F471681

General Info

Members Datasets Scaffolds Average Seq Length
640 384 1280 157

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10354127|Ga0105242_103541271
Length 167
Sequence VKGNPMSKMTLKTEGDRHVVVTRRFAAAPEAVYRAHTEPALIQKWLLGPDGWTMPVCINEARPGGKIRYEWTNGEGAGFYVTGEYLELVPFSRLVHVERMHMPDATPDNHVETTFAPDGTGTLMTMRMTLPDAATRAAMLSTGMEHGMEASYVRLETTLDASPALNP

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
190 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
191 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
192 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
193 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
194 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
195 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
196 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
197 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
198 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
199 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
200 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
201 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
215 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
216 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
217 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
220 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
221 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
222 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
223 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
224 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
225 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
228 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
229 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
230 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
231 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
232 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
233 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
238 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
239 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
240 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
243 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
244 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
245 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
246 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
247 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
248 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
249 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
250 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
251 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
252 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
253 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
254 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
255 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
256 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
257 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
258 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
259 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
260 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
261 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
262 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
263 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
264 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
265 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
266 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
267 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
268 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
269 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
270 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
271 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
287 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
288 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
289 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
290 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
291 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
292 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
293 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
303 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
304 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
305 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
306 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
307 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
308 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
309 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
310 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
311 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
312 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
313 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
314 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
315 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
316 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
317 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
320 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
321 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
322 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
323 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
324 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
325 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
326 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
327 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
328 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
329 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
330 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
331 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
332 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
333 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
334 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
335 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
336 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
337 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
338 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
339 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
340 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
341 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
342 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
343 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
344 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
345 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
346 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
347 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
348 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
349 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
350 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
351 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
