 Ga0207677_10033607 3300026023 Bacteria 3312
165 Ga0207703_10000137 3300026035 Bacteria 89265
166 Ga0207639_10033265 3300026041 Bacteria 3802
167 Ga0207639_10794715 3300026041 Bacteria 881
168 Ga0207678_10098652 3300026067 Bacteria 2496
169 Ga0207678_10110664 3300026067 Bacteria 2343
170 Ga0207708_10122148 3300026075 Bacteria 2030
171 Ga0207641_10131163 3300026088 Bacteria 2251
172 Ga0207676_10322733 3300026095 Bacteria 1418
173 Ga0207698_10087383 3300026142 Bacteria 2539
174 Ga0307515_10091635 3300028794 Bacteria 3795
175 Ga0307515_10095090 3300028794 Bacteria 3672
176 Ga0307515_10627780 3300028794 Bacteria 686
177 Ga0265340_10004982 3300031247 Bacteria 7382
178 Ga0307513_10255017 3300031456 Bacteria 1548
179 Ga0307514_10010986 3300031649 Bacteria 7558
180 Ga0307514_10215574 3300031649 Bacteria 1185
181 Ga0307413_10099977 3300031824 Bacteria 1914
182 Ga0307413_10118147 3300031824 Bacteria 1790
183 Ga0307410_10461199 3300031852 Bacteria 1038
184 Ga0307406_10000031 3300031901 Bacteria 87391
185 Ga0307406_10023972 3300031901 Bacteria 3638
186 Ga0307406_10039854 3300031901 Bacteria 2917
187 Ga0307406_10133718 3300031901 Bacteria 1745
188 Ga0307406_10275486 3300031901 Bacteria 1280
189 Ga0307406_10282229 3300031901 Bacteria 1267
190 Ga0307406_10338448 3300031901 Bacteria 1171
191 Ga0307412_10158463 3300031911 Bacteria 1679
192 Ga0307412_10453550 3300031911 Bacteria 1057
193 Ga0307409_100047306 3300031995 Bacteria 3264
194 Ga0307409_100319496 3300031995 Bacteria 1452
195 Ga0307409_100343830 3300031995 Bacteria 1405
196 Ga0307409_100348719 3300031995 Bacteria 1396
197 Ga0307409_100532032 3300031995 Bacteria 1150
198 Ga0307416_100710440 3300032002 Bacteria 1095
199 Ga0307416_101015173 3300032002 Bacteria 933
200 Ga0307414_10041922 3300032004 Bacteria 3105
201 Ga0307414_10049391 3300032004 Bacteria 2909
202 Ga0307414_10166530 3300032004 Bacteria 1757
203 Ga0307414_11082901 3300032004 Bacteria 740
204 Ga0307411_10166905 3300032005 Bacteria 1656
205 Ga0307411_10252220 3300032005 Bacteria 1388
206 Ga0395899_0001710 3300037312 Bacteria 18277
207 Ga0395899_0018259 3300037312 Bacteria 5334
208 Ga0395899_0249666 3300037312 Bacteria 1218
209 Ga0395900_0001961 3300037418 Bacteria 23236
210 Ga0395900_0004425 3300037418 Bacteria 14898
211 Ga0395898_0000256 3300037466 Bacteria 130878
212 Ga0395898_0826353 3300037466 Bacteria 866
213 Ga0395901_0032578 3300038443 Bacteria 5377
214 Ga0395901_0230664 3300038443 Bacteria 1933
215 Ga0395901_0588300 3300038443 Bacteria 1123
216 Ga0439466_0078553 3300041411 Bacteria 1043
217 Ga0439465_0026855 3300041413 Bacteria 1822
218 Ga0439465_0158934 3300041413 Bacteria 810
219 Ga0451791_0274792 3300041451 Bacteria 685
220 Ga0451793_0145361 3300041452 Bacteria 883
221 Ga0451793_0717453 3300041452 Bacteria 1254
222 Ga0451793_1562054 3300041452 Bacteria 1043
223 Ga0451793_1673339 3300041452 Bacteria 772
224 Ga0451797_1450500 3300041453 Bacteria 754
225 Ga0451802_0987753 3300041460 Bacteria 1658
226 Ga0451806_163518 3300041462 Bacteria 1168
227 Ga0451806_327088 3300041462 Bacteria 4006
228 Ga0451837_0799652 3300041494 Bacteria 975
229 Ga0451853_2950517 3300041512 Bacteria 737
230 Ga0451853_3475911 3300041512 Bacteria 927
231 Ga0450920_023153 3300042122 Bacteria 1204
232 Ga0466969_0227516 3300044656 Bacteria 848
233 Ga0466972_0080289 3300044658 Bacteria 1553
234 Ga0466972_0114948 3300044658 Bacteria 1270
235 Ga0466965_0000006 3300044683 Bacteria 158069
236 Ga0466965_0017016 3300044683 Bacteria 3469
237 Ga0466965_0020960 3300044683 Bacteria 3145
238 Ga0466965_0035346 3300044683 Bacteria 2448
239 Ga0466965_0036186 3300044683 Bacteria 2421
240 Ga0466965_0044968 3300044683 Bacteria 2183
241 Ga0466966_0039372 3300044684 Bacteria 3044
242 Ga0466966_0072748 3300044684 Bacteria 2151
243 Ga0466966_0241727 3300044684 Bacteria 1088
244 Ga0466961_0042425 3300044693 Bacteria 2915
245 Ga0466961_0103566 3300044693 Bacteria 1792
246 Ga0466961_0168295 3300044693 Bacteria 1364
247 Ga0466961_0174303 3300044693 Bacteria 1337
248 Ga0466961_0356115 3300044693 Bacteria 890
249 Ga0466963_0395971 3300044694 Bacteria 974
250 Ga0466964_0085641 3300044706 Bacteria 1361
251 Ga0466968_0026597 3300044735 Bacteria 2376
252 Ga0466968_0108898 3300044735 Bacteria 1244
253 Ga0466970_0000230 3300044765 Bacteria 27280
254 Ga0466970_0024421 3300044765 Bacteria 3160
255 Ga0466970_0032170 3300044765 Bacteria 2771
256 Ga0466970_0074090 3300044765 Bacteria 1832
257 Ga0466970_0092088 3300044765 Bacteria 1646
258 Ga0466970_0097005 3300044765 Bacteria 1603
259 Ga0466957_0166621 3300044842 Bacteria 1433
260 Ga0466957_0228093 3300044842 Bacteria 1232
261 Ga0466960_0021746 3300044901 Bacteria 2860
262 Ga0466960_0033580 3300044901 Bacteria 2385
263 Ga0466960_0089983 3300044901 Bacteria 1562
264 Ga0466960_0114379 3300044901 Bacteria 1406
265 Ga0466960_0139233 3300044901 Bacteria 1288
266 Ga0466960_0191094 3300044901 Bacteria 1114
267 Ga0466960_0232895 3300044901 Bacteria 1017
268 Ga0466960_0340034 3300044901 Bacteria 854
269 Ga0466959_0008374 3300045049 Bacteria 7307
270 Ga0466959_0146841 3300045049 Bacteria 1664
271 Ga0466959_0287948 3300045049 Bacteria 1126
272 Ga0466958_0048468 3300045836 Bacteria 2568
273 Ga0466967_0312731 3300045976 Bacteria 1513
274 Ga0495627_001242 3300046453 Bacteria 15867
275 Ga0495650_0032495 3300046471 Bacteria 2333
276 Ga0495631_0206272 3300046518 Bacteria 840
277 Ga0495644_0045154 3300046523 Bacteria 1657
278 Ga0495654_0083262 3300046530 Bacteria 1496
279 Ga0495654_0161063 3300046530 Bacteria 985
280 Ga0495656_0047903 3300046615 Bacteria 1814
281 Ga0495625_0246953 3300046660 Bacteria 1160
282 Ga0495670_0340116 3300046691 Bacteria 807
283 Ga0495672_0006728 3300047320 Bacteria 8822
284 Ga0495626_0003878 3300048091 Bacteria 9376
285 Ga0496100_0097665 3300048903 Bacteria 2017
286 Ga0496100_0173700 3300048903 Bacteria 1554
287 Ga0496101_0036861 3300048904 Bacteria 3465
288 Ga0496101_0065460 3300048904 Bacteria 2649
289 Ga0496101_0147433 3300048904 Bacteria 1798
290 Ga0496101_0273248 3300048904 Bacteria 1320
291 Ga0496101_0898198 3300048904 Bacteria 698
292 Ga0496102_0020518 3300048905 Bacteria 5839
293 Ga0496102_0049380 3300048905 Bacteria 3828
294 Ga0496102_0298123 3300048905 Bacteria 1519
295 Ga0496102_0337605 3300048905 Bacteria 1419
296 Ga0496102_0591892 3300048905 Bacteria 1032
297 Ga0496102_1095369 3300048905 Bacteria 716
298 Ga0496103_0006028 3300048906 Bacteria 7245
299 Ga0496104_0133040 3300048907 Bacteria 2389
300 Ga0496104_0359591 3300048907 Bacteria 1368
301 Ga0496105_0044624 3300048908 Bacteria 3657
302 Ga0496105_0047943 3300048908 Bacteria 3526
303 Ga0496105_0066187 3300048908 Bacteria 2982
304 Ga0496105_0133143 3300048908 Bacteria 2048
305 Ga0496105_0176347 3300048908 Bacteria 1751
306 Ga0496107_0057555 3300048910 Bacteria 2810
307 Ga0496107_0237945 3300048910 Bacteria 1355
308 Ga0496107_0497441 3300048910 Bacteria 904
309 Ga0496108_0144075 3300048911 Bacteria 2053
310 Ga0496108_0404796 3300048911 Bacteria 1192
311 Ga0496109_0174325 3300048912 Bacteria 2018
312 Ga0496109_0200622 3300048912 Bacteria 1875
313 Ga0496111_0584472 3300048914 Bacteria 818
314 Ga0496112_0122696 3300048915 Bacteria 2568
315 Ga0496113_0130185 3300048916 Bacteria 1974
316 Ga0496113_0254353 3300048916 Bacteria 1403
317 Ga0496114_0010803 3300048917 Bacteria 7267
318 Ga0496114_0015114 3300048917 Bacteria 6206
319 Ga0496114_0056472 3300048917 Bacteria 3276
320 Ga0496114_0183597 3300048917 Bacteria 1827
