F471539

General Info

Members Datasets Scaffolds Average Seq Length
638 287 638 220

Family's Representative Sequence

Representative Sequence 3300044719|Ga0466971_0023271|Ga0466971_0023271_510_1265
Length 251
Sequence LRIGLHVRRSAGPELSAALITVPNVRLLVARCEVRYSGRLDALLPEALRLIIIKADGSVLVHADAGGYKPLNWMTPPTVIEESSELMVVRKRAGSSEDRLEISLREVLSDVSHDMGTPDEDTALTKDGVEAHLQELLAEQPHWCGEGLRLVRREWPTDIGPVDLMCRDLEEQWVAVEIKRVAGIEAVEQLTRYLERIRLDPAFVSCRGVLAAQLIKPQARVLAGARGIDCVEVDLAVLRGERQPDLKLFAA

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
133 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
134 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
135 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
136 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
137 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
140 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
167 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
168 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
174 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
263 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
267 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
268 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
269 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
270 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
277 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
278 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
279 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
280 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
281 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
282 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
283 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
284 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
286 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
287 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 8.15
Rhizosphere 84.01
Stem 0
Stem Tuber 0
Unclassified 7.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10010674 3300002077 Bacteria 1880
2 Ga0070658_10202883 3300005327 Bacteria 1673
3 Ga0070658_10290290 3300005327 Bacteria 1393
4 Ga0070683_100012762 3300005329 Bacteria 7307
5 Ga0070683_100427051 3300005329 Bacteria 1264
6 Ga0070690_100018738 3300005330 Bacteria 4186
7 Ga0068869_100165812 3300005334 Bacteria 1723
8 Ga0070680_100002327 3300005336 Bacteria 14026
9 Ga0070680_100148678 3300005336 Bacteria 1966
10 Ga0070682_100029770 3300005337 Bacteria 3290
11 Ga0068868_100093729 3300005338 Bacteria 2421
12 Ga0068868_100274750 3300005338 Bacteria 1424
13 Ga0070660_100007570 3300005339 Bacteria 7568
14 Ga0070660_100096113 3300005339 Unclassified 2342
15 Ga0070687_100008486 3300005343 Bacteria 4357
16 Ga0070687_100198201 3300005343 Bacteria 1215
17 Ga0070661_100008448 3300005344 Bacteria 7121
18 Ga0070692_10407171 3300005345 Bacteria 860
19 Ga0070668_100184506 3300005347 Bacteria 1706
20 Ga0070668_100460714 3300005347 Bacteria 1095
21 Ga0070669_100700385 3300005353 Bacteria 855
22 Ga0070671_100031215 3300005355 Bacteria 4400
23 Ga0070674_100015392 3300005356 Bacteria 4775
24 Ga0070688_100248507 3300005365 Bacteria 1265
25 Ga0070659_100016250 3300005366 Bacteria 5586
26 Ga0070659_100073669 3300005366 Bacteria 2718
27 Ga0070659_100107801 3300005366 Bacteria 2246
28 Ga0070659_100258754 3300005366 Bacteria 1444
29 Ga0070714_100018537 3300005435 Bacteria 5656
30 Ga0070714_100056593 3300005435 Bacteria 3355
31 Ga0070714_100160037 3300005435 Bacteria 2036
32 Ga0070714_100374846 3300005435 Bacteria 1341
33 Ga0070714_100402748 3300005435 Bacteria 1294
34 Ga0070714_100550348 3300005435 Bacteria 1105
35 Ga0070713_100019157 3300005436 Bacteria 5217
36 Ga0070713_100031459 3300005436 Bacteria 4227
37 Ga0070713_100264978 3300005436 Bacteria 1571
38 Ga0070710_10006000 3300005437 Bacteria 5805
39 Ga0070701_10001596 3300005438 Bacteria 8438
40 Ga0070711_100434604 3300005439 Bacteria 1072
41 Ga0070700_100017943 3300005441 Bacteria 4059
42 Ga0070700_100165268 3300005441 Bacteria 1527
43 Ga0070694_100078469 3300005444 Bacteria 2290