352 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
353 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
354 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
355 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
356 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
357 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
358 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
359 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
360 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
361 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
362 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
363 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
364 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
365 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
366 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
367 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
368 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
369 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
370 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
371 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
372 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
373 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
374 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
375 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
376 2904699407
377 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
378 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
379 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
380 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
381 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
382 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
383 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
384 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.65
Metatranscriptomes 0
Isolates 2.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10
Nodule 1.72
Rhizoplane 5.78
Rhizosphere 77.03
Stem 0
Stem Tuber 0
Unclassified 5.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10354127 3300009176 Bacteria 1357
2 JGI25153J46596_10103732 3300003215 Bacteria 664
3 rootH2_10131256 3300003320 Bacteria 4278
4 Ga0065707_10478674 3300005295 Bacteria 775
5 Ga0070658_10820641 3300005327 Bacteria 808
6 Ga0070676_10120249 3300005328 Unclassified 1647
7 Ga0070676_10179517 3300005328 Bacteria 1375
8 Ga0070683_100458386 3300005329 Bacteria 1217
9 Ga0070690_100968259 3300005330 Bacteria 669
10 Ga0070670_100219044 3300005331 Bacteria 1656
11 Ga0070670_100223968 3300005331 Bacteria 1637
12 Ga0068869_100043009 3300005334 Bacteria 3242
13 Ga0068869_100383409 3300005334 Bacteria 1152
14 Ga0070666_10040847 3300005335 Bacteria 3097
15 Ga0070682_100947291 3300005337 Bacteria 711
16 Ga0068868_100066990 3300005338 Bacteria 2857
17 Ga0068868_100298932 3300005338 Bacteria 1367
18 Ga0070689_100242517 3300005340 Bacteria 1485
19 Ga0070661_100077102 3300005344 Bacteria 2457
20 Ga0070661_100309369 3300005344 Bacteria 1232
21 Ga0070661_101003612 3300005344 Bacteria 692
22 Ga0070668_100003205 3300005347 Bacteria 12054
23 Ga0070668_100129556 3300005347 Bacteria 2024
24 Ga0070668_100153391 3300005347 Bacteria 1865
25 Ga0070668_100231299 3300005347 Bacteria 1528
26 Ga0070668_100235292 3300005347 Bacteria 1516
27 Ga0070668_100341070 3300005347 Bacteria 1266
28 Ga0070669_100123753 3300005353 Bacteria 1977
29 Ga0070669_100201864 3300005353 Bacteria 1565
30 Ga0070675_100021498 3300005354 Bacteria 5157
31 Ga0070675_101155130 3300005354 Bacteria 712
32 Ga0070671_100401515 3300005355 Bacteria 1172
33 Ga0070671_100926664 3300005355 Bacteria 762
34 Ga0070674_100164531 3300005356 Bacteria 1686
35 Ga0070674_100832727 3300005356 Bacteria 799
36 Ga0070673_100070941 3300005364 Bacteria 2797
37 Ga0070673_100201814 3300005364 Bacteria 1713
38 Ga0070688_100177362 3300005365 Bacteria 1475
39 Ga0070667_100045861 3300005367 Bacteria 3677
40 Ga0070667_100236890 3300005367 Bacteria 1629
41 Ga0070709_10059044 3300005434 Bacteria 2435
42 Ga0070714_100185872 3300005435 Bacteria 1893
43 Ga0070714_101060042 3300005435 Unclassified 789
44 Ga0070710_10494226 3300005437 Bacteria 837
45 Ga0070711_100667134 3300005439 Bacteria 873
46 Ga0070711_101880861 3300005439 Bacteria 526
47 Ga0070705_100812922 3300005440 Bacteria 745
48 Ga0070663_100025179 3300005455 Bacteria 4015
49 Ga0070663_100055476 3300005455 Bacteria 2836
50 Ga0070663_100128943 3300005455 Bacteria 1918
51 Ga0070663_100553877 3300005455 Bacteria 961
52 Ga0070663_100700536 3300005455 Bacteria 861
53 Ga0070663_100916357 3300005455 Bacteria 758
54 Ga0070678_100106341 3300005456 Bacteria 2186
55 Ga0070678_101000052 3300005456 Bacteria 769
56 Ga0070678_101502979 3300005456 Bacteria 631
57 Ga0070678_101661585 3300005456 Bacteria 600
58 Ga0070662_100075112 3300005457 Bacteria 2502
59 Ga0070662_100267497 3300005457 Bacteria 1379
60 Ga0068867_100388802 3300005459 Bacteria 1174
61 Ga0070684_100738626 3300005535 Bacteria 918
62 Ga0070697_100263949 3300005536 Bacteria 1475
63 Ga0070697_100980661 3300005536 Unclassified 751
64 Ga0070672_100560677 3300005543 Bacteria 992
65 Ga0070686_100569066 3300005544 Bacteria 889
66 Ga0070696_100538847 3300005546 Bacteria 934
67 Ga0070693_100145843 3300005547 Bacteria 1495
68 Ga0070665_100045949 3300005548 Bacteria 4386
69 Ga0070665_100069384 3300005548 Bacteria 3532
70 Ga0070665_100125383 3300005548 Bacteria 2570
71 Ga0070665_100243181 3300005548 Bacteria 1800
72 Ga0070665_100902943 3300005548 Bacteria 896
73 Ga0070665_101142110 3300005548 Bacteria 790
74 Ga0068855_100045034 3300005563 Bacteria 5219
75 Ga0068855_100074234 3300005563 Bacteria 3950
76 Ga0068855_100080997 3300005563 Bacteria 3764
77 Ga0068855_101027531 3300005563 Bacteria 865
78 Ga0070664_100167960 3300005564 Bacteria 1945
79 Ga0070664_100575719 3300005564 Bacteria 1043
80 Ga0070664_100704700 3300005564 Bacteria 941
81 Ga0070664_101333561 3300005564 Bacteria 678
82 Ga0068857_100096681 3300005577 Bacteria 2647
83 Ga0068857_100297281 3300005577 Bacteria 1488
84 Ga0068856_100027488 3300005614 Bacteria 5550
85 Ga0068856_100059497 3300005614 Bacteria 3774
86 Ga0068856_100108460 3300005614 Unclassified 2773
87 Ga0068856_100149049 3300005614 Bacteria 2348
88 Ga0068856_100961128 3300005614 Bacteria 873
89 Ga0070702_100429917 3300005615 Bacteria 953
90 Ga0068852_100024303 3300005616 Bacteria 4894
91 Ga0068852_100721726 3300005616 Bacteria 1008
92 Ga0068859_100002232 3300005617 Bacteria 19641
93 Ga0068859_100034220 3300005617 Bacteria 5100
94 Ga0068859_100042383 3300005617 Bacteria 4571
95 Ga0068859_100104883 3300005617 Bacteria 2886
96 Ga0068864_100189278 3300005618 Bacteria 1886
97 Ga0068861_101094606 3300005719 Bacteria 765
98 Ga0068861_101541556 3300005719 Bacteria 653
99 Ga0068851_10029363 3300005834 Bacteria 2722
100 Ga0068870_10222327 3300005840 Bacteria 1156
101 Ga0068863_100389972 3300005841 Bacteria 1361
102 Ga0068863_100449574 3300005841 Bacteria 1264
103 Ga0068858_100048071 3300005842 Bacteria 3954