321 Ga0496114_0806485 3300048917 Bacteria 818
322 Ga0496115_0015057 3300048918 Bacteria 5862
323 Ga0496115_0048762 3300048918 Bacteria 3388
324 Ga0496115_0158270 3300048918 Bacteria 1871
325 Ga0496115_0378763 3300048918 Bacteria 1151
326 Ga0496115_1122949 3300048918 Bacteria 595
327 Ga0496116_0009343 3300048919 Bacteria 8373
328 Ga0496117_0000187 3300048920 Bacteria 127214
329 Ga0496117_0000726 3300048920 Bacteria 51736
330 Ga0496117_0001882 3300048920 Bacteria 28223
331 Ga0496117_0007327 3300048920 Bacteria 10816
332 Ga0496117_0008944 3300048920 Bacteria 9429
333 Ga0496117_0047380 3300048920 Bacteria 3082
334 Ga0496117_0090269 3300048920 Bacteria 1975
335 Ga0496117_0125676 3300048920 Bacteria 1566
336 Ga0496117_0130435 3300048920 Bacteria 1524
337 Ga0496118_0000173 3300048921 Bacteria 116057
338 Ga0496118_0005514 3300048921 Bacteria 14360
339 Ga0496118_0016874 3300048921 Bacteria 6671
340 Ga0496118_0051220 3300048921 Bacteria 3160
341 Ga0496118_0127819 3300048921 Bacteria 1639
342 Ga0496118_0180669 3300048921 Bacteria 1275
343 Ga0496119_0000295 3300048922 Bacteria 69951
344 Ga0496119_0002996 3300048922 Bacteria 17913
345 Ga0496119_0003077 3300048922 Bacteria 17612
346 Ga0496119_0006539 3300048922 Bacteria 10754
347 Ga0496119_0020651 3300048922 Bacteria 4794
348 Ga0496119_0041137 3300048922 Bacteria 2948
349 Ga0496119_0228971 3300048922 Bacteria 947
350 Ga0496120_0002268 3300048923 Bacteria 19999
351 Ga0496120_0008376 3300048923 Bacteria 7515
352 Ga0496120_0015914 3300048923 Bacteria 4938
353 Ga0496120_0042374 3300048923 Bacteria 2659
354 Ga0496120_0140145 3300048923 Bacteria 1229
355 Ga0496121_0000015 3300048924 Bacteria 571958
356 Ga0496121_0259035 3300048924 Bacteria 1202
357 Ga0496121_0358006 3300048924 Bacteria 970
358 Ga0496122_0000096 3300048925 Bacteria 200503
359 Ga0496122_0000420 3300048925 Bacteria 89921
360 Ga0496122_0001338 3300048925 Bacteria 40252
361 Ga0496122_0002856 3300048925 Bacteria 23657
362 Ga0496122_0019490 3300048925 Bacteria 6193
363 Ga0496122_0040550 3300048925 Bacteria 3698
364 Ga0496122_0054587 3300048925 Bacteria 2999
365 Ga0496122_0099593 3300048925 Bacteria 1948
366 Ga0496122_0110235 3300048925 Bacteria 1809
367 Ga0496122_0123146 3300048925 Bacteria 1667
368 Ga0496123_0000031 3300048926 Bacteria 287596
369 Ga0496123_0000354 3300048926 Bacteria 86153
370 Ga0496123_0002073 3300048926 Bacteria 25813
371 Ga0496123_0020420 3300048926 Bacteria 5182
372 Ga0496123_0069326 3300048926 Bacteria 2215
373 Ga0496123_0157397 3300048926 Bacteria 1216
374 Ga0496124_0000135 3300048927 Bacteria 152458
375 Ga0496124_0001640 3300048927 Bacteria 32069
376 Ga0496124_0002851 3300048927 Bacteria 21850
377 Ga0496124_0045188 3300048927 Bacteria 3777
378 Ga0496124_0199275 3300048927 Bacteria 1524
379 Ga0496124_0211315 3300048927 Bacteria 1468
380 Ga0496124_0314723 3300048927 Bacteria 1124
381 Ga0496125_0001305 3300048928 Bacteria 36944
382 Ga0496125_0010731 3300048928 Bacteria 9230
383 Ga0496125_0019602 3300048928 Bacteria 6373
384 Ga0496125_0075309 3300048928 Bacteria 2613
385 Ga0496125_0086091 3300048928 Bacteria 2378
386 Ga0496125_0422876 3300048928 Bacteria 771
387 Ga0496126_0002020 3300048929 Bacteria 28690
388 Ga0496126_0012712 3300048929 Bacteria 8610
389 Ga0496126_0044681 3300048929 Bacteria 4078
390 Ga0496126_0048582 3300048929 Bacteria 3876
391 Ga0496126_0052793 3300048929 Bacteria 3692
392 Ga0496126_0069342 3300048929 Bacteria 3145
393 Ga0496126_0149012 3300048929 Bacteria 2006
394 Ga0496126_0157469 3300048929 Bacteria 1943
395 Ga0496126_0567227 3300048929 Bacteria 898
396 Ga0496126_0570976 3300048929 Bacteria 895
397 Ga0501031_0070944 3300049568 Bacteria 2269
398 Ga0501031_0192034 3300049568 Bacteria 1333
399 Ga0501032_0006872 3300049569 Bacteria 8340
400 Ga0501032_0017479 3300049569 Bacteria 5036
401 Ga0501032_0050904 3300049569 Bacteria 2793
402 Ga0501032_0069590 3300049569 Bacteria 2348
403 Ga0501032_0138170 3300049569 Bacteria 1606
404 Ga0501032_0148657 3300049569 Bacteria 1541
405 Ga0501032_0241203 3300049569 Bacteria 1174
406 Ga0501033_0003795 3300049570 Bacteria 12287
407 Ga0501033_0037252 3300049570 Bacteria 3641
408 Ga0501033_0064415 3300049570 Bacteria 2697
409 Ga0501033_0069113 3300049570 Bacteria 2596
410 Ga0501033_0098745 3300049570 Bacteria 2132
411 Ga0501033_0125584 3300049570 Bacteria 1860
412 Ga0501033_0189976 3300049570 Bacteria 1470
413 Ga0501033_0221365 3300049570 Bacteria 1347
414 Ga0501033_0463911 3300049570 Bacteria 879
415 Ga0501034_0001844 3300049571 Bacteria 26913
416 Ga0501034_0008511 3300049571 Bacteria 10834
417 Ga0501034_0018926 3300049571 Bacteria 7054
418 Ga0501034_0024442 3300049571 Bacteria 6146
419 Ga0501034_0045351 3300049571 Bacteria 4442
420 Ga0501034_0057911 3300049571 Bacteria 3895
421 Ga0501034_0164285 3300049571 Bacteria 2189
422 Ga0501034_0184870 3300049571 Bacteria 2048
423 Ga0501034_0278133 3300049571 Bacteria 1613
424 Ga0501036_0008682 3300049572 Bacteria 8337
425 Ga0501036_0037729 3300049572 Bacteria 4087
426 Ga0501036_0068300 3300049572 Bacteria 3008
427 Ga0501036_0099377 3300049572 Bacteria 2461
428 Ga0501036_0188489 3300049572 Bacteria 1736
429 Ga0501036_0270516 3300049572 Bacteria 1423
430 Ga0501036_0275499 3300049572 Bacteria 1408
431 Ga0501037_0009684 3300049573 Bacteria 7071
432 Ga0501037_0012832 3300049573 Bacteria 6175
433 Ga0501037_0049354 3300049573 Bacteria 3082
434 Ga0501037_0103116 3300049573 Bacteria 2057
435 Ga0501037_0400312 3300049573 Bacteria 942
436 Ga0501037_0486936 3300049573 Bacteria 838
437 Ga0501038_0006592 3300049574 Bacteria 10736
438 Ga0501038_0010064 3300049574 Bacteria 8660
439 Ga0501038_0012905 3300049574 Bacteria 7622
440 Ga0501038_0015566 3300049574 Bacteria 6914
441 Ga0501038_0040432 3300049574 Bacteria 4072
442 Ga0501038_0095616 3300049574 Bacteria 2481
443 Ga0501038_0159929 3300049574 Bacteria 1831
444 Ga0501038_0480369 3300049574 Bacteria 952
445 Ga0501039_0024930 3300049575 Bacteria 4595
446 Ga0501039_0076532 3300049575 Bacteria 2602
447 Ga0501041_0181931 3300049577 Bacteria 1316
448 Ga0501042_0024845 3300049578 Bacteria 4205
449 Ga0501042_0091602 3300049578 Bacteria 2182
450 Ga0501043_0027366 3300049579 Bacteria 4476
451 Ga0501043_0037154 3300049579 Bacteria 3831
452 Ga0501043_0052603 3300049579 Bacteria 3198
453 Ga0501043_0058075 3300049579 Bacteria 3037
454 Ga0501043_0090918 3300049579 Bacteria 2400
455 Ga0501043_0133396 3300049579 Bacteria 1946
456 Ga0501043_0241700 3300049579 Bacteria 1392
457 Ga0501043_0537765 3300049579 Bacteria 869
458 Ga0501046_0014566 3300049580 Bacteria 6628
459 Ga0501046_0015539 3300049580 Bacteria 6393
460 Ga0501046_0031887 3300049580 Bacteria 4269
461 Ga0501046_0043699 3300049580 Bacteria 3566
462 Ga0501047_0008648 3300049581 Bacteria 9617
463 Ga0501047_0009443 3300049581 Bacteria 9214
464 Ga0501047_0021425 3300049581 Bacteria 6205
465 Ga0501047_0023797 3300049581 Bacteria 5880
466 Ga0501047_0096036 3300049581 Bacteria 2842
467 Ga0501047_0105989 3300049581 Bacteria 2691
468 Ga0501047_0195936 3300049581 Bacteria 1882
469 Ga0501047_0447702 3300049581 Bacteria 1121
470 Ga0501047_0616546 3300049581 Bacteria 906
471 Ga0501048_0033531 3300049582 Bacteria 3709
472 Ga0501048_0137548 3300049582 Bacteria 1726
473 Ga0501048_0440024 3300049582 Bacteria 933
474 Ga0501067_0147892 3300049583 Bacteria 1309
475 Ga0501068_0104495 3300049584 Bacteria 1757
476 Ga0501068_0198007 3300049584 Bacteria 1274
477 Ga0501068_0223933 3300049584 Bacteria 1196