44 Ga0070708_100882887 3300005445 Bacteria 840
45 Ga0070662_100057740 3300005457 Bacteria 2821
46 Ga0070681_10035917 3300005458 Bacteria 4978
47 Ga0070681_10224447 3300005458 Bacteria 1793
48 Ga0070681_10360229 3300005458 Bacteria 1365
49 Ga0070681_10505456 3300005458 Bacteria 1122
50 Ga0068867_100001986 3300005459 Bacteria 14268
51 Ga0070685_10019049 3300005466 Bacteria 3699
52 Ga0070699_100572458 3300005518 Bacteria 1029
53 Ga0070679_100026448 3300005530 Bacteria 5700
54 Ga0070679_100124608 3300005530 Bacteria 2559
55 Ga0070684_100174751 3300005535 Bacteria 1952
56 Ga0070684_100227481 3300005535 Unclassified 1703
57 Ga0070697_100658005 3300005536 Bacteria 923
58 Ga0068853_100083654 3300005539 Bacteria 2796
59 Ga0068853_100519898 3300005539 Bacteria 1125
60 Ga0068853_100565856 3300005539 Bacteria 1078
61 Ga0070686_100001306 3300005544 Bacteria 14081
62 Ga0070696_100012789 3300005546 Bacteria 5636
63 Ga0070693_100114253 3300005547 Bacteria 1665
64 Ga0070665_100538555 3300005548 Bacteria 1179
65 Ga0070704_100032451 3300005549 Bacteria 3523
66 Ga0068854_100045259 3300005578 Bacteria 3128
67 Ga0068856_100925053 3300005614 Bacteria 891
68 Ga0070702_100086353 3300005615 Bacteria 1892
69 Ga0068852_100185740 3300005616 Bacteria 1958
70 Ga0068852_100502267 3300005616 Bacteria 1208
71 Ga0068859_100425366 3300005617 Bacteria 1424
72 Ga0068866_10020230 3300005718 Bacteria 3047
73 Ga0068866_10069515 3300005718 Bacteria 1855
74 Ga0068861_100018009 3300005719 Bacteria 5023
75 Ga0068861_100067605 3300005719 Bacteria 2758
76 Ga0068858_100180928 3300005842 Bacteria 1991
77 Ga0068862_100252829 3300005844 Bacteria 1607
78 Ga0081538_10001726 3300005981 Bacteria 22212
79 Ga0081538_10005377 3300005981 Bacteria 11513
80 Ga0081538_10015590 3300005981 Bacteria 5874
81 Ga0081539_10101701 3300005985 Bacteria 1463
82 Ga0070717_10014762 3300006028 Bacteria 6009
83 Ga0070717_10024989 3300006028 Bacteria 4745
84 Ga0070717_10047485 3300006028 Bacteria 3518
85 Ga0070717_10465501 3300006028 Bacteria 1140
86 Ga0070717_10671871 3300006028 Bacteria 941
87 Ga0075364_10036616 3300006051 Bacteria 3173
88 Ga0070716_100090231 3300006173 Bacteria 1853
89 Ga0070712_100018561 3300006175 Bacteria 4520
90 Ga0070712_100113399 3300006175 Bacteria 2027
91 Ga0068871_100044002 3300006358 Bacteria 3588
92 Ga0075428_100037894 3300006844 Bacteria 5306
93 Ga0075428_100314695 3300006844 Bacteria 1683
94 Ga0075431_100046842 3300006847 Bacteria 4459
95 Ga0075433_10094751 3300006852 Bacteria 2642
96 Ga0075433_10432254 3300006852 Bacteria 1161
97 Ga0075434_100080236 3300006871 Bacteria 3259
98 Ga0075434_100130145 3300006871 Bacteria 2535
99 Ga0075429_100230296 3300006880 Bacteria 1623
100 Ga0068865_100015718 3300006881 Bacteria 4829
101 Ga0068865_100051365 3300006881 Bacteria 2853
102 Ga0075436_100013781 3300006914 Bacteria 5537
103 Ga0097620_100425357 3300006931 Bacteria 1424
104 Ga0075435_100060567 3300007076 Bacteria 3069
105 Ga0075435_100124926 3300007076 Bacteria 2150
106 Ga0105245_10072800 3300009098 Bacteria 3123
107 Ga0105245_10105095 3300009098 Bacteria 2619
108 Ga0114129_10006658 3300009147 Bacteria 16406
109 Ga0114129_10096414 3300009147 Bacteria 4095
110 Ga0114129_10226877 3300009147 Bacteria 2517
111 Ga0105243_10041003 3300009148 Bacteria 3619
112 Ga0105243_10206287 3300009148 Bacteria 1727
113 Ga0105243_10539662 3300009148 Bacteria 1112
114 Ga0105242_10058370 3300009176 Bacteria 3163
115 Ga0105242_10068762 3300009176 Bacteria 2931
116 Ga0105248_10048411 3300009177 Bacteria 4769
117 Ga0105238_10087200 3300009551 Bacteria 3108
118 Ga0105238_10275056 3300009551 Bacteria 1665
119 Ga0105238_10562093 3300009551 Bacteria 1146
120 Ga0105249_10010542 3300009553 Bacteria 8120
121 Ga0105249_10033962 3300009553 Bacteria 4620
122 Ga0105249_10165729 3300009553 Bacteria 2139
123 Ga0105239_10002157 3300010375 Bacteria 25329
124 Ga0105239_10250605 3300010375 Bacteria 1989
125 Ga0105239_11206251 3300010375 Bacteria 872
126 Ga0157370_10011112 3300013104 Bacteria 9439
127 Ga0157370_10133223 3300013104 Bacteria 2317
128 Ga0157369_10166132 3300013105 Bacteria 2327