104 Ga0068858_100055625 3300005842 Bacteria 3658
105 Ga0068858_100060955 3300005842 Bacteria 3487
106 Ga0068860_100131312 3300005843 Bacteria 2404
107 Ga0068860_100182973 3300005843 Bacteria 2025
108 Ga0068860_100474155 3300005843 Bacteria 1247
109 Ga0068860_101001406 3300005843 Bacteria 854
110 Ga0068860_101579145 3300005843 Bacteria 678
111 Ga0068860_102252699 3300005843 Bacteria 565
112 Ga0068862_100133943 3300005844 Bacteria 2194
113 Ga0068862_100304744 3300005844 Bacteria 1466
114 Ga0081455_10131953 3300005937 Bacteria 1952
115 Ga0081455_10196205 3300005937 Bacteria 1516
116 Ga0081538_10002756 3300005981 Bacteria 16861
117 Ga0081540_1016473 3300005983 Bacteria 4622
118 Ga0081540_1022487 3300005983 Bacteria 3724
119 Ga0081540_1024532 3300005983 Bacteria 3498
120 Ga0081540_1074261 3300005983 Bacteria 1559
121 Ga0081539_10016840 3300005985 Bacteria 5184
122 Ga0070717_10998732 3300006028 Bacteria 762
123 Ga0075365_10026461 3300006038 Bacteria 3683
124 Ga0075365_10508537 3300006038 Bacteria 851
125 Ga0075368_10213424 3300006042 Bacteria 819
126 Ga0075363_100000348 3300006048 Bacteria 13858
127 Ga0075363_100129707 3300006048 Bacteria 1413
128 Ga0075363_100641436 3300006048 Bacteria 638
129 Ga0075364_10102210 3300006051 Bacteria 1908
130 Ga0075364_10447469 3300006051 Bacteria 882
131 Ga0075432_10329433 3300006058 Bacteria 641
132 Ga0070715_10243898 3300006163 Bacteria 936
133 Ga0070715_10866477 3300006163 Bacteria 553
134 Ga0070716_100525986 3300006173 Bacteria 877
135 Ga0070712_100198569 3300006175 Bacteria 1574
136 Ga0070712_100212399 3300006175 Bacteria 1527
137 Ga0070712_100247164 3300006175 Bacteria 1423
138 Ga0075367_10018728 3300006178 Bacteria 3826
139 Ga0075367_10157922 3300006178 Bacteria 1410
140 Ga0075369_10027270 3300006186 Bacteria 2387
141 Ga0075369_10257772 3300006186 Bacteria 811
142 Ga0075366_10569575 3300006195 Bacteria 701
143 Ga0075366_10607923 3300006195 Bacteria 678
144 Ga0097621_100099330 3300006237 Bacteria 2446
145 Ga0097621_100346776 3300006237 Bacteria 1320
146 Ga0097621_100901057 3300006237 Bacteria 824
147 Ga0075370_10080347 3300006353 Bacteria 1873
148 Ga0068871_100027113 3300006358 Bacteria 4478
149 Ga0068871_100898243 3300006358 Bacteria 821
150 Ga0068871_101320757 3300006358 Bacteria 679
151 Ga0075428_100035426 3300006844 Bacteria 5502
152 Ga0075428_100054605 3300006844 Bacteria 4377
153 Ga0075430_100114373 3300006846 Bacteria 2248
154 Ga0075430_100174790 3300006846 Bacteria 1787
155 Ga0075430_100589302 3300006846 Bacteria 917
156 Ga0075431_100133087 3300006847 Bacteria 2564
157 Ga0075433_11110107 3300006852 Bacteria 688
158 Ga0075434_100026107 3300006871 Bacteria 5721
159 Ga0075434_100047486 3300006871 Bacteria 4261
160 Ga0075434_100126394 3300006871 Bacteria 2574
161 Ga0075434_100383464 3300006871 Bacteria 1426
162 Ga0075429_100026489 3300006880 Bacteria 5035
163 Ga0075429_100063136 3300006880 Bacteria 3227
164 Ga0075429_100854415 3300006880 Bacteria 797
165 Ga0097620_100002232 3300006931 Bacteria 19641
166 Ga0097620_100034220 3300006931 Bacteria 5100
167 Ga0097620_100042383 3300006931 Bacteria 4571
168 Ga0097620_100104890 3300006931 Bacteria 2886
169 Ga0075435_100100272 3300007076 Unclassified 2399
170 Ga0105240_10020299 3300009093 Bacteria 8867
171 Ga0105240_10064926 3300009093 Unclassified 4533
172 Ga0111539_10016248 3300009094 Bacteria 9231
173 Ga0111539_10572976 3300009094 Bacteria 1315
174 Ga0111539_10847841 3300009094 Bacteria 1063
175 Ga0105245_10117208 3300009098 Bacteria 2484
176 Ga0105245_10984044 3300009098 Bacteria 887
177 Ga0105247_10558510 3300009101 Unclassified 843
178 Ga0105247_10583593 3300009101 Bacteria 826
179 Ga0114129_10038800 3300009147 Bacteria 6714
180 Ga0114129_10227790 3300009147 Bacteria 2511
181 Ga0105243_10261894 3300009148 Bacteria 1548
182 Ga0105243_10290859 3300009148 Bacteria 1476
183 Ga0105243_10477819 3300009148 Bacteria 1175
184 Ga0105243_11997793 3300009148 Bacteria 614
185 Ga0105241_10048687 3300009174 Bacteria 3226
186 Ga0105241_10066778 3300009174 Bacteria 2782
187 Ga0105241_10250847 3300009174 Bacteria 1500
188 Ga0105242_10462388 3300009176 Bacteria 1198
189 Ga0105242_10888098 3300009176 Unclassified 890
190 Ga0105242_11868367 3300009176 Bacteria 640
191 Ga0105248_10064707 3300009177 Bacteria 4105
192 Ga0105248_10351267 3300009177 Bacteria 1660
193 Ga0105237_10053102 3300009545 Bacteria 4065
194 Ga0105237_10098416 3300009545 Bacteria 2916
195 Ga0105238_10001687 3300009551 Bacteria 22217
196 Ga0105238_10031599 3300009551 Bacteria 5390
197 Ga0105238_10180308 3300009551 Bacteria 2089
198 Ga0105238_11125939 3300009551 Bacteria 808
199 Ga0105238_11278146 3300009551 Unclassified 759
200 Ga0105249_10200540 3300009553 Bacteria 1952
201 Ga0105249_11203604 3300009553 Unclassified 829
202 Ga0105239_10071568 3300010375 Bacteria 3810
203 Ga0105239_10307671 3300010375 Bacteria 1786
204 Ga0105246_10009102 3300011119 Bacteria 6116
205 Ga0105246_10025043 3300011119 Bacteria 3887
206 Ga0105246_10085201 3300011119 Bacteria 2263
207 Ga0105246_10999232 3300011119 Bacteria 757
208 Ga0157373_10140431 3300013100 Bacteria 1699
209 Ga0157373_10780217 3300013100 Bacteria 704
210 Ga0157370_10282507 3300013104 Bacteria 1533
211 Ga0157369_10183922 3300013105 Bacteria 2198
212 Ga0157369_10613642 3300013105 Bacteria 1122
213 Ga0157374_10125621 3300013296 Bacteria 2480
214 Ga0157374_10297300 3300013296 Unclassified 1597
215 Ga0157378_10028582 3300013297 Bacteria 4921
216 Ga0157378_10054806 3300013297 Bacteria 3551
217 Ga0157378_10430284 3300013297 Bacteria 1306
218 Ga0163162_10295922 3300013306 Bacteria 1750
219 Ga0163162_10874063 3300013306 Bacteria 1013
220 Ga0157372_10120488 3300013307 Bacteria 3013
221 Ga0157372_10132901 3300013307 Bacteria 2864
222 Ga0157375_10168131 3300013308 Bacteria 2339
223 Ga0157375_10367291 3300013308 Bacteria 1605
224 Ga0163163_10167063 3300014325 Bacteria 2247
225 Ga0163163_10289310 3300014325 Bacteria 1691
226 Ga0163163_10645137 3300014325 Bacteria 1122
227 Ga0157380_10450263 3300014326 Bacteria 1236
228 Ga0157377_10233861 3300014745 Bacteria 1183
229 Ga0157379_10563929 3300014968 Bacteria 1060
230 Ga0157376_10092022 3300014969 Bacteria 2628
231 Ga0157376_10184534 3300014969 Bacteria 1909
232 Ga0163161_10008364 3300017792 Bacteria 7162
233 Ga0163161_10111362 3300017792 Bacteria 2047
234 Ga0213873_10013981 3300021358 Unclassified 1771
235 Ga0213876_10024389 3300021384 Unclassified 3193
236 Ga0213876_10183224 3300021384 Unclassified 1114
237 Ga0209758_1020460 3300025297 Bacteria 3130
238 Ga0209758_1128683 3300025297 Bacteria 673
239 Ga0209257_1024758 3300025304 Bacteria 2069
240 Ga0207697_10252584 3300025315 Bacteria 780
241 Ga0207653_10037773 3300025885 Bacteria 1576
242 Ga0207692_10041170 3300025898 Bacteria 2285
243 Ga0207688_10039902 3300025901 Bacteria 2608
244 Ga0207688_10176476 3300025901 Bacteria 1273
245 Ga0207680_10050687 3300025903 Bacteria 2478
246 Ga0207647_10303775 3300025904 Bacteria 908
247 Ga0207645_10032171 3300025907 Bacteria 3372