478 Ga0501069_0061761 3300049585 Bacteria 2093
479 Ga0501070_0000472 3300049586 Bacteria 36579
480 Ga0501070_0001725 3300049586 Bacteria 19327
481 Ga0501070_0034874 3300049586 Bacteria 4205
482 Ga0501070_0075803 3300049586 Bacteria 2784
483 Ga0501070_0173795 3300049586 Bacteria 1774
484 Ga0501070_0265169 3300049586 Bacteria 1403
485 Ga0501070_0442437 3300049586 Bacteria 1048
486 Ga0501070_0491483 3300049586 Bacteria 986
487 Ga0501072_0036953 3300049588 Bacteria 3830
488 Ga0501073_0000020 3300049589 Bacteria 139560
489 Ga0501073_0023123 3300049589 Bacteria 4468
490 Ga0501073_0270458 3300049589 Bacteria 1173
491 Ga0501073_0450249 3300049589 Bacteria 890
492 Ga0501073_0811990 3300049589 Bacteria 644
493 Ga0501074_0119445 3300049590 Bacteria 1885
494 Ga0501080_0072299 3300049742 Bacteria 3209
495 Ga0501080_0152982 3300049742 Bacteria 2132
496 Ga0501080_0333493 3300049742 Bacteria 1371
497 Ga0501080_0502754 3300049742 Bacteria 1083
498 Ga0501083_0000119 3300049744 Bacteria 53723
499 Ga0501083_0027579 3300049744 Bacteria 3918
500 Ga0501035_0001199 3300049822 Bacteria 27008
501 Ga0501035_0011878 3300049822 Bacteria 8061
502 Ga0501035_0020069 3300049822 Bacteria 6136
503 Ga0501035_0037846 3300049822 Bacteria 4366
504 Ga0501035_0056210 3300049822 Bacteria 3512
505 Ga0501035_0982583 3300049822 Bacteria 665
506 Ga0501044_0000954 3300049823 Bacteria 34722
507 Ga0501044_0008901 3300049823 Bacteria 10970
508 Ga0501044_0015730 3300049823 Bacteria 8148
509 Ga0501044_0023586 3300049823 Bacteria 6543
510 Ga0501044_0027761 3300049823 Bacteria 5976
511 Ga0501044_0048883 3300049823 Bacteria 4366
512 Ga0501044_0062953 3300049823 Bacteria 3791
513 Ga0501044_0114749 3300049823 Bacteria 2699
514 Ga0501045_0031682 3300049824 Bacteria 3829
515 Ga0501045_0097959 3300049824 Bacteria 2169
516 nmdc:mga03n38_209011_c1 3300050490 Bacteria 1013
517 nmdc:mga00v17_115847_c1 3300050491 Bacteria 1703
518 nmdc:mga00v17_17273_c1 3300050491 Bacteria 4081
519 nmdc:mga00v17_27127_c1 3300050491 Bacteria 3341
520 nmdc:mga00v17_2726_c1 3300050491 Bacteria 9067
521 nmdc:mga00v17_288012_c1 3300050491 Bacteria 1066
522 nmdc:mga00v17_343859_c1 3300050491 Bacteria 970
523 nmdc:mga0yw44_270282_c1 3300050492 Bacteria 1135
524 nmdc:mga0yw44_4797_c1 3300050492 Bacteria 3526
525 nmdc:mga0yw44_59599_c1 3300050492 Bacteria 2336
526 nmdc:mga0yw44_91349_c1 3300050492 Bacteria 1925
527 nmdc:mga06z11_34271_c1 3300050494 Bacteria 2491
528 nmdc:mga07m45_24824_c1 3300050496 Bacteria 3286
529 nmdc:mga07m45_370817_c1 3300050496 Bacteria 831
530 nmdc:mga0sz30_174518_c1 3300050516 Bacteria 953
531 nmdc:mga0sz30_3916_c2 3300050516 Bacteria 4009
532 Ga0500635_0000037 3300053080 Bacteria 93959
533 Ga0500643_000224 3300053087 Bacteria 52829
534 Ga0500651_0001153 3300053093 Bacteria 13102
535 Ga0500556_0000100 3300053104 Bacteria 78417
536 Ga0500556_0000608 3300053104 Bacteria 22924
537 Ga0500593_001363 3300053117 Bacteria 8805
538 Ga0500655_009157 3300053133 Bacteria 1782
539 Ga0500559_0000255 3300053136 Bacteria 42246
540 Ga0500559_0002146 3300053136 Bacteria 10501
541 Ga0500559_0010960 3300053136 Bacteria 3882
542 Ga0500559_0041000 3300053136 Bacteria 2017
543 Ga0500568_0000100 3300053139 Bacteria 78717
544 Ga0500568_0000832 3300053139 Bacteria 21703
545 Ga0500573_0000014 3300053140 Bacteria 193353
546 Ga0500573_0003491 3300053140 Bacteria 8142
547 Ga0500573_0009695 3300053140 Bacteria 5355
548 Ga0500573_0015993 3300053140 Bacteria 4256
549 Ga0500573_0017289 3300053140 Bacteria 4105
550 Ga0500573_0081834 3300053140 Bacteria 1834
551 Ga0500573_0104239 3300053140 Bacteria 1593
552 Ga0500573_0122652 3300053140 Bacteria 1445
553 Ga0500573_0222863 3300053140 Bacteria 988
554 Ga0500577_0012280 3300053142 Bacteria 2583
555 Ga0500577_0122722 3300053142 Bacteria 1082
556 Ga0500577_0135455 3300053142 Bacteria 1035
557 Ga0500616_0000027 3300053153 Bacteria 441053
558 Ga0500616_0083024 3300053153 Bacteria 1606
559 Ga0466962_0050072 3300061719 Bacteria 1997

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003316 rootH1_10080781 rootH1_100807813 160
2 3300025921 Ga0207652_10350399 Ga0207652_103503992 163
3 3300049568 Ga0501031_0070944 Ga0501031_0070944_1737_2252 168
4 3300049586 Ga0501070_0442437 Ga0501070_0442437_493_1008 168
5 3300037418 Ga0395900_0004425 Ga0395900_0004425_5767_6318 169
6 3300038443 Ga0395901_0032578 Ga0395901_0032578_3231_3782 169
7 3300048918 Ga0496115_1122949 Ga0496115_1122949_58_576 169
8 3300049568 Ga0501031_0192034 Ga0501031_0192034_154_753 169
9 3300049569 Ga0501032_0017479 Ga0501032_0017479_3369_3968 169
10 3300049570 Ga0501033_0064415 Ga0501033_0064415_92_691 169
11 3300049570 Ga0501033_0069113 Ga0501033_0069113_41_640 169
12 3300049571 Ga0501034_0024442 Ga0501034_0024442_2920_3519 169
13 3300049571 Ga0501034_0045351 Ga0501034_0045351_1145_1744 169
14 3300049572 Ga0501036_0037729 Ga0501036_0037729_3140_3739 169
15 3300049572 Ga0501036_0275499 Ga0501036_0275499_759_1358 169
16 3300049573 Ga0501037_0009684 Ga0501037_0009684_5537_6136 169
17 3300049573 Ga0501037_0103116 Ga0501037_0103116_392_991 169
18 3300049574 Ga0501038_0010064 Ga0501038_0010064_5764_6363 169
19 3300049578 Ga0501042_0024845 Ga0501042_0024845_936_1535 169
20 3300049578 Ga0501042_0091602 Ga0501042_0091602_1040_1639 169
21 3300049579 Ga0501043_0027366 Ga0501043_0027366_3748_4347 169
22 3300049579 Ga0501043_0037154 Ga0501043_0037154_2336_2935 169
23 3300049579 Ga0501043_0133396 Ga0501043_0133396_1017_1640 169
24 3300049580 Ga0501046_0015539 Ga0501046_0015539_1010_1609 169
25 3300049580 Ga0501046_0043699 Ga0501046_0043699_879_1478 169
26 3300049581 Ga0501047_0023797 Ga0501047_0023797_2628_3227 169
27 3300049581 Ga0501047_0096036 Ga0501047_0096036_151_750 169
28 3300049581 Ga0501047_0195936 Ga0501047_0195936_196_795 169
29 3300049582 Ga0501048_0033531 Ga0501048_0033531_219_818 169
30 3300049584 Ga0501068_0223933 Ga0501068_0223933_518_1117 169
31 3300049585 Ga0501069_0061761 Ga0501069_0061761_693_1292 169
32 3300049586 Ga0501070_0034874 Ga0501070_0034874_2133_2732 169
33 3300049586 Ga0501070_0173795 Ga0501070_0173795_441_1031 169
34 3300049586 Ga0501070_0491483 Ga0501070_0491483_297_896 169
35 3300049589 Ga0501073_0811990 Ga0501073_0811990_29_628 169
36 3300049742 Ga0501080_0333493 Ga0501080_0333493_570_1169 169
37 3300049822 Ga0501035_0011878 Ga0501035_0011878_5496_6095 169
38 3300049822 Ga0501035_0020069 Ga0501035_0020069_2910_3509 169
39 3300049822 Ga0501035_0037846 Ga0501035_0037846_2699_3298 169
40 3300049823 Ga0501044_0008901 Ga0501044_0008901_7452_8051 169
41 3300049823 Ga0501044_0048883 Ga0501044_0048883_1069_1668 169
42 3300049824 Ga0501045_0031682 Ga0501045_0031682_869_1468 169
43 3300044683 Ga0466965_0020960 Ga0466965_0020960_531_1112 174
44 3300044693 Ga0466961_0168295 Ga0466961_0168295_325_906 174
45 3300044706 Ga0466964_0085641 Ga0466964_0085641_167_748 174
46 3300044901 Ga0466960_0191094 Ga0466960_0191094_486_1067 174
47 3300049584 Ga0501068_0198007 Ga0501068_0198007_363_896 174
48 3300049570 Ga0501033_0098745 Ga0501033_0098745_1006_1647 175
49 3300049571 Ga0501034_0008511 Ga0501034_0008511_5764_6405 175
50 3300049572 Ga0501036_0099377 Ga0501036_0099377_17_628 175
51 3300049573 Ga0501037_0400312 Ga0501037_0400312_31_672 175
52 3300049823 Ga0501044_0023586 Ga0501044_0023586_4724_5365 175
53 3300031247 Ga0265340_10004982 Ga0265340_100049829 178
54 3300046530 Ga0495654_0083262 Ga0495654_0083262_11_571 180