129 Ga0157374_10012163 3300013296 Bacteria 7477
130 Ga0157374_10782209 3300013296 Unclassified 970
131 Ga0157378_10037430 3300013297 Bacteria 4297
132 Ga0163162_10001769 3300013306 Bacteria 20249
133 Ga0163162_10886361 3300013306 Bacteria 1006
134 Ga0157372_10198145 3300013307 Bacteria 2326
135 Ga0157372_10264823 3300013307 Bacteria 1996
136 Ga0157372_11309152 3300013307 Bacteria 836
137 Ga0157380_10017229 3300014326 Bacteria 5344
138 Ga0157380_10036935 3300014326 Bacteria 3783
139 Ga0182008_10223456 3300014497 Bacteria 964
140 Ga0157377_10061972 3300014745 Bacteria 2139
141 Ga0157376_10046520 3300014969 Bacteria 3578
142 Ga0163161_10207025 3300017792 Bacteria 1514
143 Ga0206354_11348025 3300020081 Bacteria 2394
144 Ga0206353_10596252 3300020082 Bacteria 5631
145 Ga0206353_10863355 3300020082 Bacteria 2387
146 Ga0206353_11434632 3300020082 Bacteria 2643
147 Ga0213874_10000005 3300021377 Bacteria 27808
148 Ga0213874_10048479 3300021377 Bacteria 1296
149 Ga0213874_10085101 3300021377 Bacteria 1030
150 Ga0213876_10006232 3300021384 Bacteria 6506
151 Ga0213876_10016494 3300021384 Bacteria 3905
152 Ga0213876_10059078 3300021384 Bacteria 2024
153 Ga0213876_10101855 3300021384 Bacteria 1522
154 Ga0213876_10147870 3300021384 Bacteria 1249
155 Ga0213876_10150506 3300021384 Bacteria 1238
156 Ga0213875_10006473 3300021388 Bacteria 6141
157 Ga0213875_10009519 3300021388 Bacteria 4920
158 Ga0213875_10016639 3300021388 Bacteria 3564
159 Ga0213875_10083886 3300021388 Bacteria 1487
160 Ga0207692_10145259 3300025898 Bacteria 1353
161 Ga0207642_10012082 3300025899 Bacteria 3105
162 Ga0207699_10027001 3300025906 Bacteria 3173
163 Ga0207705_10217250 3300025909 Bacteria 1451
164 Ga0207707_10135132 3300025912 Bacteria 2156
165 Ga0207707_10157467 3300025912 Bacteria 1986
166 Ga0207707_10294270 3300025912 Bacteria 1404
167 Ga0207707_10338547 3300025912 Bacteria 1297
168 Ga0207693_10002345 3300025915 Bacteria 16445
169 Ga0207693_10046637 3300025915 Bacteria 3405
170 Ga0207693_10210332 3300025915 Bacteria 1529
171 Ga0207693_10212928 3300025915 Bacteria 1519
172 Ga0207663_10015163 3300025916 Bacteria 4244
173 Ga0207663_10090167 3300025916 Bacteria 2032
174 Ga0207663_10107181 3300025916 Bacteria 1889
175 Ga0207660_10041075 3300025917 Bacteria 3240
176 Ga0207660_10154969 3300025917 Bacteria 1763
177 Ga0207660_10298995 3300025917 Bacteria 1281
178 Ga0207662_10113456 3300025918 Bacteria 1692
179 Ga0207657_10012783 3300025919 Bacteria 8263
180 Ga0207657_10017863 3300025919 Bacteria 6788
181 Ga0207657_10018530 3300025919 Bacteria 6640
182 Ga0207657_10049707 3300025919 Bacteria 3651
183 Ga0207657_10417656 3300025919 Bacteria 1054
184 Ga0207652_10023986 3300025921 Bacteria 5060
185 Ga0207652_10098505 3300025921 Bacteria 2578
186 Ga0207652_10142052 3300025921 Bacteria 2147
187 Ga0207694_10414532 3300025924 Bacteria 1121
188 Ga0207694_10614443 3300025924 Bacteria 914
189 Ga0207687_10435085 3300025927 Unclassified 1085
190 Ga0207687_10438226 3300025927 Bacteria 1082
191 Ga0207687_10700241 3300025927 Bacteria 860
192 Ga0207700_10017046 3300025928 Bacteria 4841
193 Ga0207700_10035952 3300025928 Bacteria 3573
194 Ga0207700_10091210 3300025928 Bacteria 2406
195 Ga0207664_10001411 3300025929 Bacteria 15808
196 Ga0207664_10028937 3300025929 Bacteria 4217
197 Ga0207664_10050177 3300025929 Bacteria 3289
198 Ga0207664_10050634 3300025929 Bacteria 3276
199 Ga0207664_10313078 3300025929 Bacteria 1383
200 Ga0207644_10047535 3300025931 Bacteria 3063
201 Ga0207690_10060649 3300025932 Bacteria 2568
202 Ga0207690_10287668 3300025932 Bacteria 1282
203 Ga0207686_10039731 3300025934 Bacteria 2856
204 Ga0207686_10145429 3300025934 Bacteria 1644
205 Ga0207709_10062717 3300025935 Bacteria 2328
206 Ga0207669_10025080 3300025937 Bacteria 3215
207 Ga0207704_10015400 3300025938 Bacteria 3895
208 Ga0207704_10613006 3300025938 Bacteria 892
209 Ga0207665_10583332 3300025939 Bacteria 872
210 Ga0207665_10841294 3300025939 Bacteria 726
211 Ga0207691_10171852 3300025940 Bacteria 1898
212 Ga0207691_10486579 3300025940 Bacteria 1048
213 Ga0207689_10834376 3300025942 Bacteria 778