248 Ga0207645_10048076 3300025907 Bacteria 2723
249 Ga0207645_10086901 3300025907 Bacteria 2009
250 Ga0207705_10484024 3300025909 Bacteria 960
251 Ga0207654_10026696 3300025911 Bacteria 3130
252 Ga0207654_10439446 3300025911 Bacteria 913
253 Ga0207695_10151953 3300025913 Unclassified 2254
254 Ga0207695_10176365 3300025913 Unclassified 2060
255 Ga0207671_10048745 3300025914 Bacteria 3135
256 Ga0207693_10028329 3300025915 Bacteria 4426
257 Ga0207693_10114516 3300025915 Bacteria 2116
258 Ga0207660_10714257 3300025917 Bacteria 818
259 Ga0207662_10270543 3300025918 Bacteria 1121
260 Ga0207649_10120814 3300025920 Bacteria 1766
261 Ga0207681_10323971 3300025923 Bacteria 1226
262 Ga0207681_10590179 3300025923 Bacteria 917
263 Ga0207681_10767567 3300025923 Bacteria 804
264 Ga0207681_11187632 3300025923 Bacteria 641
265 Ga0207694_10025006 3300025924 Bacteria 4538
266 Ga0207650_10608529 3300025925 Bacteria 919
267 Ga0207659_10308327 3300025926 Bacteria 1302
268 Ga0207659_10325195 3300025926 Bacteria 1270
269 Ga0207687_10287708 3300025927 Bacteria 1320
270 Ga0207700_10175531 3300025928 Bacteria 1791
271 Ga0207664_10388171 3300025929 Bacteria 1240
272 Ga0207644_10164738 3300025931 Bacteria 1726
273 Ga0207644_10187415 3300025931 Unclassified 1625
274 Ga0207706_10016613 3300025933 Bacteria 6642
275 Ga0207706_10073436 3300025933 Bacteria 3008
276 Ga0207706_10385478 3300025933 Unclassified 1216
277 Ga0207706_10531622 3300025933 Bacteria 1013
278 Ga0207686_10204582 3300025934 Bacteria 1416
279 Ga0207709_10282052 3300025935 Bacteria 1227
280 Ga0207670_10120807 3300025936 Bacteria 1904
281 Ga0207670_10684518 3300025936 Bacteria 848
282 Ga0207669_10239161 3300025937 Bacteria 1345
283 Ga0207704_10520717 3300025938 Bacteria 962
284 Ga0207665_10570184 3300025939 Bacteria 881
285 Ga0207691_10064717 3300025940 Bacteria 3311
286 Ga0207691_10442533 3300025940 Bacteria 1106
287 Ga0207711_10032504 3300025941 Bacteria 4411
288 Ga0207711_10256008 3300025941 Bacteria 1608
289 Ga0207689_10015162 3300025942 Bacteria 6529
290 Ga0207661_10090831 3300025944 Bacteria 2544
291 Ga0207679_10104180 3300025945 Bacteria 2225
292 Ga0207679_10966069 3300025945 Bacteria 780
293 Ga0207679_10968410 3300025945 Bacteria 779
294 Ga0207667_10018382 3300025949 Bacteria 7841
295 Ga0207667_10124669 3300025949 Bacteria 2653
296 Ga0207667_10706686 3300025949 Bacteria 1010
297 Ga0207651_10218231 3300025960 Bacteria 1540
298 Ga0207651_10793892 3300025960 Bacteria 839
299 Ga0207712_10307632 3300025961 Bacteria 1303
300 Ga0207668_10005753 3300025972 Bacteria 7307
301 Ga0207668_10027223 3300025972 Bacteria 3723
302 Ga0207668_10108088 3300025972 Bacteria 2081
303 Ga0207668_10163779 3300025972 Bacteria 1736
304 Ga0207668_10198273 3300025972 Bacteria 1596
305 Ga0207640_10202002 3300025981 Bacteria 1507
306 Ga0207658_10070252 3300025986 Bacteria 2649
307 Ga0207677_10050297 3300026023 Bacteria 2818
308 Ga0207677_10135787 3300026023 Bacteria 1875
309 Ga0207677_10540963 3300026023 Bacteria 1013
310 Ga0207703_10013480 3300026035 Bacteria 6368
311 Ga0207703_10097973 3300026035 Bacteria 2479
312 Ga0207703_10717959 3300026035 Bacteria 951
313 Ga0207639_10527932 3300026041 Bacteria 1081
314 Ga0207639_10658683 3300026041 Bacteria 969
315 Ga0207639_11199105 3300026041 Unclassified 712
316 Ga0207678_10033371 3300026067 Bacteria 4485
317 Ga0207678_10037005 3300026067 Bacteria 4248
318 Ga0207678_10046619 3300026067 Bacteria 3747
319 Ga0207678_10110030 3300026067 Bacteria 2350
320 Ga0207678_10127706 3300026067 Bacteria 2169
321 Ga0207678_10676720 3300026067 Bacteria 907
322 Ga0207678_10827388 3300026067 Bacteria 818
323 Ga0207702_10049194 3300026078 Bacteria 3557
324 Ga0207702_10049598 3300026078 Bacteria 3543
325 Ga0207702_10083161 3300026078 Bacteria 2785
326 Ga0207702_10760909 3300026078 Bacteria 956
327 Ga0207641_10031325 3300026088 Bacteria 4411
328 Ga0207641_10580233 3300026088 Unclassified 1096
329 Ga0207648_10194189 3300026089 Bacteria 1800
330 Ga0207676_10021791 3300026095 Bacteria 4705
331 Ga0207676_10101799 3300026095 Bacteria 2383
332 Ga0207674_10122940 3300026116 Bacteria 2561
333 Ga0207674_10762084 3300026116 Bacteria 934
334 Ga0207675_100150935 3300026118 Bacteria 2211
335 Ga0207675_100236435 3300026118 Bacteria 1764
336 Ga0207683_10018238 3300026121 Bacteria 5987
337 Ga0207683_10053045 3300026121 Bacteria 3554
338 Ga0207683_10297800 3300026121 Bacteria 1476
339 Ga0209813_10313002 3300027866 Bacteria 613
340 Ga0268266_10003225 3300028379 Bacteria 16480
341 Ga0268266_10004165 3300028379 Bacteria 13945
342 Ga0268266_10209221 3300028379 Bacteria 1788
343 Ga0268266_10844001 3300028379 Bacteria 885
344 Ga0268266_11304236 3300028379 Bacteria 701
345 Ga0268265_10075399 3300028380 Bacteria 2641
346 Ga0268265_10167612 3300028380 Bacteria 1873
347 Ga0268265_11479083 3300028380 Bacteria 682
348 Ga0268264_10744632 3300028381 Bacteria 976
349 Ga0307517_10157822 3300028786 Bacteria 1533
350 Ga0307515_10016062 3300028794 Bacteria 13741
351 Ga0307515_10206548 3300028794 Bacteria 1822
352 Ga0307512_10377260 3300030522 Bacteria 609
353 Ga0307513_10257965 3300031456 Bacteria 1535
354 Ga0307509_10077451 3300031507 Bacteria 3448
355 Ga0307405_10587804 3300031731 Bacteria 907
356 Ga0307413_10924191 3300031824 Bacteria 743
357 Ga0307412_10235555 3300031911 Bacteria 1412
358 Ga0307409_101553517 3300031995 Bacteria 690
359 Ga0307411_10246631 3300032005 Bacteria 1402
360 Ga0307415_100199594 3300032126 Bacteria 1586
361 Ga0307415_100312324 3300032126 Bacteria 1307
362 Ga0307510_10025403 3300033180 Bacteria 6831
363 Ga0373957_0331740 3300035120 Unclassified 648
364 Ga0373931_0552910 3300035691 Bacteria 748
365 Ga0373931_0578316 3300035691 Bacteria 732
366 Ga0373937_0146485 3300036401 Bacteria 2211
367 Ga0395900_0584961 3300037418 Bacteria 1058
368 Ga0395898_0249607 3300037466 Bacteria 1693
369 Ga0395905_0021733 3300037471 Bacteria 6070
370 Ga0436364_0425587 3300037853 Unclassified 1012
371 Ga0436365_0254148 3300039437 Bacteria 6731
372 Ga0436365_1641286 3300039437 Unclassified 2373
373 Ga0436360_0833609 3300039438 Bacteria 590
374 Ga0436363_0179669 3300039450 Bacteria 676
375 Ga0436362_0656487 3300039453 Bacteria 5198
376 Ga0451789_0732108 3300041443 Bacteria 1825
377 Ga0451791_0480612 3300041451 Bacteria 1504
378 Ga0451797_0445312 3300041453 Bacteria 856
379 Ga0451798_0707696 3300041458 Bacteria 957
380 Ga0451800_1554497 3300041459 Bacteria 794
381 Ga0451807_0311811 3300041486 Bacteria 1016
382 Ga0451841_1169861 3300041498 Bacteria 584
383 Ga0451845_0357776 3300041501 Bacteria 1058
384 Ga0451849_0866963 3300041505 Bacteria 958
385 Ga0451849_1277062 3300041505 Bacteria 770
386 Ga0439435_0011715 3300042436 Bacteria 2109
387 Ga0466966_0114188 3300044684 Bacteria 1663
388 Ga0466961_0133690 3300044693 Bacteria 1554
389 Ga0466961_0660614 3300044693 Unclassified 627
390 Ga0453684_0646170 3300044712 Unclassified 1155
391 Ga0466968_0269900 3300044735 Bacteria 812
392 Ga0466970_0104125 3300044765 Bacteria 1547
393 Ga0466959_0180450 3300045049 Bacteria 1477