55 iso_pu_bacteria 2857710386 2857711349 188
56 3300048929 Ga0496126_0157469 Ga0496126_0157469_1340_1933 189
57 iso_pu_bacteria 2811994872 2812324076 189
58 iso_pu_bacteria 8004212874 8004214787 189
59 iso_pu_bacteria 2751185788 2753303536 190
60 iso_pu_bacteria 2808606447 2809228048 190
61 iso_pu_bacteria 2844852863 2844854453 190
62 iso_pu_bacteria 2852632344 2852634757 190
63 iso_pu_bacteria 2852643534 2852644509 190
64 iso_pu_bacteria 2857733635 2857734355 190
65 iso_pu_bacteria 2904430863 2904432550 190
66 iso_pu_bacteria 2904501621 2904501666 190
67 iso_pu_bacteria 2908674828 2908676280 190
68 iso_pu_bacteria 2909074476 2909077164 190
69 iso_pu_bacteria 2919039151 2919041864 190
70 iso_pu_bacteria 2919042368 2919043356 190
71 iso_pu_bacteria 2928104781 2928105625 190
72 iso_pu_bacteria 2928500415 2928500786 190
73 iso_pu_bacteria 2939657138 2939659285 190
74 iso_pu_bacteria 2939660829 2939662874 190
75 iso_pu_bacteria 2966924647 2966927435 190
76 iso_pu_bacteria 2984551494 2984551827 190
77 iso_pu_bacteria 8056037122 8056039253 190
78 iso_pu_bacteria 8057345674 8057347538 190
79 iso_pu_bacteria 2643221616 2644096572 191
80 iso_pu_bacteria 2643221632 2644182542 191
81 iso_pu_bacteria 2773857759 2774383313 191
82 iso_pu_bacteria 2844841374 2844843210 191
83 iso_pu_bacteria 2870622029 2870622336 191
84 iso_pu_bacteria 2884763398 2884766224 191
85 iso_pu_bacteria 2919055335 2919058699 191
86 iso_pu_bacteria 2919523602 2919525281 191
87 iso_pu_bacteria 2928153084 2928153346 191
88 iso_pu_bacteria 2966921586 2966922085 191
89 3300005327 Ga0070658_10066751 Ga0070658_100667513 192
90 3300005338 Ga0068868_100016511 Ga0068868_1000165116 192
91 3300005339 Ga0070660_100009493 Ga0070660_1000094934 192
92 3300005366 Ga0070659_100003188 Ga0070659_1000031884 192
93 3300005367 Ga0070667_100064057 Ga0070667_1000640572 192
94 3300005435 Ga0070714_100843946 Ga0070714_1008439461 192
95 3300005455 Ga0070663_101015798 Ga0070663_1010157981 192
96 3300005466 Ga0070685_10002096 Ga0070685_100020968 192
97 3300005563 Ga0068855_100352282 Ga0068855_1003522822 192
98 3300005614 Ga0068856_100162895 Ga0068856_1001628952 192
99 3300005616 Ga0068852_100033847 Ga0068852_1000338474 192
100 3300005842 Ga0068858_100000023 Ga0068858_100000023166 192
101 3300009093 Ga0105240_10156128 Ga0105240_101561283 192
102 3300009098 Ga0105245_10004311 Ga0105245_100043117 192
103 3300009098 Ga0105245_10282540 Ga0105245_102825402 192
104 3300009177 Ga0105248_10077758 Ga0105248_100777583 192
105 3300009177 Ga0105248_10191194 Ga0105248_101911944 192
106 3300009545 Ga0105237_10250699 Ga0105237_102506994 192
107 3300009551 Ga0105238_10003710 Ga0105238_100037104 192
108 3300009551 Ga0105238_10528942 Ga0105238_105289423 192
109 3300010375 Ga0105239_11174227 Ga0105239_111742272 192
110 3300025909 Ga0207705_10044136 Ga0207705_100441366 192
111 3300025909 Ga0207705_10334607 Ga0207705_103346073 192
112 3300025913 Ga0207695_10017263 Ga0207695_100172637 192
113 3300025919 Ga0207657_10191700 Ga0207657_101917002 192
114 3300025924 Ga0207694_10000052 Ga0207694_1000005288 192
115 3300025927 Ga0207687_10020338 Ga0207687_100203384 192
116 3300025932 Ga0207690_10000618 Ga0207690_100006183 192
117 3300025941 Ga0207711_10008167 Ga0207711_100081673 192
118 3300025941 Ga0207711_10333224 Ga0207711_103332243 192
119 3300025949 Ga0207667_10007622 Ga0207667_100076225 192
120 3300025949 Ga0207667_10203245 Ga0207667_102032454 192
121 3300025986 Ga0207658_10021098 Ga0207658_100210985 192
122 3300026023 Ga0207677_10033607 Ga0207677_100336072 192
123 3300026035 Ga0207703_10000137 Ga0207703_1000013777 192
124 3300026041 Ga0207639_10033265 Ga0207639_100332657 192
125 3300026142 Ga0207698_10087383 Ga0207698_100873835 192
126 3300053093 Ga0500651_0001153 Ga0500651_0001153_2074_2706 192
127 iso_pu_bacteria 2585428157 2588109270 192
128 iso_pu_bacteria 2773857763 2774398664 192
129 iso_pu_bacteria 2857737099 2857738525 192
130 iso_pu_bacteria 2897561785 2897562553 192
131 iso_pu_bacteria 8045830549 8045834386 192
132 3300049569 Ga0501032_0069590 Ga0501032_0069590_241_873 193
133 3300049574 Ga0501038_0095616 Ga0501038_0095616_133_765 193
134 3300049823 Ga0501044_0114749 Ga0501044_0114749_226_858 193
135 iso_pu_bacteria 2643221566 2643849009 193
136 iso_pu_bacteria 2643221597 2643995185 193
137 iso_pu_bacteria 2833709550 2833711780 193
138 iso_pu_bacteria 2852677369 2852678717 193
139 iso_pu_bacteria 2857729791 2857730538 193
140 iso_pu_bacteria 2928121344 2928123786 193
141 iso_pu_bacteria 8046352972 8046353648 193
142 3300003323 rootH1_10019641 rootH1_100196413 194
143 3300009011 Ga0105251_10248385 Ga0105251_102483852 194
144 3300013104 Ga0157370_10125266 Ga0157370_101252662 194
145 3300013105 Ga0157369_10001655 Ga0157369_1000165523 194
146 3300044683 Ga0466965_0036186 Ga0466965_0036186_906_1502 194
147 3300044684 Ga0466966_0241727 Ga0466966_0241727_439_1053 194
148 3300044765 Ga0466970_0097005 Ga0466970_0097005_848_1450 194
149 3300044901 Ga0466960_0139233 Ga0466960_0139233_55_651 194
150 3300048091 Ga0495626_0003878 Ga0495626_0003878_6529_7131 194
151 3300048904 Ga0496101_0147433 Ga0496101_0147433_1184_1786 194
152 3300048905 Ga0496102_0298123 Ga0496102_0298123_438_1040 194
153 3300048905 Ga0496102_1095369 Ga0496102_1095369_46_648 194
154 3300048920 Ga0496117_0008944 Ga0496117_0008944_7566_8168 194
155 3300048921 Ga0496118_0000173 Ga0496118_0000173_109076_109678 194
156 3300048922 Ga0496119_0020651 Ga0496119_0020651_981_1583 194
157 3300048923 Ga0496120_0042374 Ga0496120_0042374_1062_1664 194
158 3300048923 Ga0496120_0140145 Ga0496120_0140145_100_699 194
159 3300048925 Ga0496122_0002856 Ga0496122_0002856_11030_11632 194
160 3300048925 Ga0496122_0040550 Ga0496122_0040550_2518_3120 194
161 3300048925 Ga0496122_0099593 Ga0496122_0099593_249_851 194
162 3300048925 Ga0496122_0123146 Ga0496122_0123146_928_1530 194
163 3300048926 Ga0496123_0020420 Ga0496123_0020420_827_1429 194
164 3300048926 Ga0496123_0069326 Ga0496123_0069326_957_1559 194
165 3300048927 Ga0496124_0000135 Ga0496124_0000135_145504_146106 194
166 3300049571 Ga0501034_0057911 Ga0501034_0057911_2097_2696 194
167 3300049571 Ga0501034_0164285 Ga0501034_0164285_1486_2085 194
168 3300049583 Ga0501067_0147892 Ga0501067_0147892_118_717 194
169 3300049588 Ga0501072_0036953 Ga0501072_0036953_3032_3631 194
170 3300049589 Ga0501073_0023123 Ga0501073_0023123_2246_2845 194
171 3300049589 Ga0501073_0450249 Ga0501073_0450249_65_664 194
172 3300049742 Ga0501080_0152982 Ga0501080_0152982_108_707 194
173 3300053136 Ga0500559_0041000 Ga0500559_0041000_830_1426 194
174 3300053140 Ga0500573_0017289 Ga0500573_0017289_1335_1931 194
175 3300053140 Ga0500573_0104239 Ga0500573_0104239_15_611 194
176 3300053142 Ga0500577_0122722 Ga0500577_0122722_379_975 194
177 3300053153 Ga0500616_0000027 Ga0500616_0000027_84299_84901 194
178 iso_pu_bacteria 2585428094 2587864041 194
179 iso_pu_bacteria 2643221546 2643754414 194
180 iso_pu_bacteria 2643221572 2643876297 194
181 iso_pu_bacteria 2643221619 2644111843 194
182 iso_pu_bacteria 2643221649 2644278634 194
183 iso_pu_bacteria 2643221669 2644383352 194
184 iso_pu_bacteria 2721755702 2723641307 194
185 iso_pu_bacteria 2808606306 2808630472 194
186 iso_pu_bacteria 2808606372 2808901199 194
187 iso_pu_bacteria 2857720070 2857720669 194
188 iso_pu_bacteria 2862993130 2862993488 194
189 iso_pu_bacteria 2870628048 2870630998 194
190 iso_pu_bacteria 2895660088 2895660477 194