214 Ga0207661_10022852 3300025944 Bacteria 4716
215 Ga0207679_10056979 3300025945 Bacteria 2888
216 Ga0207679_10348869 3300025945 Bacteria 1289
217 Ga0207679_10688867 3300025945 Bacteria 927
218 Ga0207667_10267732 3300025949 Bacteria 1747
219 Ga0207667_10512455 3300025949 Bacteria 1216
220 Ga0207712_10152968 3300025961 Bacteria 1784
221 Ga0207668_10103327 3300025972 Bacteria 2122
222 Ga0207668_10187024 3300025972 Bacteria 1638
223 Ga0207640_10736552 3300025981 Bacteria 849
224 Ga0207658_10165780 3300025986 Bacteria 1815
225 Ga0207677_10338979 3300026023 Bacteria 1255
226 Ga0207639_10209385 3300026041 Bacteria 1677
227 Ga0207639_10436749 3300026041 Bacteria 1186
228 Ga0207678_10055213 3300026067 Bacteria 3421
229 Ga0207708_10018961 3300026075 Bacteria 5181
230 Ga0207708_10035685 3300026075 Bacteria 3784
231 Ga0207702_10198515 3300026078 Bacteria 1858
232 Ga0207702_10471384 3300026078 Bacteria 1221
233 Ga0207648_10000947 3300026089 Bacteria 32821
234 Ga0207676_10346929 3300026095 Bacteria 1372
235 Ga0207675_100034760 3300026118 Bacteria 4700
236 Ga0207675_100038595 3300026118 Bacteria 4456
237 Ga0207683_10005535 3300026121 Bacteria 10827
238 Ga0207683_10331012 3300026121 Bacteria 1396
239 Ga0207698_10191504 3300026142 Bacteria 1822
240 Ga0207698_10631754 3300026142 Bacteria 1059
241 Ga0268265_10047046 3300028380 Unclassified 3230
242 Ga0265337_1005371 3300028556 Bacteria 5095
243 Ga0265326_10000282 3300028558 Bacteria 23309
244 Ga0265319_1000065 3300028563 Bacteria 85273
245 Ga0265318_10008234 3300028577 Bacteria 4656
246 Ga0265322_10006583 3300028654 Bacteria 3417
247 Ga0265336_10000001 3300028666 Bacteria 916179
248 Ga0265338_10000004 3300028800 Bacteria 644793
249 Ga0265338_10030889 3300028800 Bacteria 5263
250 Ga0265338_10195970 3300028800 Bacteria 1527
251 Ga0265328_10115089 3300031239 Bacteria 1001
252 Ga0265320_10156864 3300031240 Bacteria 1026
253 Ga0265340_10000002 3300031247 Bacteria 711693
254 Ga0265327_10030508 3300031251 Bacteria 3046
255 Ga0265342_10251476 3300031712 Bacteria 943
256 Ga0307413_10056524 3300031824 Bacteria 2394
257 Ga0307413_10525810 3300031824 Bacteria 955
258 Ga0307410_10488781 3300031852 Bacteria 1011
259 Ga0307406_10259615 3300031901 Bacteria 1313
260 Ga0307406_10582182 3300031901 Bacteria 920
261 Ga0307407_10187715 3300031903 Bacteria 1375
262 Ga0307412_10719590 3300031911 Bacteria 859
263 Ga0307409_100331132 3300031995 Bacteria 1429
264 Ga0307416_100572323 3300032002 Bacteria 1206
265 Ga0307415_100010737 3300032126 Bacteria 5202
266 Ga0307415_100058533 3300032126 Bacteria 2653
267 Ga0373924_0055216 3300035410 Bacteria 1653
268 Ga0373933_0023248 3300035724 Bacteria 3539
269 Ga0373933_0376801 3300035724 Bacteria 924
270 Ga0373937_0153973 3300036401 Bacteria 2154
271 Ga0373925_0280645 3300037068 Bacteria 1341
272 Ga0373925_0346983 3300037068 Bacteria 1205
273 Ga0395899_0084568 3300037312 Unclassified 2306
274 Ga0395899_0214702 3300037312 Unclassified 1335
275 Ga0395900_0004135 3300037418 Bacteria 15451
276 Ga0395900_0026510 3300037418 Bacteria 5934
277 Ga0395900_0034090 3300037418 Bacteria 5240
278 Ga0395900_0053454 3300037418 Bacteria 4157
279 Ga0395900_0065982 3300037418 Bacteria 3719
280 Ga0395900_0094185 3300037418 Bacteria 3076
281 Ga0395900_0151152 3300037418 Bacteria 2372
282 Ga0395898_0000894 3300037466 Bacteria 48455
283 Ga0395898_0006669 3300037466 Bacteria 12312
284 Ga0395898_0021885 3300037466 Bacteria 6477
285 Ga0395898_0050565 3300037466 Bacteria 4067
286 Ga0395905_0017576 3300037471 Bacteria 6786
287 Ga0395905_0027590 3300037471 Bacteria 5354
288 Ga0395905_0040789 3300037471 Bacteria 4355
289 Ga0395905_0237994 3300037471 Bacteria 1702
290 Ga0436364_0159150 3300037853 Bacteria 9191
291 Ga0436364_0159207 3300037853 Bacteria 28255
292 Ga0436364_0263937 3300037853 Bacteria 1047
293 Ga0436364_0334646 3300037853 Bacteria 5280
294 Ga0436364_0418406 3300037853 Bacteria 5504
295 Ga0436364_0424870 3300037853 Bacteria 994
296 Ga0436364_0793605 3300037853 Bacteria 3185
297 Ga0436364_0811094 3300037853 Bacteria 4923
298 Ga0436364_1339551 3300037853 Bacteria 15044