394 Ga0451576_0755638 3300045051 Bacteria 1021
395 Ga0466967_0101266 3300045976 Bacteria 2633
396 Ga0466967_0727738 3300045976 Unclassified 983
397 Ga0495617_019033 3300046452 Bacteria 2322
398 Ga0495617_029047 3300046452 Bacteria 1860
399 Ga0495617_086342 3300046452 Bacteria 1026
400 Ga0495603_0008614 3300046455 Bacteria 6165
401 Ga0495603_0046438 3300046455 Bacteria 2588
402 Ga0495603_0206269 3300046455 Bacteria 1135
403 Ga0495591_028960 3300046458 Bacteria 1688
404 Ga0495629_0040306 3300046459 Bacteria 3285
405 Ga0495629_0308280 3300046459 Bacteria 1083
406 Ga0495638_0419611 3300046460 Bacteria 690
407 Ga0495650_0019173 3300046471 Bacteria 3378
408 Ga0495650_0156533 3300046471 Bacteria 815
409 Ga0495639_0221147 3300046475 Bacteria 931
410 Ga0495639_0328871 3300046475 Bacteria 765
411 Ga0495585_0025119 3300046492 Bacteria 3415
412 Ga0495594_0223382 3300046499 Bacteria 1074
413 Ga0495596_0054912 3300046500 Unclassified 1557
414 Ga0495607_0266072 3300046501 Bacteria 819
415 Ga0495583_0382395 3300046506 Bacteria 554
416 Ga0495606_0096080 3300046507 Bacteria 1813
417 Ga0495610_0173756 3300046512 Bacteria 901
418 Ga0495616_0248946 3300046513 Unclassified 764
419 Ga0495620_0076088 3300046515 Bacteria 1365
420 Ga0495620_0097011 3300046515 Bacteria 1178
421 Ga0495628_0523417 3300046516 Bacteria 854
422 Ga0495632_0122055 3300046519 Bacteria 1217
423 Ga0495632_0132265 3300046519 Bacteria 1160
424 Ga0495632_0310837 3300046519 Bacteria 697
425 Ga0495637_0116634 3300046520 Bacteria 1031
426 Ga0495643_0250442 3300046522 Bacteria 827
427 Ga0495644_0020125 3300046523 Bacteria 2546
428 Ga0495644_0036883 3300046523 Bacteria 1844
429 Ga0495644_0108545 3300046523 Bacteria 1052
430 Ga0495648_0123574 3300046524 Bacteria 1387
431 Ga0495663_0064487 3300046525 Bacteria 1156
432 Ga0495642_0084769 3300046528 Unclassified 1337
433 Ga0495642_0165862 3300046528 Bacteria 959
434 Ga0495652_0335491 3300046529 Bacteria 1088
435 Ga0495654_0044928 3300046530 Bacteria 2181
436 Ga0495587_0226411 3300046536 Bacteria 1054
437 Ga0495598_0024974 3300046537 Unclassified 1625
438 Ga0495609_0061529 3300046538 Bacteria 1658
439 Ga0495621_0000243 3300046539 Bacteria 12963
440 Ga0495597_0135077 3300046542 Bacteria 1021
441 Ga0495645_0164107 3300046543 Bacteria 1533
442 Ga0495622_0009891 3300046557 Bacteria 4412
443 Ga0495633_0051611 3300046558 Bacteria 1937
444 Ga0495633_0060301 3300046558 Bacteria 1778
445 Ga0495656_0021836 3300046615 Bacteria 2497
446 Ga0495656_0044344 3300046615 Unclassified 1872
447 Ga0495668_0170492 3300046616 Bacteria 1192
448 Ga0495668_0204190 3300046616 Bacteria 1082
449 Ga0495625_0090236 3300046660 Bacteria 2120
450 Ga0495625_0597058 3300046660 Bacteria 663
451 Ga0495635_0247064 3300046663 Bacteria 1203
452 Ga0495635_0452009 3300046663 Bacteria 849
453 Ga0495659_0006030 3300046664 Bacteria 3830
454 Ga0495659_0136668 3300046664 Bacteria 976
455 Ga0495588_0390386 3300046674 Bacteria 731
456 Ga0495658_0012007 3300046683 Unclassified 4374
457 Ga0495613_0657817 3300046689 Bacteria 693
458 Ga0495670_0281638 3300046691 Bacteria 889
459 Ga0495671_0330117 3300046692 Unclassified 732
460 Ga0495649_0193967 3300046694 Bacteria 1057
461 Ga0495589_0042871 3300046794 Bacteria 2254
462 Ga0495589_0141727 3300046794 Unclassified 1151
463 Ga0495600_0744484 3300046809 Bacteria 587
464 Ga0495660_0302567 3300046810 Bacteria 724
465 Ga0495581_0215959 3300047315 Bacteria 1121
466 Ga0495604_0581258 3300047317 Bacteria 720
467 Ga0495636_0154484 3300047318 Bacteria 1031
468 Ga0495672_0346532 3300047320 Bacteria 691
469 Ga0495676_0706351 3300047321 Bacteria 652
470 Ga0495680_0268646 3300047322 Bacteria 1205
471 Ga0495683_0405361 3300047323 Bacteria 566
472 Ga0495679_109162 3300047446 Bacteria 763
473 Ga0495685_061162 3300047447 Bacteria 1269
474 Ga0495681_0050691 3300047470 Bacteria 1955
475 Ga0495681_0123615 3300047470 Bacteria 1108
476 Ga0495686_0179632 3300047472 Bacteria 1227
477 Ga0495593_0429872 3300047673 Unclassified 661
478 Ga0495615_0074739 3300048090 Bacteria 919
479 Ga0496100_0199700 3300048903 Bacteria 1457
480 Ga0496100_1011344 3300048903 Bacteria 654
481 Ga0496101_0273636 3300048904 Bacteria 1319
482 Ga0496101_0553083 3300048904 Bacteria 910
483 Ga0496102_0462729 3300048905 Bacteria 1189
484 Ga0496104_0000094 3300048907 Bacteria 86872
485 Ga0496104_0034325 3300048907 Bacteria 4730
486 Ga0496105_0003265 3300048908 Bacteria 11952
487 Ga0496106_0046352 3300048909 Bacteria 3268
488 Ga0496106_0454664 3300048909 Bacteria 1029
489 Ga0496107_0101903 3300048910 Bacteria 2105
490 Ga0496108_0002336 3300048911 Bacteria 15191
491 Ga0496108_0259887 3300048911 Bacteria 1511
492 Ga0496109_0005457 3300048912 Bacteria 10635
493 Ga0496109_0065946 3300048912 Bacteria 3314
494 Ga0496110_0002789 3300048913 Bacteria 13186
495 Ga0496110_0188472 3300048913 Bacteria 1873
496 Ga0496110_0201841 3300048913 Bacteria 1807
497 Ga0496110_1751601 3300048913 Bacteria 531
498 Ga0496111_0003109 3300048914 Bacteria 10211
499 Ga0496112_0017874 3300048915 Bacteria 6673
500 Ga0496112_1342249 3300048915 Bacteria 630
501 Ga0496113_0003316 3300048916 Bacteria 9612
502 Ga0496113_0134133 3300048916 Bacteria 1945
503 Ga0496113_0206880 3300048916 Bacteria 1561
504 Ga0496113_0239330 3300048916 Bacteria 1448
505 Ga0496114_0671748 3300048917 Bacteria 910
506 Ga0496115_0070535 3300048918 Bacteria 2833
507 Ga0496115_0253788 3300048918 Bacteria 1447
508 Ga0496115_0271677 3300048918 Bacteria 1393
509 Ga0496115_0480347 3300048918 Bacteria 1001
510 Ga0496118_0225674 3300048921 Bacteria 1086
511 Ga0496119_0328463 3300048922 Bacteria 747
512 Ga0496120_0385015 3300048923 Bacteria 623
513 Ga0496121_0028497 3300048924 Bacteria 5195
514 Ga0496121_0145545 3300048924 Bacteria 1751
515 Ga0496121_0181691 3300048924 Bacteria 1517
516 Ga0496121_0216038 3300048924 Bacteria 1354
517 Ga0496121_0357296 3300048924 Bacteria 971
518 Ga0496124_0503647 3300048927 Bacteria 811
519 Ga0496125_0100491 3300048928 Bacteria 2132
520 Ga0496126_0139353 3300048929 Bacteria 2089
521 Ga0496126_0204243 3300048929 Bacteria 1666
522 Ga0495678_105230 3300049459 Bacteria 972
523 Ga0501034_0366576 3300049571 Bacteria 1367
524 Ga0501034_0523552 3300049571 Bacteria 1097
525 Ga0501036_0821603 3300049572 Bacteria 765
526 Ga0501037_0247077 3300049573 Bacteria 1249
527 Ga0501037_0740096 3300049573 Bacteria 652
528 Ga0501038_0553000 3300049574 Bacteria 875
529 Ga0501038_0779102 3300049574 Bacteria 712
530 Ga0501039_0305359 3300049575 Bacteria 1251
531 Ga0501039_1075978 3300049575 Bacteria 624
532 Ga0501046_0199285 3300049580 Bacteria 1490
533 Ga0501046_0398849 3300049580 Bacteria 994
534 Ga0501047_0011596 3300049581 Bacteria 8341
535 Ga0501047_0164605 3300049581 Bacteria 2089
536 Ga0501048_0401876 3300049582 Bacteria 979
537 Ga0501068_0277348 3300049584 Bacteria 1071
538 Ga0501070_0004195 3300049586 Bacteria 12401
539 Ga0501072_0189208 3300049588 Bacteria 1642
540 Ga0501072_0259819 3300049588 Bacteria 1382
541 Ga0501073_0302860 3300049589 Bacteria 1103
542 Ga0501074_0494751 3300049590 Bacteria 866