191 iso_pu_bacteria 2906799679 2906801032 194
192 iso_pu_bacteria 2919443155 2919445705 194
193 iso_pu_bacteria 2928090899 2928091444 194
194 iso_pu_bacteria 2935409751 2935410720 194
195 iso_pu_bacteria 2946033335 2946036746 194
196 iso_pu_bacteria 2964326757 2964328584 194
197 iso_pu_bacteria 2984580707 2984581811 194
198 3300002067 JGI24735J21928_10000949 JGI24735J21928_100009499 195
199 3300002772 JGI25164J39214_1000221 JGI25164J39214_100022140 195
200 3300003214 JGI25165J46597_1000332 JGI25165J46597_100033211 195
201 3300003578 Ga0006562J51391_1008124 Ga0006562J51391_100812419 195
202 3300003578 Ga0006562J51391_1008125 Ga0006562J51391_10081257 195
203 3300003752 Ga0055539_1000005 Ga0055539_1000005479 195
204 3300003756 Ga0055533_1000001 Ga0055533_10000011548 195
205 3300003759 Ga0055525_1000290 Ga0055525_100029031 195
206 3300003759 Ga0055525_1003999 Ga0055525_10039992 195
207 3300003760 Ga0055527_1000017 Ga0055527_1000017201 195
208 3300003762 Ga0055542_1000044 Ga0055542_1000044201 195
209 3300003763 Ga0055529_1000093 Ga0055529_100009350 195
210 3300003841 Ga0055541_1001300 Ga0055541_10013005 195
211 3300005327 Ga0070658_10000242 Ga0070658_1000024245 195
212 3300005327 Ga0070658_10009630 Ga0070658_100096303 195
213 3300005539 Ga0068853_100214117 Ga0068853_1002141172 195
214 3300005563 Ga0068855_100370070 Ga0068855_1003700702 195
215 3300006186 Ga0075369_10212643 Ga0075369_102126433 195
216 3300013102 Ga0157371_10001468 Ga0157371_1000146821 195
217 3300013102 Ga0157371_10305818 Ga0157371_103058182 195
218 3300013104 Ga0157370_10035185 Ga0157370_100351853 195
219 3300013104 Ga0157370_10162974 Ga0157370_101629742 195
220 3300013105 Ga0157369_10022781 Ga0157369_100227819 195
221 3300013105 Ga0157369_10179443 Ga0157369_101794434 195
222 3300013105 Ga0157369_10190543 Ga0157369_101905433 195
223 3300013306 Ga0163162_10573119 Ga0163162_105731193 195
224 3300020070 Ga0206356_10767943 Ga0206356_107679432 195
225 3300020081 Ga0206354_11038418 Ga0206354_110384182 195
226 3300020082 Ga0206353_11859887 Ga0206353_118598871 195
227 3300022467 Ga0224712_10048179 Ga0224712_100481792 195
228 3300025225 Ga0209566_100053 Ga0209566_100053134 195
229 3300025226 Ga0209674_100001 Ga0209674_1000011549 195
230 3300025228 Ga0209672_100039 Ga0209672_100039204 195
231 3300025229 Ga0209147_100651 Ga0209147_10065111 195
232 3300025230 Ga0209563_100001 Ga0209563_1000011549 195
233 3300025230 Ga0209563_100314 Ga0209563_10031418 195
234 3300025231 Ga0207427_100042 Ga0207427_100042208 195
235 3300025233 Ga0209437_100883 Ga0209437_1008832 195
236 3300025242 Ga0209258_100996 Ga0209258_10099611 195
237 3300025253 Ga0209677_100001 Ga0209677_1000011549 195
238 3300025253 Ga0209677_100767 Ga0209677_10076711 195
239 3300025254 Ga0209148_1000004 Ga0209148_1000004204 195
240 3300025261 Ga0209233_1000001 Ga0209233_10000011294 195
241 3300025272 Ga0209455_1000117 Ga0209455_100011729 195
242 3300025272 Ga0209455_1001672 Ga0209455_10016725 195
243 3300025898 Ga0207692_10052701 Ga0207692_100527012 195
244 3300025904 Ga0207647_10103309 Ga0207647_101033092 195
245 3300025904 Ga0207647_10111676 Ga0207647_101116762 195
246 3300025909 Ga0207705_10000001 Ga0207705_10000001477 195
247 3300025909 Ga0207705_10192387 Ga0207705_101923871 195
248 3300025919 Ga0207657_10054893 Ga0207657_100548933 195
249 3300026041 Ga0207639_10794715 Ga0207639_107947151 195
250 3300026067 Ga0207678_10098652 Ga0207678_100986523 195
251 3300031456 Ga0307513_10255017 Ga0307513_102550172 195
252 3300031649 Ga0307514_10010986 Ga0307514_100109867 195
253 3300031649 Ga0307514_10215574 Ga0307514_102155742 195
254 3300037312 Ga0395899_0001710 Ga0395899_0001710_5802_6398 195
255 3300037312 Ga0395899_0018259 Ga0395899_0018259_4312_4911 195
256 3300037418 Ga0395900_0001961 Ga0395900_0001961_7657_8256 195
257 3300037466 Ga0395898_0000256 Ga0395898_0000256_103518_104117 195
258 3300037466 Ga0395898_0826353 Ga0395898_0826353_39_635 195
259 3300038443 Ga0395901_0230664 Ga0395901_0230664_424_1020 195
260 3300041451 Ga0451791_0274792 Ga0451791_0274792_31_627 195
261 3300041452 Ga0451793_0145361 Ga0451793_0145361_148_762 195
262 3300041452 Ga0451793_1562054 Ga0451793_1562054_345_950 195
263 3300041452 Ga0451793_1673339 Ga0451793_1673339_161_757 195
264 3300041460 Ga0451802_0987753 Ga0451802_0987753_1017_1622 195
265 3300041462 Ga0451806_163518 Ga0451806_163518_331_936 195
266 3300041462 Ga0451806_327088 Ga0451806_327088_119_724 195
267 3300044656 Ga0466969_0227516 Ga0466969_0227516_14_634 195
268 3300044658 Ga0466972_0080289 Ga0466972_0080289_879_1475 195
269 3300044658 Ga0466972_0114948 Ga0466972_0114948_131_727 195
270 3300044683 Ga0466965_0017016 Ga0466965_0017016_2031_2627 195
271 3300044683 Ga0466965_0035346 Ga0466965_0035346_278_874 195
272 3300044683 Ga0466965_0044968 Ga0466965_0044968_527_1123 195
273 3300044684 Ga0466966_0039372 Ga0466966_0039372_313_909 195
274 3300044684 Ga0466966_0072748 Ga0466966_0072748_742_1338 195
275 3300044693 Ga0466961_0042425 Ga0466961_0042425_1238_1834 195
276 3300044693 Ga0466961_0103566 Ga0466961_0103566_996_1592 195
277 3300044693 Ga0466961_0174303 Ga0466961_0174303_249_845 195
278 3300044694 Ga0466963_0395971 Ga0466963_0395971_205_822 195
279 3300044735 Ga0466968_0108898 Ga0466968_0108898_242_838 195
280 3300044765 Ga0466970_0024421 Ga0466970_0024421_1793_2410 195
281 3300044765 Ga0466970_0032170 Ga0466970_0032170_720_1316 195
282 3300044765 Ga0466970_0074090 Ga0466970_0074090_829_1425 195
283 3300044765 Ga0466970_0092088 Ga0466970_0092088_376_972 195
284 3300044842 Ga0466957_0166621 Ga0466957_0166621_49_645 195
285 3300044901 Ga0466960_0021746 Ga0466960_0021746_1811_2407 195
286 3300044901 Ga0466960_0033580 Ga0466960_0033580_219_836 195
287 3300044901 Ga0466960_0089983 Ga0466960_0089983_445_1041 195
288 3300044901 Ga0466960_0232895 Ga0466960_0232895_376_972 195
289 3300044901 Ga0466960_0340034 Ga0466960_0340034_114_725 195
290 3300045049 Ga0466959_0008374 Ga0466959_0008374_1185_1781 195
291 3300045049 Ga0466959_0146841 Ga0466959_0146841_1022_1633 195
292 3300045049 Ga0466959_0287948 Ga0466959_0287948_514_1110 195
293 3300045836 Ga0466958_0048468 Ga0466958_0048468_1047_1643 195
294 3300047320 Ga0495672_0006728 Ga0495672_0006728_7834_8430 195
295 3300048903 Ga0496100_0097665 Ga0496100_0097665_542_1138 195
296 3300048903 Ga0496100_0173700 Ga0496100_0173700_158_754 195
297 3300048904 Ga0496101_0036861 Ga0496101_0036861_530_1126 195
298 3300048904 Ga0496101_0898198 Ga0496101_0898198_37_633 195
299 3300048905 Ga0496102_0337605 Ga0496102_0337605_313_909 195
300 3300048905 Ga0496102_0591892 Ga0496102_0591892_89_685 195
301 3300048907 Ga0496104_0359591 Ga0496104_0359591_298_894 195
302 3300048908 Ga0496105_0044624 Ga0496105_0044624_2911_3507 195
303 3300048908 Ga0496105_0133143 Ga0496105_0133143_1119_1715 195
304 3300048908 Ga0496105_0176347 Ga0496105_0176347_632_1228 195
305 3300048910 Ga0496107_0497441 Ga0496107_0497441_106_702 195
306 3300048916 Ga0496113_0254353 Ga0496113_0254353_649_1245 195
307 3300048917 Ga0496114_0010803 Ga0496114_0010803_3333_3929 195
308 3300048918 Ga0496115_0048762 Ga0496115_0048762_879_1475 195
309 3300048918 Ga0496115_0158270 Ga0496115_0158270_1228_1824 195
310 3300048918 Ga0496115_0378763 Ga0496115_0378763_97_693 195
311 3300048920 Ga0496117_0047380 Ga0496117_0047380_2076_2672 195
312 3300048920 Ga0496117_0130435 Ga0496117_0130435_195_791 195
313 3300048921 Ga0496118_0016874 Ga0496118_0016874_804_1400 195