299 Ga0436364_1346518 3300037853 Bacteria 4089
300 Ga0395901_0003054 3300038443 Bacteria 16863
301 Ga0395901_0011629 3300038443 Bacteria 8913
302 Ga0395901_0020589 3300038443 Bacteria 6751
303 Ga0395901_0133342 3300038443 Bacteria 2610
304 Ga0395901_0476002 3300038443 Bacteria 1274
305 Ga0395901_0523142 3300038443 Bacteria 1205
306 Ga0395901_0630799 3300038443 Bacteria 1077
307 Ga0242420_059665 3300038996 Bacteria 759
308 Ga0436365_0004038 3300039437 Bacteria 26265
309 Ga0436365_0168949 3300039437 Bacteria 4102
310 Ga0436365_0186047 3300039437 Bacteria 1555
311 Ga0436365_0896130 3300039437 Bacteria 22043
312 Ga0436365_1001279 3300039437 Bacteria 29327
313 Ga0436365_1282173 3300039437 Bacteria 7766
314 Ga0436365_1315914 3300039437 Bacteria 1974
315 Ga0436365_1510673 3300039437 Bacteria 7863
316 Ga0436365_1758755 3300039437 Bacteria 3726
317 Ga0436365_1790130 3300039437 Bacteria 6598
318 Ga0436365_1809914 3300039437 Bacteria 2888
319 Ga0436365_1843863 3300039437 Bacteria 9695
320 Ga0436365_1906563 3300039437 Bacteria 2176
321 Ga0436360_0896315 3300039438 Bacteria 1304
322 Ga0436363_0212212 3300039450 Bacteria 1613
323 Ga0436363_0595893 3300039450 Bacteria 2279
324 Ga0436363_0760459 3300039450 Bacteria 34430
325 Ga0436363_0843533 3300039450 Bacteria 7913
326 Ga0436363_0896388 3300039450 Bacteria 1859
327 Ga0436363_0985997 3300039450 Bacteria 1073
328 Ga0436363_1078326 3300039450 Bacteria 1860
329 Ga0436363_1691717 3300039450 Bacteria 5219
330 Ga0436362_0325995 3300039453 Bacteria 913
331 Ga0436362_0993185 3300039453 Bacteria 777
332 Ga0466969_0017968 3300044656 Bacteria 3689
333 Ga0466969_0026626 3300044656 Bacteria 2964
334 Ga0466969_0029449 3300044656 Bacteria 2803
335 Ga0466969_0183497 3300044656 Bacteria 957
336 Ga0466965_0026614 3300044683 Bacteria 2804
337 Ga0466965_0081916 3300044683 Bacteria 1632
338 Ga0466966_0016985 3300044684 Bacteria 4810
339 Ga0466966_0031037 3300044684 Bacteria 3466
340 Ga0466966_0195381 3300044684 Bacteria 1225
341 Ga0466966_0273347 3300044684 Bacteria 1017
342 Ga0466961_0004704 3300044693 Bacteria 8585
343 Ga0466961_0076742 3300044693 Bacteria 2117
344 Ga0466961_0078710 3300044693 Bacteria 2088
345 Ga0466961_0081110 3300044693 Bacteria 2053
346 Ga0466961_0095342 3300044693 Bacteria 1876
347 Ga0466961_0387963 3300044693 Bacteria 848
348 Ga0466963_0000104 3300044694 Bacteria 30306
349 Ga0466963_0007807 3300044694 Bacteria 6400
350 Ga0466963_0013255 3300044694 Bacteria 5060
351 Ga0466963_0050761 3300044694 Bacteria 2746
352 Ga0466963_0118470 3300044694 Bacteria 1821
353 Ga0466963_0170911 3300044694 Bacteria 1515
354 Ga0466963_0408613 3300044694 Bacteria 957
355 Ga0466971_0005233 3300044719 Bacteria 5617
356 Ga0466971_0023271 3300044719 Bacteria 2760
357 Ga0466971_0028325 3300044719 Bacteria 2507
358 Ga0466968_0033615 3300044735 Bacteria 2137
359 Ga0466968_0233436 3300044735 Bacteria 869
360 Ga0466970_0014568 3300044765 Bacteria 4039
361 Ga0466970_0033730 3300044765 Bacteria 2707
362 Ga0466957_0001380 3300044842 Bacteria 12675
363 Ga0466957_0005549 3300044842 Bacteria 7086
364 Ga0466957_0034550 3300044842 Bacteria 3033
365 Ga0466957_0177667 3300044842 Bacteria 1389
366 Ga0466957_0242061 3300044842 Bacteria 1197
367 Ga0466960_0005487 3300044901 Bacteria 5029
368 Ga0466959_0009139 3300045049 Bacteria 7039
369 Ga0466959_0012687 3300045049 Bacteria 6096
370 Ga0466959_0018636 3300045049 Bacteria 5098
371 Ga0466959_0053107 3300045049 Bacteria 2964
372 Ga0466959_0062978 3300045049 Bacteria 2694
373 Ga0466959_0079682 3300045049 Bacteria 2361
374 Ga0466959_0110111 3300045049 Bacteria 1966
375 Ga0466959_0132945 3300045049 Bacteria 1762
376 Ga0466959_0150528 3300045049 Bacteria 1640
377 Ga0466959_0710608 3300045049 Bacteria 673
378 Ga0466958_0000233 3300045836 Bacteria 21201
379 Ga0466958_0001574 3300045836 Bacteria 10946
380 Ga0466958_0004120 3300045836 Bacteria 7630
381 Ga0466958_0021100 3300045836 Bacteria 3803
382 Ga0466958_0023271 3300045836 Bacteria 3634
383 Ga0466958_0039365 3300045836 Bacteria 2840
384 Ga0466958_0041198 3300045836 Bacteria 2778