543 Ga0501075_0224846 3300049591 Bacteria 1431
544 Ga0501075_0715687 3300049591 Bacteria 762
545 Ga0501076_0612508 3300049592 Bacteria 898
546 Ga0501077_0241439 3300049593 Bacteria 1148
547 Ga0501217_073296 3300049661 Bacteria 936
548 Ga0501227_223490 3300049665 Bacteria 536
549 Ga0501221_117816 3300049704 Bacteria 676
550 Ga0501079_0531576 3300049741 Bacteria 924
551 Ga0501080_0205066 3300049742 Bacteria 1809
552 Ga0501080_0341901 3300049742 Bacteria 1352
553 Ga0501081_0131789 3300049743 Bacteria 1786
554 Ga0501083_0049566 3300049744 Bacteria 2830
555 Ga0501035_0115612 3300049822 Bacteria 2348
556 Ga0501035_0164517 3300049822 Bacteria 1919
557 Ga0501044_0000712 3300049823 Bacteria 40091
558 Ga0501044_0003178 3300049823 Bacteria 18555
559 Ga0501044_0559346 3300049823 Bacteria 1040
560 Ga0501045_0149613 3300049824 Bacteria 1737
561 Ga0501045_0238764 3300049824 Bacteria 1353
562 nmdc:mga03683_255094_c1 3300050489 Bacteria 815
563 nmdc:mga03n38_2635_c1 3300050490 Bacteria 5600
564 nmdc:mga00v17_13449_c2 3300050491 Bacteria 3826
565 nmdc:mga0yw44_142680_c1 3300050492 Bacteria 1557
566 nmdc:mga0k408_126523_c1 3300050493 Bacteria 1516
567 nmdc:mga06z11_72601_c1 3300050494 Bacteria 1825
568 nmdc:mga04h51_346976_c1 3300050495 Bacteria 613
569 nmdc:mga07m45_190180_c1 3300050496 Bacteria 1194
570 nmdc:mga07m45_224964_c1 3300050496 Bacteria 1092
571 nmdc:mga05p37_81767_c1 3300050507 Bacteria 3979
572 nmdc:mga09592_168384_c1 3300050508 Bacteria 1894
573 nmdc:mga09592_374826_c1 3300050508 Bacteria 1231
574 nmdc:mga0qj67_109490_c1 3300050509 Bacteria 2229
575 nmdc:mga0qj67_966032_c1 3300050509 Bacteria 669
576 nmdc:mga08y16_119203_c1 3300050511 Bacteria 2747
577 nmdc:mga08y16_708008_c1 3300050511 Bacteria 1006
578 nmdc:mga0n895_1306709_c1 3300050512 Unclassified 696
579 nmdc:mga0n895_167453_c1 3300050512 Bacteria 2229
580 nmdc:mga0n895_641239_c1 3300050512 Bacteria 1062
581 nmdc:mga0rr50_185092_c1 3300050513 Unclassified 1704
582 nmdc:mga0rr50_600000_c1 3300050513 Unclassified 939
583 Ga0495601_0056229 3300053077 Bacteria 2492
584 Ga0495601_0060263 3300053077 Bacteria 2408
585 Ga0500643_033277 3300053087 Bacteria 1560
586 Ga0500581_317341 3300053089 Bacteria 610
587 Ga0500646_0079070 3300053090 Bacteria 1000
588 Ga0500583_0061649 3300053092 Bacteria 1771
589 Ga0500651_0214082 3300053093 Bacteria 1132
590 Ga0500566_0044158 3300053094 Bacteria 2567
591 Ga0500641_0008286 3300053096 Bacteria 3708
592 Ga0500650_0083377 3300053098 Bacteria 1495
593 Ga0500654_202084 3300053099 Bacteria 597
594 Ga0500554_000680 3300053102 Bacteria 6889
595 Ga0500555_093405 3300053103 Bacteria 771
596 Ga0500556_0300420 3300053104 Bacteria 628
597 Ga0500562_061011 3300053108 Bacteria 1013
598 Ga0500594_0119188 3300053118 Bacteria 827
599 Ga0500595_000521 3300053119 Bacteria 23203
600 Ga0500595_008311 3300053119 Bacteria 4247
601 Ga0500642_0152025 3300053130 Bacteria 1086
602 Ga0500658_0073890 3300053134 Bacteria 1444
603 Ga0500559_0065087 3300053136 Bacteria 1632
604 Ga0500564_223999 3300053138 Bacteria 759
605 Ga0500577_0043358 3300053142 Bacteria 1652
606 Ga0500589_088461 3300053147 Bacteria 1369
607 Ga0500603_261257 3300053150 Bacteria 558
608 Ga0500627_0126883 3300053158 Bacteria 1152
609 Ga0500633_0161744 3300053160 Bacteria 840
610 Ga0500634_0171068 3300053161 Bacteria 989
611 Ga0500634_0240184 3300053161 Bacteria 761
612 Ga0500638_121548 3300053162 Bacteria 1194
613 Ga0500636_0046694 3300053177 Bacteria 2553
614 Ga0500637_0000029 3300053178 Bacteria 52437
615 Ga0500637_0508215 3300053178 Bacteria 595
616 Ga0500609_019811 3300053731 Bacteria 917
617 Ga0500587_033678 3300053739 Bacteria 712
618 Ga0500587_047397 3300053739 Bacteria 630
619 Ga0501084_0157125 3300054114 Bacteria 1918
620 Ga0501084_0187562 3300054114 Bacteria 1745
621 Ga0500661_000060 3300055283 Bacteria 17314
622 Ga0501082_0193718 3300060353 Bacteria 1768
623 Ga0501082_0351435 3300060353 Bacteria 1285
624 Ga0530510_0331678 3300061734 Bacteria 1141
625 2513694087 2513237101 Bacteria 7952346
626 2524535189 2524023228 Bacteria 10118060
627 2723849384 2721755755 Bacteria 8322773
628 2874608384 2874604998 Bacteria 7834745
629 2876815906 2876808645 Bacteria 8824342
630 2879112848 2879110137 Bacteria 8907982
631 2889035826 2889033259 Bacteria 9099371
632 2904708031
633 2922364307 2922361189 Bacteria 7436256
634 2922389006 2922386360 Bacteria 7017218
635 8006936653 8006933436 Bacteria 10410654
636 8006970255 8006964411 Bacteria 8966052
637 8006976623 8006973647 Bacteria 10679141
638 8006992407 8006984368 Bacteria 9651211
639 8007000008 8006994254 Bacteria 8309700
640 8056678641 8056673599 Bacteria 7871253
641 Ga0105242_10354127
642 JGI25153J46596_10103732
643 rootH2_10131256
644 Ga0065707_10478674
645 Ga0070658_10820641
646 Ga0070676_10120249
647 Ga0070676_10179517
648 Ga0070683_100458386
649 Ga0070690_100968259
650 Ga0070670_100219044
651 Ga0070670_100223968
652 Ga0068869_100043009
653 Ga0068869_100383409
654 Ga0070666_10040847
655 Ga0070682_100947291
656 Ga0068868_100066990
657 Ga0068868_100298932
658 Ga0070689_100242517
659 Ga0070661_100077102
660 Ga0070661_100309369
661 Ga0070661_101003612
662 Ga0070668_100003205
663 Ga0070668_100129556
664 Ga0070668_100153391
665 Ga0070668_100231299
666 Ga0070668_100235292
667 Ga0070668_100341070
668 Ga0070669_100123753
669 Ga0070669_100201864
670 Ga0070675_100021498
671 Ga0070675_101155130
672 Ga0070671_100401515
673 Ga0070671_100926664
674 Ga0070674_100164531
675 Ga0070674_100832727
676 Ga0070673_100070941
677 Ga0070673_100201814
678 Ga0070688_100177362
679 Ga0070667_100045861
680 Ga0070667_100236890
681 Ga0070709_10059044
682 Ga0070714_100185872
683 Ga0070714_101060042
684 Ga0070710_10494226
685 Ga0070711_100667134
686 Ga0070711_101880861
687 Ga0070705_100812922
688 Ga0070663_100025179
689 Ga0070663_100055476
690 Ga0070663_100128943
691 Ga0070663_100553877
692 Ga0070663_100700536
693 Ga0070663_100916357
694 Ga0070678_100106341
695 Ga0070678_101000052
696 Ga0070678_101502979
697 Ga0070678_101661585
698 Ga0070662_100075112
699 Ga0070662_100267497
700 Ga0068867_100388802
701 Ga0070684_100738626
702 Ga0070697_100263949
703 Ga0070697_100980661
704 Ga0070672_100560677
705 Ga0070686_100569066
706 Ga0070696_100538847
707 Ga0070693_100145843
708 Ga0070665_100045949
709 Ga0070665_100069384
710 Ga0070665_100125383
711 Ga0070665_100243181
712 Ga0070665_100902943
713 Ga0070665_101142110
714 Ga0068855_100045034
715 Ga0068855_100074234
716 Ga0068855_100080997
717 Ga0068855_101027531
718 Ga0070664_100167960
719 Ga0070664_100575719
720 Ga0070664_100704700
721 Ga0070664_101333561
722 Ga0068857_100096681
723 Ga0068857_100297281
724 Ga0068856_100027488
725 Ga0068856_100059497
726 Ga0068856_100108460
727 Ga0068856_100149049
728 Ga0068856_100961128
729 Ga0070702_100429917
730 Ga0068852_100024303
731 Ga0068852_100721726
732 Ga0068859_100002232
733 Ga0068859_100034220
734 Ga0068859_100042383
735 Ga0068859_100104883
736 Ga0068864_100189278
737 Ga0068861_101094606
738 Ga0068861_101541556
739 Ga0068851_10029363