314 3300048922 Ga0496119_0003077 Ga0496119_0003077_10298_10906 195
315 3300048922 Ga0496119_0228971 Ga0496119_0228971_240_836 195
316 3300048923 Ga0496120_0015914 Ga0496120_0015914_1914_2522 195
317 3300048924 Ga0496121_0000015 Ga0496121_0000015_122118_122717 195
318 3300048924 Ga0496121_0358006 Ga0496121_0358006_31_642 195
319 3300048925 Ga0496122_0001338 Ga0496122_0001338_29810_30406 195
320 3300048926 Ga0496123_0002073 Ga0496123_0002073_23572_24168 195
321 3300048926 Ga0496123_0157397 Ga0496123_0157397_353_961 195
322 3300048929 Ga0496126_0002020 Ga0496126_0002020_1065_1661 195
323 3300048929 Ga0496126_0052793 Ga0496126_0052793_887_1483 195
324 3300049569 Ga0501032_0006872 Ga0501032_0006872_7428_8024 195
325 3300049569 Ga0501032_0050904 Ga0501032_0050904_1948_2556 195
326 3300049569 Ga0501032_0138170 Ga0501032_0138170_608_1207 195
327 3300049570 Ga0501033_0003795 Ga0501033_0003795_5376_5972 195
328 3300049570 Ga0501033_0125584 Ga0501033_0125584_271_867 195
329 3300049570 Ga0501033_0189976 Ga0501033_0189976_139_735 195
330 3300049570 Ga0501033_0221365 Ga0501033_0221365_366_962 195
331 3300049571 Ga0501034_0018926 Ga0501034_0018926_1514_2110 195
332 3300049572 Ga0501036_0008682 Ga0501036_0008682_7377_7973 195
333 3300049572 Ga0501036_0068300 Ga0501036_0068300_2222_2830 195
334 3300049573 Ga0501037_0012832 Ga0501037_0012832_5379_5975 195
335 3300049574 Ga0501038_0006592 Ga0501038_0006592_6987_7583 195
336 3300049574 Ga0501038_0480369 Ga0501038_0480369_42_650 195
337 3300049575 Ga0501039_0024930 Ga0501039_0024930_2718_3314 195
338 3300049579 Ga0501043_0052603 Ga0501043_0052603_1104_1712 195
339 3300049579 Ga0501043_0058075 Ga0501043_0058075_1448_2044 195
340 3300049579 Ga0501043_0090918 Ga0501043_0090918_936_1532 195
341 3300049580 Ga0501046_0014566 Ga0501046_0014566_4348_4944 195
342 3300049580 Ga0501046_0031887 Ga0501046_0031887_1666_2262 195
343 3300049581 Ga0501047_0008648 Ga0501047_0008648_4156_4752 195
344 3300049581 Ga0501047_0009443 Ga0501047_0009443_1676_2272 195
345 3300049581 Ga0501047_0021425 Ga0501047_0021425_5333_5941 195
346 3300049581 Ga0501047_0447702 Ga0501047_0447702_466_1062 195
347 3300049581 Ga0501047_0616546 Ga0501047_0616546_220_816 195
348 3300049582 Ga0501048_0137548 Ga0501048_0137548_658_1254 195
349 3300049584 Ga0501068_0104495 Ga0501068_0104495_551_1147 195
350 3300049586 Ga0501070_0000472 Ga0501070_0000472_22885_23481 195
351 3300049586 Ga0501070_0075803 Ga0501070_0075803_1805_2404 195
352 3300049589 Ga0501073_0000020 Ga0501073_0000020_15122_15721 195
353 3300049590 Ga0501074_0119445 Ga0501074_0119445_833_1432 195
354 3300049742 Ga0501080_0072299 Ga0501080_0072299_827_1426 195
355 3300049744 Ga0501083_0000119 Ga0501083_0000119_25028_25624 195
356 3300049744 Ga0501083_0027579 Ga0501083_0027579_2638_3234 195
357 3300049822 Ga0501035_0001199 Ga0501035_0001199_13114_13722 195
358 3300049822 Ga0501035_0056210 Ga0501035_0056210_2829_3425 195
359 3300049823 Ga0501044_0000954 Ga0501044_0000954_13795_14403 195
360 3300049823 Ga0501044_0015730 Ga0501044_0015730_1464_2060 195
361 3300049823 Ga0501044_0027761 Ga0501044_0027761_4091_4687 195
362 3300049823 Ga0501044_0062953 Ga0501044_0062953_2885_3481 195
363 3300049824 Ga0501045_0097959 Ga0501045_0097959_1176_1772 195
364 3300050496 nmdc:mga07m45_370817_c1 nmdc:mga07m45_370817_c1_17_613 195
365 3300050516 nmdc:mga0sz30_174518_c1 nmdc:mga0sz30_174518_c1_72_674 195
366 3300053080 Ga0500635_0000037 Ga0500635_0000037_8438_9034 195
367 3300053087 Ga0500643_000224 Ga0500643_000224_12081_12677 195
368 3300053104 Ga0500556_0000100 Ga0500556_0000100_39153_39749 195
369 3300053136 Ga0500559_0002146 Ga0500559_0002146_5588_6184 195
370 3300053136 Ga0500559_0010960 Ga0500559_0010960_256_852 195
371 3300053139 Ga0500568_0000100 Ga0500568_0000100_38729_39325 195
372 3300053140 Ga0500573_0000014 Ga0500573_0000014_140442_141038 195
373 3300053140 Ga0500573_0015993 Ga0500573_0015993_1726_2322 195
374 3300053140 Ga0500573_0081834 Ga0500573_0081834_1069_1665 195
375 3300053140 Ga0500573_0122652 Ga0500573_0122652_418_1014 195
376 3300053140 Ga0500573_0222863 Ga0500573_0222863_304_921 195
377 3300053142 Ga0500577_0012280 Ga0500577_0012280_1290_1886 195
378 3300061719 Ga0466962_0050072 Ga0466962_0050072_715_1311 195
379 iso_pu_bacteria 2643221542 2643732399 195
380 iso_pu_bacteria 2643221553 2643786494 195
381 iso_pu_bacteria 2643221630 2644171219 195
382 iso_pu_bacteria 2643221724 2644681194 195
383 iso_pu_bacteria 2728369380 2730230373 195
384 iso_pu_bacteria 2747842429 2747953756 195
385 iso_pu_bacteria 2808606368 2808883400 195
386 iso_pu_bacteria 2821268502 2821270799 195
387 iso_pu_bacteria 2852646457 2852648980 195
388 iso_pu_bacteria 2852663356 2852664263 195
389 iso_pu_bacteria 2857723135 2857724801 195
390 iso_pu_bacteria 2945968032 2945968596 195
391 iso_pu_bacteria 2946041624 2946045039 195
392 iso_pu_bacteria 2946080515 2946084210 195
393 iso_pu_bacteria 8004182704 8004184678 195
394 3300005437 Ga0070710_10113730 Ga0070710_101137302 196
395 3300005535 Ga0070684_100349454 Ga0070684_1003494542 196
396 3300005841 Ga0068863_100185860 Ga0068863_1001858604 196
397 3300006038 Ga0075365_10016097 Ga0075365_100160978 196
398 3300006038 Ga0075365_10029912 Ga0075365_100299125 196
399 3300006038 Ga0075365_10304126 Ga0075365_103041262 196
400 3300006051 Ga0075364_10007603 Ga0075364_100076034 196
401 3300006186 Ga0075369_10016635 Ga0075369_100166353 196
402 3300009177 Ga0105248_10000424 Ga0105248_100004246 196
403 3300009545 Ga0105237_10074674 Ga0105237_100746744 196
404 3300010375 Ga0105239_10787350 Ga0105239_107873501 196
405 3300013250 Ga0171462_1004 Ga0171462_1004359 196
406 3300013308 Ga0157375_10358230 Ga0157375_103582302 196
407 3300014325 Ga0163163_10476093 Ga0163163_104760932 196
408 3300025914 Ga0207671_10041954 Ga0207671_100419543 196
409 3300025941 Ga0207711_10000299 Ga0207711_1000029928 196
410 3300026088 Ga0207641_10131163 Ga0207641_101311632 196
411 3300028794 Ga0307515_10091635 Ga0307515_100916355 196
412 3300028794 Ga0307515_10095090 Ga0307515_100950902 196
413 3300028794 Ga0307515_10627780 Ga0307515_106277801 196
414 3300031901 Ga0307406_10039854 Ga0307406_100398545 196
415 3300031901 Ga0307406_10275486 Ga0307406_102754861 196
416 3300031995 Ga0307409_100348719 Ga0307409_1003487192 196
417 3300032004 Ga0307414_11082901 Ga0307414_110829012 196
418 3300041452 Ga0451793_0717453 Ga0451793_0717453_418_1029 196
419 3300041512 Ga0451853_2950517 Ga0451853_2950517_44_643 196
420 3300044735 Ga0466968_0026597 Ga0466968_0026597_503_1105 196
421 3300046518 Ga0495631_0206272 Ga0495631_0206272_46_657 196
422 3300046523 Ga0495644_0045154 Ga0495644_0045154_178_789 196
423 3300046615 Ga0495656_0047903 Ga0495656_0047903_1125_1736 196
424 3300048904 Ga0496101_0065460 Ga0496101_0065460_1916_2536 196
425 3300048910 Ga0496107_0057555 Ga0496107_0057555_375_995 196
426 3300048911 Ga0496108_0144075 Ga0496108_0144075_298_918 196
427 3300048914 Ga0496111_0584472 Ga0496111_0584472_12_617 196
428 3300048915 Ga0496112_0122696 Ga0496112_0122696_845_1465 196
429 3300048917 Ga0496114_0056472 Ga0496114_0056472_1613_2233 196
430 3300048919 Ga0496116_0009343 Ga0496116_0009343_5270_5869 196
431 3300048920 Ga0496117_0000187 Ga0496117_0000187_34372_35007 196
432 3300048920 Ga0496117_0001882 Ga0496117_0001882_12198_12803 196
433 3300048920 Ga0496117_0007327 Ga0496117_0007327_5455_6054 196
434 3300048920 Ga0496117_0125676 Ga0496117_0125676_491_1105 196