385 Ga0466958_0060810 3300045836 Bacteria 2300
386 Ga0466958_0069955 3300045836 Bacteria 2147
387 Ga0466958_0224159 3300045836 Bacteria 1200
388 Ga0466958_0240136 3300045836 Bacteria 1158
389 Ga0466967_0007977 3300045976 Bacteria 7704
390 Ga0466967_0008602 3300045976 Bacteria 7502
391 Ga0466967_0080963 3300045976 Bacteria 2932
392 Ga0466967_0211681 3300045976 Bacteria 1839
393 Ga0466967_0222003 3300045976 Bacteria 1796
394 Ga0466967_0361383 3300045976 Bacteria 1407
395 Ga0466967_0396298 3300045976 Bacteria 1342
396 Ga0466967_0398970 3300045976 Bacteria 1338
397 Ga0466967_0661002 3300045976 Bacteria 1034
398 Ga0466967_0830978 3300045976 Bacteria 918
399 Ga0495592_0076660 3300046454 Bacteria 2425
400 Ga0495592_0346917 3300046454 Bacteria 953
401 Ga0495603_0007570 3300046455 Bacteria 6534
402 Ga0495603_0047885 3300046455 Bacteria 2545
403 Ga0495641_0134061 3300046461 Unclassified 1106
404 Ga0495651_0006559 3300046462 Bacteria 8886
405 Ga0495653_0028675 3300046463 Bacteria 4449
406 Ga0495653_0132989 3300046463 Bacteria 1758
407 Ga0495650_0000053 3300046471 Bacteria 316684
408 Ga0495580_0456348 3300046472 Bacteria 857
409 Ga0495582_0092130 3300046473 Bacteria 1690
410 Ga0495664_0000036 3300046477 Bacteria 71543
411 Ga0495584_0076277 3300046491 Bacteria 1686
412 Ga0495594_0268053 3300046499 Bacteria 973
413 Ga0495596_0197542 3300046500 Bacteria 782
414 Ga0495608_0057911 3300046511 Bacteria 2555
415 Ga0495608_0191266 3300046511 Bacteria 1292
416 Ga0495618_0000875 3300046514 Bacteria 20807
417 Ga0495618_0009790 3300046514 Bacteria 5794
418 Ga0495628_0036020 3300046516 Bacteria 3974
419 Ga0495630_0180663 3300046517 Bacteria 1609
420 Ga0495630_0262199 3300046517 Bacteria 1320
421 Ga0495630_0403544 3300046517 Bacteria 1047
422 Ga0495666_0231874 3300046526 Bacteria 844
423 Ga0495652_0028874 3300046529 Bacteria 4876
424 Ga0495652_0035637 3300046529 Bacteria 4330
425 Ga0495665_0080189 3300046531 Bacteria 1717
426 Ga0495640_0036389 3300046533 Bacteria 3478
427 Ga0495587_0234375 3300046536 Bacteria 1034
428 Ga0495645_0091105 3300046543 Bacteria 2178
429 Ga0495667_0001023 3300046559 Bacteria 18094
430 Ga0495667_0159055 3300046559 Bacteria 1453
431 Ga0495656_0127186 3300046615 Bacteria 1209
432 Ga0495634_0023315 3300046642 Bacteria 4352
433 Ga0495634_0029954 3300046642 Bacteria 3763
434 Ga0495635_0079599 3300046663 Bacteria 2242
435 Ga0495635_0083822 3300046663 Bacteria 2181
436 Ga0495657_0021964 3300046675 Bacteria 4575
437 Ga0495657_0183327 3300046675 Bacteria 1283
438 Ga0495657_0365758 3300046675 Bacteria 852
439 Ga0495646_0040775 3300046680 Bacteria 2857
440 Ga0495646_0125171 3300046680 Bacteria 1451
441 Ga0495647_0033918 3300046681 Bacteria 1910
442 Ga0495647_0079646 3300046681 Bacteria 1326
443 Ga0495658_0035435 3300046683 Bacteria 2746
444 Ga0495613_0012677 3300046689 Bacteria 6268
445 Ga0495613_0128797 3300046689 Bacteria 1813
446 Ga0495613_0205474 3300046689 Bacteria 1387
447 Ga0495613_0332992 3300046689 Bacteria 1046
448 Ga0495624_0178431 3300046690 Bacteria 1295
449 Ga0495600_0125680 3300046809 Bacteria 1668
450 Ga0495604_0334136 3300047317 Bacteria 1010
451 Ga0495674_0084744 3300047319 Bacteria 2715
452 Ga0495674_0155618 3300047319 Bacteria 1915
453 Ga0495674_0206862 3300047319 Bacteria 1627
454 Ga0495676_0071399 3300047321 Bacteria 2669
455 Ga0495680_0009812 3300047322 Bacteria 8587
456 Ga0495680_0080447 3300047322 Bacteria 2462
457 Ga0495684_0014186 3300047471 Bacteria 6130
458 Ga0495684_0015619 3300047471 Bacteria 5844
459 Ga0495684_0057504 3300047471 Bacteria 2964
460 Ga0495602_0057336 3300048088 Bacteria 3417
461 Ga0496100_0034935 3300048903 Bacteria 3159
462 Ga0496100_0044855 3300048903 Bacteria 2834
463 Ga0496100_0086206 3300048903 Bacteria 2132
464 Ga0496100_0329586 3300048903 Bacteria 1149
465 Ga0496100_0334780 3300048903 Bacteria 1140
466 Ga0496101_0071832 3300048904 Bacteria 2538
467 Ga0496101_0090734 3300048904 Bacteria 2273
468 Ga0496101_0403433 3300048904 Bacteria 1077
469 Ga0496102_0031622 3300048905 Bacteria 4748
470 Ga0496102_0152077 3300048905 Bacteria 2175
471 Ga0496104_0000033 3300048907 Bacteria 189758