740 Ga0068870_10222327
741 Ga0068863_100389972
742 Ga0068863_100449574
743 Ga0068858_100048071
744 Ga0068858_100055625
745 Ga0068858_100060955
746 Ga0068860_100131312
747 Ga0068860_100182973
748 Ga0068860_100474155
749 Ga0068860_101001406
750 Ga0068860_101579145
751 Ga0068860_102252699
752 Ga0068862_100133943
753 Ga0068862_100304744
754 Ga0081455_10131953
755 Ga0081455_10196205
756 Ga0081538_10002756
757 Ga0081540_1016473
758 Ga0081540_1022487
759 Ga0081540_1024532
760 Ga0081540_1074261
761 Ga0081539_10016840
762 Ga0070717_10998732
763 Ga0075365_10026461
764 Ga0075365_10508537
765 Ga0075368_10213424
766 Ga0075363_100000348
767 Ga0075363_100129707
768 Ga0075363_100641436
769 Ga0075364_10102210
770 Ga0075364_10447469
771 Ga0075432_10329433
772 Ga0070715_10243898
773 Ga0070715_10866477
774 Ga0070716_100525986
775 Ga0070712_100198569
776 Ga0070712_100212399
777 Ga0070712_100247164
778 Ga0075367_10018728
779 Ga0075367_10157922
780 Ga0075369_10027270
781 Ga0075369_10257772
782 Ga0075366_10569575
783 Ga0075366_10607923
784 Ga0097621_100099330
785 Ga0097621_100346776
786 Ga0097621_100901057
787 Ga0075370_10080347
788 Ga0068871_100027113
789 Ga0068871_100898243
790 Ga0068871_101320757
791 Ga0075428_100035426
792 Ga0075428_100054605
793 Ga0075430_100114373
794 Ga0075430_100174790
795 Ga0075430_100589302
796 Ga0075431_100133087
797 Ga0075433_11110107
798 Ga0075434_100026107
799 Ga0075434_100047486
800 Ga0075434_100126394
801 Ga0075434_100383464
802 Ga0075429_100026489
803 Ga0075429_100063136
804 Ga0075429_100854415
805 Ga0097620_100002232
806 Ga0097620_100034220
807 Ga0097620_100042383
808 Ga0097620_100104890
809 Ga0075435_100100272
810 Ga0105240_10020299
811 Ga0105240_10064926
812 Ga0111539_10016248
813 Ga0111539_10572976
814 Ga0111539_10847841
815 Ga0105245_10117208
816 Ga0105245_10984044
817 Ga0105247_10558510
818 Ga0105247_10583593
819 Ga0114129_10038800
820 Ga0114129_10227790
821 Ga0105243_10261894
822 Ga0105243_10290859
823 Ga0105243_10477819
824 Ga0105243_11997793
825 Ga0105241_10048687
826 Ga0105241_10066778
827 Ga0105241_10250847
828 Ga0105242_10462388
829 Ga0105242_10888098
830 Ga0105242_11868367
831 Ga0105248_10064707
832 Ga0105248_10351267
833 Ga0105237_10053102
834 Ga0105237_10098416
835 Ga0105238_10001687
836 Ga0105238_10031599
837 Ga0105238_10180308
838 Ga0105238_11125939
839 Ga0105238_11278146
840 Ga0105249_10200540
841 Ga0105249_11203604
842 Ga0105239_10071568
843 Ga0105239_10307671
844 Ga0105246_10009102
845 Ga0105246_10025043
846 Ga0105246_10085201
847 Ga0105246_10999232
848 Ga0157373_10140431
849 Ga0157373_10780217
850 Ga0157370_10282507
851 Ga0157369_10183922
852 Ga0157369_10613642
853 Ga0157374_10125621
854 Ga0157374_10297300
855 Ga0157378_10028582
856 Ga0157378_10054806
857 Ga0157378_10430284
858 Ga0163162_10295922
859 Ga0163162_10874063
860 Ga0157372_10120488
861 Ga0157372_10132901
862 Ga0157375_10168131
863 Ga0157375_10367291
864 Ga0163163_10167063
865 Ga0163163_10289310
866 Ga0163163_10645137
867 Ga0157380_10450263
868 Ga0157377_10233861
869 Ga0157379_10563929
870 Ga0157376_10092022
871 Ga0157376_10184534
872 Ga0163161_10008364
873 Ga0163161_10111362
874 Ga0213873_10013981
875 Ga0213876_10024389
876 Ga0213876_10183224
877 Ga0209758_1020460
878 Ga0209758_1128683
879 Ga0209257_1024758
880 Ga0207697_10252584
881 Ga0207653_10037773
882 Ga0207692_10041170
883 Ga0207688_10039902
884 Ga0207688_10176476
885 Ga0207680_10050687
886 Ga0207647_10303775
887 Ga0207645_10032171
888 Ga0207645_10048076
889 Ga0207645_10086901
890 Ga0207705_10484024
891 Ga0207654_10026696
892 Ga0207654_10439446
893 Ga0207695_10151953
894 Ga0207695_10176365
895 Ga0207671_10048745
896 Ga0207693_10028329
897 Ga0207693_10114516
898 Ga0207660_10714257
899 Ga0207662_10270543
900 Ga0207649_10120814
901 Ga0207681_10323971
902 Ga0207681_10590179
903 Ga0207681_10767567
904 Ga0207681_11187632
905 Ga0207694_10025006
906 Ga0207650_10608529
907 Ga0207659_10308327
908 Ga0207659_10325195
909 Ga0207687_10287708
910 Ga0207700_10175531
911 Ga0207664_10388171
912 Ga0207644_10164738
913 Ga0207644_10187415
914 Ga0207706_10016613
915 Ga0207706_10073436
916 Ga0207706_10385478
917 Ga0207706_10531622
918 Ga0207686_10204582
919 Ga0207709_10282052
920 Ga0207670_10120807
921 Ga0207670_10684518
922 Ga0207669_10239161
923 Ga0207704_10520717
924 Ga0207665_10570184
925 Ga0207691_10064717
926 Ga0207691_10442533
927 Ga0207711_10032504
928 Ga0207711_10256008
929 Ga0207689_10015162
930 Ga0207661_10090831
931 Ga0207679_10104180
932 Ga0207679_10966069
933 Ga0207679_10968410
934 Ga0207667_10018382
935 Ga0207667_10124669
936 Ga0207667_10706686
937 Ga0207651_10218231
938 Ga0207651_10793892
939 Ga0207712_10307632
940 Ga0207668_10005753
941 Ga0207668_10027223
942 Ga0207668_10108088
943 Ga0207668_10163779
944 Ga0207668_10198273
945 Ga0207640_10202002
946 Ga0207658_10070252
947 Ga0207677_10050297
948 Ga0207677_10135787
949 Ga0207677_10540963
950 Ga0207703_10013480
951 Ga0207703_10097973
952 Ga0207703_10717959
953 Ga0207639_10527932
954 Ga0207639_10658683
955 Ga0207639_11199105
956 Ga0207678_10033371
957 Ga0207678_10037005
958 Ga0207678_10046619
959 Ga0207678_10110030
960 Ga0207678_10127706
961 Ga0207678_10676720
962 Ga0207678_10827388
963 Ga0207702_10049194
964 Ga0207702_10049598
965 Ga0207702_10083161
966 Ga0207702_10760909
967 Ga0207641_10031325
968 Ga0207641_10580233
969 Ga0207648_10194189
970 Ga0207676_10021791
971 Ga0207676_10101799
972 Ga0207674_10122940
973 Ga0207674_10762084
974 Ga0207675_100150935
975 Ga0207675_100236435
976 Ga0207683_10018238
977 Ga0207683_10053045
978 Ga0207683_10297800
979 Ga0209813_10313002
980 Ga0268266_10003225
981 Ga0268266_10004165
982 Ga0268266_10209221
983 Ga0268266_10844001
984 Ga0268266_11304236
985 Ga0268265_10075399
986 Ga0268265_10167612
987 Ga0268265_11479083
988 Ga0268264_10744632
989 Ga0307517_10157822
990 Ga0307515_10016062
991 Ga0307515_10206548
992 Ga0307512_10377260
993 Ga0307513_10257965
994 Ga0307509_10077451
995 Ga0307405_10587804
996 Ga0307413_10924191
997 Ga0307412_10235555
998 Ga0307409_101553517
999 Ga0307411_10246631
1000 Ga0307415_100199594
1001 Ga0307415_100312324
1002 Ga0307510_10025403
1003 Ga0373957_0331740
1004 Ga0373931_0552910
1005 Ga0373931_0578316
1006 Ga0373937_0146485
1007 Ga0395900_0584961
1008 Ga0395898_0249607
1009 Ga0395905_0021733
1010 Ga0436364_0425587
1011 Ga0436365_0254148
1012 Ga0436365_1641286
1013 Ga0436360_0833609
1014 Ga0436363_0179669
1015 Ga0436362_0656487
1016 Ga0451789_0732108
1017 Ga0451791_0480612
1018 Ga0451797_0445312
1019 Ga0451798_0707696
1020 Ga0451800_1554497
1021 Ga0451807_0311811
1022 Ga0451841_1169861
1023 Ga0451845_0357776
1024 Ga0451849_0866963
1025 Ga0451849_1277062
1026 Ga0439435_0011715
1027 Ga0466966_0114188
1028 Ga0466961_0133690
1029 Ga0466961_0660614
1030 Ga0453684_0646170
1031 Ga0466968_0269900
1032 Ga0466970_0104125
1033 Ga0466959_0180450
1034 Ga0451576_0755638
1035 Ga0466967_0101266
1036 Ga0466967_0727738
1037 Ga0495617_019033
1038 Ga0495617_029047
1039 Ga0495617_086342
1040 Ga0495603_0008614
1041 Ga0495603_0046438