435 3300048921 Ga0496118_0005514 Ga0496118_0005514_765_1370 196
436 3300048921 Ga0496118_0180669 Ga0496118_0180669_320_934 196
437 3300048922 Ga0496119_0000295 Ga0496119_0000295_65377_65979 196
438 3300048922 Ga0496119_0002996 Ga0496119_0002996_1880_2485 196
439 3300048922 Ga0496119_0006539 Ga0496119_0006539_3457_4056 196
440 3300048922 Ga0496119_0041137 Ga0496119_0041137_1624_2238 196
441 3300048923 Ga0496120_0002268 Ga0496120_0002268_4290_4889 196
442 3300048923 Ga0496120_0008376 Ga0496120_0008376_5075_5680 196
443 3300048925 Ga0496122_0000096 Ga0496122_0000096_15191_15790 196
444 3300048925 Ga0496122_0000420 Ga0496122_0000420_19280_19885 196
445 3300048926 Ga0496123_0000031 Ga0496123_0000031_46211_46810 196
446 3300048926 Ga0496123_0000354 Ga0496123_0000354_68981_69586 196
447 3300048927 Ga0496124_0001640 Ga0496124_0001640_17736_18335 196
448 3300048927 Ga0496124_0002851 Ga0496124_0002851_15753_16358 196
449 3300048927 Ga0496124_0211315 Ga0496124_0211315_451_1053 196
450 3300048928 Ga0496125_0010731 Ga0496125_0010731_4692_5297 196
451 3300048928 Ga0496125_0422876 Ga0496125_0422876_119_718 196
452 3300048929 Ga0496126_0048582 Ga0496126_0048582_467_1072 196
453 3300048929 Ga0496126_0069342 Ga0496126_0069342_2348_2953 196
454 3300048929 Ga0496126_0567227 Ga0496126_0567227_282_881 196
455 3300048929 Ga0496126_0570976 Ga0496126_0570976_81_695 196
456 3300049573 Ga0501037_0486936 Ga0501037_0486936_199_801 196
457 3300049575 Ga0501039_0076532 Ga0501039_0076532_78_680 196
458 3300049577 Ga0501041_0181931 Ga0501041_0181931_314_916 196
459 3300049579 Ga0501043_0537765 Ga0501043_0537765_51_653 196
460 3300049586 Ga0501070_0001725 Ga0501070_0001725_14989_15591 196
461 3300050491 nmdc:mga00v17_115847_c1 nmdc:mga00v17_115847_c1_780_1379 196
462 3300050491 nmdc:mga00v17_17273_c1 nmdc:mga00v17_17273_c1_2584_3189 196
463 3300050492 nmdc:mga0yw44_270282_c1 nmdc:mga0yw44_270282_c1_283_882 196
464 3300050492 nmdc:mga0yw44_4797_c1 nmdc:mga0yw44_4797_c1_1381_1986 196
465 3300050492 nmdc:mga0yw44_91349_c1 nmdc:mga0yw44_91349_c1_154_759 196
466 3300050516 nmdc:mga0sz30_3916_c2 nmdc:mga0sz30_3916_c2_2365_2970 196
467 3300053104 Ga0500556_0000608 Ga0500556_0000608_16703_17311 196
468 3300053117 Ga0500593_001363 Ga0500593_001363_223_831 196
469 3300053133 Ga0500655_009157 Ga0500655_009157_776_1384 196
470 3300053136 Ga0500559_0000255 Ga0500559_0000255_7109_7714 196
471 3300053140 Ga0500573_0009695 Ga0500573_0009695_727_1338 196
472 3300053153 Ga0500616_0083024 Ga0500616_0083024_606_1211 196
473 iso_pu_bacteria 2643221549 2643768467 196
474 iso_pu_bacteria 2919395869 2919398064 196
475 3300013105 Ga0157369_10009294 Ga0157369_1000929411 197
476 3300013105 Ga0157369_10930617 Ga0157369_109306171 197
477 3300020069 Ga0197907_11172585 Ga0197907_111725852 197
478 3300020082 Ga0206353_10979951 Ga0206353_109799512 197
479 3300031824 Ga0307413_10099977 Ga0307413_100999772 197
480 3300031901 Ga0307406_10338448 Ga0307406_103384482 197
481 3300031995 Ga0307409_100532032 Ga0307409_1005320322 197
482 3300032002 Ga0307416_100710440 Ga0307416_1007104402 197
483 3300038443 Ga0395901_0588300 Ga0395901_0588300_281_919 197
484 3300041413 Ga0439465_0026855 Ga0439465_0026855_465_1061 197
485 3300041512 Ga0451853_3475911 Ga0451853_3475911_214_813 197
486 3300044693 Ga0466961_0356115 Ga0466961_0356115_195_836 197
487 3300048904 Ga0496101_0273248 Ga0496101_0273248_242_847 197
488 3300048907 Ga0496104_0133040 Ga0496104_0133040_1439_2044 197
489 3300048908 Ga0496105_0047943 Ga0496105_0047943_50_655 197
490 3300048912 Ga0496109_0200622 Ga0496109_0200622_144_749 197
491 3300048916 Ga0496113_0130185 Ga0496113_0130185_777_1382 197
492 3300048917 Ga0496114_0015114 Ga0496114_0015114_323_928 197
493 3300048917 Ga0496114_0183597 Ga0496114_0183597_550_1155 197
494 3300048917 Ga0496114_0806485 Ga0496114_0806485_49_690 197
495 3300048920 Ga0496117_0090269 Ga0496117_0090269_68_772 197
496 3300048921 Ga0496118_0127819 Ga0496118_0127819_36_740 197
497 3300053142 Ga0500577_0135455 Ga0500577_0135455_273_893 197
498 3300005339 Ga0070660_100428178 Ga0070660_1004281781 198
499 3300005354 Ga0070675_100202895 Ga0070675_1002028952 198
500 3300005355 Ga0070671_100150166 Ga0070671_1001501662 198
501 3300005455 Ga0070663_100094154 Ga0070663_1000941543 198
502 3300005457 Ga0070662_100420868 Ga0070662_1004208682 198
503 3300005530 Ga0070679_100216383 Ga0070679_1002163832 198
504 3300005543 Ga0070672_100002268 Ga0070672_10000226813 198
505 3300005563 Ga0068855_100001410 Ga0068855_10000141030 198
506 3300005563 Ga0068855_100518004 Ga0068855_1005180042 198
507 3300005618 Ga0068864_100039667 Ga0068864_1000396674 198
508 3300005618 Ga0068864_100356062 Ga0068864_1003560622 198
509 3300005840 Ga0068870_10089760 Ga0068870_100897604 198
510 3300006048 Ga0075363_100253286 Ga0075363_1002532863 198
511 3300006051 Ga0075364_10017368 Ga0075364_100173685 198
512 3300009094 Ga0111539_11952035 Ga0111539_119520351 198
513 3300014325 Ga0163163_10835155 Ga0163163_108351553 198
514 3300014326 Ga0157380_10002067 Ga0157380_100020679 198
515 3300025904 Ga0207647_10018242 Ga0207647_100182424 198
516 3300025908 Ga0207643_10107185 Ga0207643_101071852 198
517 3300025919 Ga0207657_10141957 Ga0207657_101419571 198
518 3300025936 Ga0207670_10547981 Ga0207670_105479813 198
519 3300025940 Ga0207691_10099205 Ga0207691_100992055 198
520 3300025949 Ga0207667_10004099 Ga0207667_100040992 198
521 3300025972 Ga0207668_10250022 Ga0207668_102500222 198
522 3300026067 Ga0207678_10110664 Ga0207678_101106642 198
523 3300026075 Ga0207708_10122148 Ga0207708_101221482 198
524 3300026095 Ga0207676_10322733 Ga0207676_103227332 198
525 3300031824 Ga0307413_10118147 Ga0307413_101181473 198
526 3300031852 Ga0307410_10461199 Ga0307410_104611992 198
527 3300031901 Ga0307406_10282229 Ga0307406_102822292 198
528 3300031911 Ga0307412_10453550 Ga0307412_104535502 198
529 3300031995 Ga0307409_100047306 Ga0307409_1000473062 198
530 3300031995 Ga0307409_100319496 Ga0307409_1003194962 198
531 3300031995 Ga0307409_100343830 Ga0307409_1003438302 198
532 3300032002 Ga0307416_101015173 Ga0307416_1010151732 198
533 3300032005 Ga0307411_10252220 Ga0307411_102522203 198
534 3300037312 Ga0395899_0249666 Ga0395899_0249666_433_1032 198
535 3300041411 Ga0439466_0078553 Ga0439466_0078553_270_878 198
536 3300041413 Ga0439465_0158934 Ga0439465_0158934_140_748 198
537 3300044683 Ga0466965_0000006 Ga0466965_0000006_30558_31187 198
538 3300046660 Ga0495625_0246953 Ga0495625_0246953_517_1125 198
539 3300046691 Ga0495670_0340116 Ga0495670_0340116_138_746 198
540 3300048905 Ga0496102_0049380 Ga0496102_0049380_774_1382 198
541 3300048910 Ga0496107_0237945 Ga0496107_0237945_127_735 198
542 3300048911 Ga0496108_0404796 Ga0496108_0404796_530_1138 198
543 3300048927 Ga0496124_0045188 Ga0496124_0045188_2900_3505 198
544 3300049569 Ga0501032_0148657 Ga0501032_0148657_373_1005 198
545 3300049569 Ga0501032_0241203 Ga0501032_0241203_357_989 198
546 3300049570 Ga0501033_0037252 Ga0501033_0037252_1638_2270 198
547 3300049570 Ga0501033_0463911 Ga0501033_0463911_174_806 198
548 3300049571 Ga0501034_0001844 Ga0501034_0001844_7481_8080 198
549 3300049571 Ga0501034_0184870 Ga0501034_0184870_1310_1942 198
550 3300049571 Ga0501034_0278133 Ga0501034_0278133_193_825 198
551 3300049572 Ga0501036_0188489 Ga0501036_0188489_89_721 198
552 3300049572 Ga0501036_0270516 Ga0501036_0270516_593_1225 198