472 Ga0496104_0007061 3300048907 Bacteria 9904
473 Ga0496104_0012549 3300048907 Bacteria 7624
474 Ga0496104_0093699 3300048907 Bacteria 2873
475 Ga0496104_0338389 3300048907 Bacteria 1418
476 Ga0496104_1040083 3300048907 Bacteria 723
477 Ga0496105_0015422 3300048908 Bacteria 6090
478 Ga0496105_0099074 3300048908 Bacteria 2407
479 Ga0496105_0164230 3300048908 Bacteria 1822
480 Ga0496106_0036395 3300048909 Bacteria 3682
481 Ga0496106_0049891 3300048909 Bacteria 3153
482 Ga0496107_0007930 3300048910 Bacteria 7329
483 Ga0496107_0041472 3300048910 Bacteria 3304
484 Ga0496107_0070849 3300048910 Bacteria 2532
485 Ga0496108_0006408 3300048911 Bacteria 9542
486 Ga0496108_0141236 3300048911 Bacteria 2075
487 Ga0496108_0337704 3300048911 Bacteria 1314
488 Ga0496108_0684660 3300048911 Bacteria 890
489 Ga0496109_0000119 3300048912 Bacteria 81869
490 Ga0496109_0035786 3300048912 Bacteria 4482
491 Ga0496109_0253050 3300048912 Bacteria 1659
492 Ga0496109_0298425 3300048912 Bacteria 1519
493 Ga0496109_0473793 3300048912 Bacteria 1182
494 Ga0496110_0000046 3300048913 Bacteria 60653
495 Ga0496110_0010360 3300048913 Bacteria 7579
496 Ga0496110_0023147 3300048913 Bacteria 5283
497 Ga0496111_0002403 3300048914 Bacteria 11299
498 Ga0496111_0002592 3300048914 Bacteria 10944
499 Ga0496111_0033355 3300048914 Bacteria 3671
500 Ga0496111_0036337 3300048914 Bacteria 3522
501 Ga0496112_0002347 3300048915 Bacteria 15192
502 Ga0496112_0005144 3300048915 Bacteria 11247
503 Ga0496112_0034280 3300048915 Bacteria 4939
504 Ga0496112_0144060 3300048915 Bacteria 2351
505 Ga0496112_0369705 3300048915 Bacteria 1375
506 Ga0496113_0002780 3300048916 Bacteria 10293
507 Ga0496113_0009800 3300048916 Bacteria 6302
508 Ga0496113_0093058 3300048916 Bacteria 2326
509 Ga0496114_0001493 3300048917 Bacteria 17771
510 Ga0496114_0013504 3300048917 Bacteria 6550
511 Ga0496114_0093555 3300048917 Bacteria 2556
512 Ga0496115_0370071 3300048918 Bacteria 1166
513 Ga0496119_0078970 3300048922 Bacteria 1902
514 Ga0501031_0018002 3300049568 Bacteria 4596
515 Ga0501031_0107433 3300049568 Bacteria 1822
516 Ga0501032_0006397 3300049569 Bacteria 8668
517 Ga0501032_0010737 3300049569 Bacteria 6592
518 Ga0501032_0126199 3300049569 Bacteria 1690
519 Ga0501032_0275405 3300049569 Bacteria 1090
520 Ga0501033_0006867 3300049570 Bacteria 8888
521 Ga0501033_0041858 3300049570 Bacteria 3416
522 Ga0501034_0036214 3300049571 Bacteria 5000
523 Ga0501034_0116761 3300049571 Bacteria 2656
524 Ga0501036_0009924 3300049572 Bacteria 7843
525 Ga0501036_0040505 3300049572 Bacteria 3940
526 Ga0501036_0043491 3300049572 Bacteria 3804
527 Ga0501037_0010808 3300049573 Bacteria 6709
528 Ga0501037_0063847 3300049573 Bacteria 2684
529 Ga0501037_0102158 3300049573 Bacteria 2068
530 Ga0501037_0612052 3300049573 Bacteria 731
531 Ga0501038_0015020 3300049574 Bacteria 7053
532 Ga0501038_0026437 3300049574 Bacteria 5169
533 Ga0501038_0432809 3300049574 Bacteria 1014
534 Ga0501038_0587441 3300049574 Bacteria 844
535 Ga0501039_0048377 3300049575 Bacteria 3287
536 Ga0501040_0003675 3300049576 Bacteria 9935
537 Ga0501040_0018215 3300049576 Bacteria 4662
538 Ga0501040_0108162 3300049576 Bacteria 1944
539 Ga0501040_0347425 3300049576 Bacteria 1062
540 Ga0501041_0078505 3300049577 Bacteria 2031
541 Ga0501041_0227689 3300049577 Bacteria 1170
542 Ga0501042_0002692 3300049578 Bacteria 10937
543 Ga0501042_0072657 3300049578 Bacteria 2461
544 Ga0501042_0097932 3300049578 Bacteria 2108
545 Ga0501042_0275569 3300049578 Bacteria 1215
546 Ga0501043_0007275 3300049579 Bacteria 8787
547 Ga0501043_0066021 3300049579 Bacteria 2841
548 Ga0501046_0012939 3300049580 Bacteria 7090
549 Ga0501046_0043183 3300049580 Bacteria 3590
550 Ga0501047_0035150 3300049581 Bacteria 4841
551 Ga0501047_0062404 3300049581 Bacteria 3594
552 Ga0501048_0006396 3300049582 Bacteria 8955
553 Ga0501048_0021652 3300049582 Bacteria 4705
554 Ga0501048_0046928 3300049582 Bacteria 3083
555 Ga0501048_0068149 3300049582 Bacteria 2514
556 Ga0501067_0017910 3300049583 Bacteria 3922
557 Ga0501068_0000910 3300049584 Bacteria 15453