1042 Ga0495603_0206269
1043 Ga0495591_028960
1044 Ga0495629_0040306
1045 Ga0495629_0308280
1046 Ga0495638_0419611
1047 Ga0495650_0019173
1048 Ga0495650_0156533
1049 Ga0495639_0221147
1050 Ga0495639_0328871
1051 Ga0495585_0025119
1052 Ga0495594_0223382
1053 Ga0495596_0054912
1054 Ga0495607_0266072
1055 Ga0495583_0382395
1056 Ga0495606_0096080
1057 Ga0495610_0173756
1058 Ga0495616_0248946
1059 Ga0495620_0076088
1060 Ga0495620_0097011
1061 Ga0495628_0523417
1062 Ga0495632_0122055
1063 Ga0495632_0132265
1064 Ga0495632_0310837
1065 Ga0495637_0116634
1066 Ga0495643_0250442
1067 Ga0495644_0020125
1068 Ga0495644_0036883
1069 Ga0495644_0108545
1070 Ga0495648_0123574
1071 Ga0495663_0064487
1072 Ga0495642_0084769
1073 Ga0495642_0165862
1074 Ga0495652_0335491
1075 Ga0495654_0044928
1076 Ga0495587_0226411
1077 Ga0495598_0024974
1078 Ga0495609_0061529
1079 Ga0495621_0000243
1080 Ga0495597_0135077
1081 Ga0495645_0164107
1082 Ga0495622_0009891
1083 Ga0495633_0051611
1084 Ga0495633_0060301
1085 Ga0495656_0021836
1086 Ga0495656_0044344
1087 Ga0495668_0170492
1088 Ga0495668_0204190
1089 Ga0495625_0090236
1090 Ga0495625_0597058
1091 Ga0495635_0247064
1092 Ga0495635_0452009
1093 Ga0495659_0006030
1094 Ga0495659_0136668
1095 Ga0495588_0390386
1096 Ga0495658_0012007
1097 Ga0495613_0657817
1098 Ga0495670_0281638
1099 Ga0495671_0330117
1100 Ga0495649_0193967
1101 Ga0495589_0042871
1102 Ga0495589_0141727
1103 Ga0495600_0744484
1104 Ga0495660_0302567
1105 Ga0495581_0215959
1106 Ga0495604_0581258
1107 Ga0495636_0154484
1108 Ga0495672_0346532
1109 Ga0495676_0706351
1110 Ga0495680_0268646
1111 Ga0495683_0405361
1112 Ga0495679_109162
1113 Ga0495685_061162
1114 Ga0495681_0050691
1115 Ga0495681_0123615
1116 Ga0495686_0179632
1117 Ga0495593_0429872
1118 Ga0495615_0074739
1119 Ga0496100_0199700
1120 Ga0496100_1011344
1121 Ga0496101_0273636
1122 Ga0496101_0553083
1123 Ga0496102_0462729
1124 Ga0496104_0000094
1125 Ga0496104_0034325
1126 Ga0496105_0003265
1127 Ga0496106_0046352
1128 Ga0496106_0454664
1129 Ga0496107_0101903
1130 Ga0496108_0002336
1131 Ga0496108_0259887
1132 Ga0496109_0005457
1133 Ga0496109_0065946
1134 Ga0496110_0002789
1135 Ga0496110_0188472
1136 Ga0496110_0201841
1137 Ga0496110_1751601
1138 Ga0496111_0003109
1139 Ga0496112_0017874
1140 Ga0496112_1342249
1141 Ga0496113_0003316
1142 Ga0496113_0134133
1143 Ga0496113_0206880
1144 Ga0496113_0239330
1145 Ga0496114_0671748
1146 Ga0496115_0070535
1147 Ga0496115_0253788
1148 Ga0496115_0271677
1149 Ga0496115_0480347
1150 Ga0496118_0225674
1151 Ga0496119_0328463
1152 Ga0496120_0385015
1153 Ga0496121_0028497
1154 Ga0496121_0145545
1155 Ga0496121_0181691
1156 Ga0496121_0216038
1157 Ga0496121_0357296
1158 Ga0496124_0503647
1159 Ga0496125_0100491
1160 Ga0496126_0139353
1161 Ga0496126_0204243
1162 Ga0495678_105230
1163 Ga0501034_0366576
1164 Ga0501034_0523552
1165 Ga0501036_0821603
1166 Ga0501037_0247077
1167 Ga0501037_0740096
1168 Ga0501038_0553000
1169 Ga0501038_0779102
1170 Ga0501039_0305359
1171 Ga0501039_1075978
1172 Ga0501046_0199285
1173 Ga0501046_0398849
1174 Ga0501047_0011596
1175 Ga0501047_0164605
1176 Ga0501048_0401876
1177 Ga0501068_0277348
1178 Ga0501070_0004195
1179 Ga0501072_0189208
1180 Ga0501072_0259819
1181 Ga0501073_0302860
1182 Ga0501074_0494751
1183 Ga0501075_0224846
1184 Ga0501075_0715687
1185 Ga0501076_0612508
1186 Ga0501077_0241439
1187 Ga0501217_073296
1188 Ga0501227_223490
1189 Ga0501221_117816
1190 Ga0501079_0531576
1191 Ga0501080_0205066
1192 Ga0501080_0341901
1193 Ga0501081_0131789
1194 Ga0501083_0049566
1195 Ga0501035_0115612
1196 Ga0501035_0164517
1197 Ga0501044_0000712
1198 Ga0501044_0003178
1199 Ga0501044_0559346
1200 Ga0501045_0149613
1201 Ga0501045_0238764
1202 nmdc:mga03683_255094_c1
1203 nmdc:mga03n38_2635_c1
1204 nmdc:mga00v17_13449_c2
1205 nmdc:mga0yw44_142680_c1
1206 nmdc:mga0k408_126523_c1
1207 nmdc:mga06z11_72601_c1
1208 nmdc:mga04h51_346976_c1
1209 nmdc:mga07m45_190180_c1
1210 nmdc:mga07m45_224964_c1
1211 nmdc:mga05p37_81767_c1
1212 nmdc:mga09592_168384_c1
1213 nmdc:mga09592_374826_c1
1214 nmdc:mga0qj67_109490_c1
1215 nmdc:mga0qj67_966032_c1
1216 nmdc:mga08y16_119203_c1
1217 nmdc:mga08y16_708008_c1
1218 nmdc:mga0n895_1306709_c1
1219 nmdc:mga0n895_167453_c1
1220 nmdc:mga0n895_641239_c1
1221 nmdc:mga0rr50_185092_c1
1222 nmdc:mga0rr50_600000_c1
1223 Ga0495601_0056229
1224 Ga0495601_0060263
1225 Ga0500643_033277
1226 Ga0500581_317341
1227 Ga0500646_0079070
1228 Ga0500583_0061649
1229 Ga0500651_0214082
1230 Ga0500566_0044158
1231 Ga0500641_0008286
1232 Ga0500650_0083377
1233 Ga0500654_202084
1234 Ga0500554_000680
1235 Ga0500555_093405
1236 Ga0500556_0300420
1237 Ga0500562_061011
1238 Ga0500594_0119188
1239 Ga0500595_000521
1240 Ga0500595_008311
1241 Ga0500642_0152025
1242 Ga0500658_0073890
1243 Ga0500559_0065087
1244 Ga0500564_223999
1245 Ga0500577_0043358
1246 Ga0500589_088461
1247 Ga0500603_261257
1248 Ga0500627_0126883
1249 Ga0500633_0161744
1250 Ga0500634_0171068
1251 Ga0500634_0240184
1252 Ga0500638_121548
1253 Ga0500636_0046694
1254 Ga0500637_0000029
1255 Ga0500637_0508215
1256 Ga0500609_019811
1257 Ga0500587_033678
1258 Ga0500587_047397
1259 Ga0501084_0157125
1260 Ga0501084_0187562
1261 Ga0500661_000060
1262 Ga0501082_0193718
1263 Ga0501082_0351435
1264 Ga0530510_0331678
1265 2513694087
1266 2524535189
1267 2723849384
1268 2874608384
1269 2876815906
1270 2879112848
1271 2889035826
1272 2904708031
1273 2922364307
1274 2922389006
1275 8006936653
1276 8006970255
1277 8006976623
1278 8006992407
1279 8007000008
1280 8056678641

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

26

160

0.95

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

16

160

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pu2-assembly8.cif.gz_H crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9607 3 154
3pu2-assembly1.cif.gz_A crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9605 3 154
3pu2-assembly2.cif.gz_B crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9601 3 154
3pu2-assembly7.cif.gz_G crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9555 5 154
3pu2-assembly4.cif.gz_D crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.951 3 154
ID Description Score Start End Superfamily
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9532 3 152 3.30.530.20
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9146 3 152 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.89 5 155 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8892 13 153 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8837 5 154 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A4Q0T4P4-F1-model_v4 Putative glutathione S-transferase-related transmembrane protein 0.9894 49 153 GO:0016740
AF-A0A1W9Q833-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9863 3 152
AF-A0A2T7UR62-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9852 4 152
AF-A0A7Y2NHP6-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9833 1 153
AF-A0A7D7VI45-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9828 1 152

Map