553 3300049573 Ga0501037_0049354 Ga0501037_0049354_1958_2590 198
554 3300049574 Ga0501038_0012905 Ga0501038_0012905_1811_2413 198
555 3300049574 Ga0501038_0015566 Ga0501038_0015566_4350_4958 198
556 3300049574 Ga0501038_0040432 Ga0501038_0040432_511_1143 198
557 3300049574 Ga0501038_0159929 Ga0501038_0159929_788_1420 198
558 3300049579 Ga0501043_0241700 Ga0501043_0241700_52_684 198
559 3300049581 Ga0501047_0105989 Ga0501047_0105989_1934_2566 198
560 3300049582 Ga0501048_0440024 Ga0501048_0440024_48_680 198
561 3300049586 Ga0501070_0265169 Ga0501070_0265169_747_1379 198
562 3300049589 Ga0501073_0270458 Ga0501073_0270458_393_1025 198
563 3300049742 Ga0501080_0502754 Ga0501080_0502754_124_732 198
564 3300049822 Ga0501035_0982583 Ga0501035_0982583_10_618 198
565 3300050490 nmdc:mga03n38_209011_c1 nmdc:mga03n38_209011_c1_202_810 198
566 3300050491 nmdc:mga00v17_343859_c1 nmdc:mga00v17_343859_c1_270_872 198
567 3300053139 Ga0500568_0000832 Ga0500568_0000832_12745_13374 198
568 3300053140 Ga0500573_0003491 Ga0500573_0003491_683_1303 198
569 3300003320 rootH2_10097482 rootH2_100974823 199
570 3300005288 Ga0065714_10076428 Ga0065714_100764281 199
571 3300005339 Ga0070660_100880850 Ga0070660_1008808501 199
572 3300006038 Ga0075365_10002264 Ga0075365_100022644 199
573 3300006048 Ga0075363_100026400 Ga0075363_1000264002 199
574 3300006051 Ga0075364_10005896 Ga0075364_100058966 199
575 3300006051 Ga0075364_10019310 Ga0075364_100193105 199
576 3300006051 Ga0075364_10122135 Ga0075364_101221353 199
577 3300006178 Ga0075367_10001326 Ga0075367_100013263 199
578 3300006186 Ga0075369_10039246 Ga0075369_100392462 199
579 3300006353 Ga0075370_10004060 Ga0075370_100040602 199
580 3300009036 Ga0105244_10017100 Ga0105244_100171005 199
581 3300009036 Ga0105244_10068730 Ga0105244_100687302 199
582 3300009148 Ga0105243_10001650 Ga0105243_100016503 199
583 3300013104 Ga0157370_10198313 Ga0157370_101983133 199
584 3300013105 Ga0157369_10294494 Ga0157369_102944941 199
585 3300013105 Ga0157369_10318378 Ga0157369_103183782 199
586 3300013306 Ga0163162_10298489 Ga0163162_102984893 199
587 3300025246 Ga0209646_1000013 Ga0209646_1000013111 199
588 3300025728 Ga0207655_1017153 Ga0207655_10171531 199
589 3300025728 Ga0207655_1025611 Ga0207655_10256114 199
590 3300025935 Ga0207709_10005233 Ga0207709_100052337 199
591 3300025935 Ga0207709_10044868 Ga0207709_100448683 199
592 3300031901 Ga0307406_10000031 Ga0307406_1000003169 199
593 3300031901 Ga0307406_10023972 Ga0307406_100239725 199
594 3300031901 Ga0307406_10133718 Ga0307406_101337182 199
595 3300031911 Ga0307412_10158463 Ga0307412_101584634 199
596 3300032004 Ga0307414_10041922 Ga0307414_100419222 199
597 3300032004 Ga0307414_10049391 Ga0307414_100493912 199
598 3300032004 Ga0307414_10166530 Ga0307414_101665304 199
599 3300032005 Ga0307411_10166905 Ga0307411_101669054 199
600 3300041453 Ga0451797_1450500 Ga0451797_1450500_73_696 199
601 3300041494 Ga0451837_0799652 Ga0451837_0799652_124_726 199
602 3300042122 Ga0450920_023153 Ga0450920_023153_163_786 199
603 3300044901 Ga0466960_0114379 Ga0466960_0114379_632_1234 199
604 3300046453 Ga0495627_001242 Ga0495627_001242_5714_6316 199
605 3300046471 Ga0495650_0032495 Ga0495650_0032495_1325_1948 199
606 3300046530 Ga0495654_0161063 Ga0495654_0161063_146_766 199
607 3300048905 Ga0496102_0020518 Ga0496102_0020518_638_1258 199
608 3300048906 Ga0496103_0006028 Ga0496103_0006028_1537_2157 199
609 3300048908 Ga0496105_0066187 Ga0496105_0066187_616_1236 199
610 3300048912 Ga0496109_0174325 Ga0496109_0174325_104_724 199
611 3300048918 Ga0496115_0015057 Ga0496115_0015057_4571_5191 199
612 3300048920 Ga0496117_0000726 Ga0496117_0000726_2655_3257 199
613 3300048921 Ga0496118_0051220 Ga0496118_0051220_520_1122 199
614 3300048924 Ga0496121_0259035 Ga0496121_0259035_340_942 199
615 3300048925 Ga0496122_0019490 Ga0496122_0019490_2840_3442 199
616 3300048925 Ga0496122_0054587 Ga0496122_0054587_1331_1933 199
617 3300048925 Ga0496122_0110235 Ga0496122_0110235_284_886 199
618 3300048927 Ga0496124_0199275 Ga0496124_0199275_102_704 199
619 3300048927 Ga0496124_0314723 Ga0496124_0314723_191_793 199
620 3300048928 Ga0496125_0001305 Ga0496125_0001305_342_944 199
621 3300048928 Ga0496125_0019602 Ga0496125_0019602_336_938 199
622 3300048928 Ga0496125_0075309 Ga0496125_0075309_416_1018 199
623 3300048928 Ga0496125_0086091 Ga0496125_0086091_374_976 199
624 3300048929 Ga0496126_0012712 Ga0496126_0012712_5322_5924 199
625 3300048929 Ga0496126_0044681 Ga0496126_0044681_999_1601 199
626 3300048929 Ga0496126_0149012 Ga0496126_0149012_841_1443 199
627 3300050491 nmdc:mga00v17_27127_c1 nmdc:mga00v17_27127_c1_759_1361 199
628 3300050491 nmdc:mga00v17_2726_c1 nmdc:mga00v17_2726_c1_7154_7756 199
629 3300050491 nmdc:mga00v17_288012_c1 nmdc:mga00v17_288012_c1_104_706 199
630 3300050492 nmdc:mga0yw44_59599_c1 nmdc:mga0yw44_59599_c1_1646_2269 199
631 3300050494 nmdc:mga06z11_34271_c1 nmdc:mga06z11_34271_c1_822_1445 199
632 3300050496 nmdc:mga07m45_24824_c1 nmdc:mga07m45_24824_c1_1783_2406 199
633 3300003578 Ga0006562J51391_1023978 Ga0006562J51391_10239782 200
634 3300003578 Ga0006562J51391_1023979 Ga0006562J51391_10239794 200
635 3300044765 Ga0466970_0000230 Ga0466970_0000230_1869_2489 206
636 3300044842 Ga0466957_0228093 Ga0466957_0228093_261_881 206
637 3300045976 Ga0466967_0312731 Ga0466967_0312731_94_714 206
638 3300001979 JGI24740J21852_10001187 JGI24740J21852_100011877 207
639 3300009148 Ga0105243_10330156 Ga0105243_103301562 207
640 3300013102 Ga0157371_10211189 Ga0157371_102111893 207
641 3300025935 Ga0207709_10072755 Ga0207709_100727554 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08768

THAP4_heme-bd

THAP4-like, heme-binding beta-barrel domain

11

232

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fwv-assembly1.cif.gz_A crystal structure of rv0813 0.8642 7 206
3ia8-assembly1.cif.gz_A the structure of the c-terminal heme nitrobindin domain of thap domain-containing protein 4 from homo sapiens 0.8631 5 207
3ia8-assembly1.cif.gz_A the structure of the c-terminal heme nitrobindin domain of thap domain-containing protein 4 from homo sapiens 0.8533 5 207
3wjf-assembly1.cif.gz_B crystal structure of mutant nitrobindin m75l/h76l/q96c/v128w/m148l/h158l (nb9) from arabidopsis thaliana 0.8354 5 207
3wjc-assembly1.cif.gz_B crystal structure of mutant nitrobindin m75l/h76l/q96c/m148l/h158l covalently linked with [rh(cp-mal)(cod)] (nb4-rh) from arabidopsis thaliana 0.8313 5 207
ID Description Score Start End Superfamily
2fwvA00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8642 7 206 2.40.128.20
3ia8B00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8445 5 207 2.40.128.20
3wjeB00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8414 5 207 2.40.128.20
3wjeB00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8362 5 207 2.40.128.20
3ia8B00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8343 5 207 2.40.128.20
ID Description Score Start End GO Terms
AF-A0A847CN79-F1-model_v4 FABP family protein 0.987 129 207
AF-K1E6X6-F1-model_v4 THAP4-like heme-binding beta-barrel domain-containing protein 0.9792 144 207
AF-A0A6J6WLJ6-F1-model_v4 Unannotated protein 0.9791 131 207
AF-A0A2G6DW04-F1-model_v4 THAP4-like heme-binding beta-barrel domain-containing protein 0.9739 131 207
AF-A0A838SNY8-F1-model_v4 FABP family protein 0.9695 150 207

Feature Viewer

pLDDT pTM Quality
94.9 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map