558 Ga0501068_0079806 3300049584 Bacteria 2007
559 Ga0501068_0268462 3300049584 Bacteria 1089
560 Ga0501069_0008925 3300049585 Bacteria 5286
561 Ga0501069_0026213 3300049585 Bacteria 3192
562 Ga0501070_0001280 3300049586 Bacteria 22582
563 Ga0501070_0078679 3300049586 Bacteria 2728
564 Ga0501070_0150529 3300049586 Bacteria 1920
565 Ga0501070_0441395 3300049586 Bacteria 1050
566 Ga0501071_0009751 3300049587 Bacteria 6407
567 Ga0501071_0032431 3300049587 Bacteria 3709
568 Ga0501071_0042360 3300049587 Bacteria 3262
569 Ga0501071_0543306 3300049587 Bacteria 892
570 Ga0501072_0008261 3300049588 Bacteria 7908
571 Ga0501072_0016558 3300049588 Bacteria 5663
572 Ga0501073_0003796 3300049589 Bacteria 11355
573 Ga0501073_0007749 3300049589 Bacteria 7972
574 Ga0501074_0015585 3300049590 Bacteria 5524
575 Ga0501074_0036830 3300049590 Bacteria 3544
576 Ga0501075_0043194 3300049591 Bacteria 3380
577 Ga0501076_0013410 3300049592 Bacteria 6145
578 Ga0501076_0013836 3300049592 Bacteria 6056
579 Ga0501076_0021274 3300049592 Bacteria 4975
580 Ga0501076_0534007 3300049592 Bacteria 967
581 Ga0501077_0005005 3300049593 Bacteria 8035
582 Ga0501077_0037863 3300049593 Bacteria 3071
583 Ga0501077_0088916 3300049593 Bacteria 1958
584 Ga0501077_0091785 3300049593 Bacteria 1924
585 Ga0501080_0008481 3300049742 Bacteria 9314
586 Ga0501081_0008063 3300049743 Bacteria 6836
587 Ga0501081_0020598 3300049743 Bacteria 4395
588 Ga0501081_0381018 3300049743 Bacteria 1042
589 Ga0501081_0547884 3300049743 Bacteria 864
590 Ga0501081_0548602 3300049743 Unclassified 863
591 Ga0501083_0012763 3300049744 Bacteria 5875
592 Ga0501083_0087312 3300049744 Bacteria 2062
593 Ga0501083_0569675 3300049744 Bacteria 737
594 Ga0501035_0309251 3300049822 Bacteria 1330
595 Ga0501044_0020066 3300049823 Bacteria 7136
596 Ga0501044_0141694 3300049823 Bacteria 2392
597 Ga0501045_0010528 3300049824 Bacteria 6476
598 Ga0501045_0214904 3300049824 Bacteria 1432
599 Ga0501045_0272405 3300049824 Bacteria 1260
600 nmdc:mga03n38_37482_c1 3300050490 Bacteria 2091
601 nmdc:mga00v17_235458_c1 3300050491 Bacteria 1187
602 nmdc:mga0yw44_41270_c1 3300050492 Bacteria 1622
603 nmdc:mga07m45_240461_c1 3300050496 Bacteria 1053
604 nmdc:mga05p37_19361_c1 3300050507 Bacteria 8233
605 nmdc:mga05p37_19787_c1 3300050507 Bacteria 8143
606 nmdc:mga05p37_55699_c1 3300050507 Bacteria 4867
607 nmdc:mga0qj67_94156_c1 3300050509 Bacteria 2409
608 nmdc:mga06r32_500796_c1 3300050510 Bacteria 1192
609 nmdc:mga08y16_734401_c1 3300050511 Bacteria 984
610 nmdc:mga0n895_279587_c1 3300050512 Bacteria 1693
611 nmdc:mga0n895_454364_c1 3300050512 Bacteria 1293
612 nmdc:mga0rr50_42833_c1 3300050513 Bacteria 3309
613 nmdc:mga0rr50_7412_c1 3300050513 Bacteria 6765
614 nmdc:mga08x19_7111_c1 3300050514 Bacteria 6644
615 nmdc:mga08x19_842411_c1 3300050514 Unclassified 651
616 nmdc:mga08x19_98170_c1 3300050514 Bacteria 1940
617 nmdc:mga0a205_42204_c1 3300050515 Bacteria 4395
618 Ga0495601_0136022 3300053077 Bacteria 1602
619 Ga0495612_0000103 3300053078 Bacteria 36230
620 Ga0495612_0016370 3300053078 Bacteria 2972
621 Ga0495612_0076012 3300053078 Bacteria 1406
622 Ga0495595_0010720 3300053084 Bacteria 3818
623 Ga0495595_0014354 3300053084 Bacteria 3360
624 Ga0495619_0011725 3300053085 Bacteria 5523
625 Ga0495619_0084045 3300053085 Bacteria 2148
626 Ga0495619_0098198 3300053085 Bacteria 1991
627 Ga0501084_0098013 3300054114 Bacteria 2461
628 Ga0590077_020669 3300059426 Bacteria 1398
629 Ga0501082_0007829 3300060353 Bacteria 9223
630 Ga0501082_0118613 3300060353 Bacteria 2292
631 Ga0466962_0049330 3300061719 Bacteria 2012
632 Ga0466962_0077362 3300061719 Bacteria 1590
633 Ga0530510_0004994 3300061734 Bacteria 9161
634 Ga0530510_0145467 3300061734 Bacteria 1748
635 Ga0530510_0279685 3300061734 Bacteria 1246
636 Ga0530510_0436858 3300061734 Bacteria 989
637 Ga0530510_0494277 3300061734 Bacteria 927
638 Ga0530510_0712344 3300061734 Unclassified 765

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_454364_c1 nmdc:mga0n895_454364_c1_705_1277 143
2 3300050514 nmdc:mga08x19_842411_c1 nmdc:mga08x19_842411_c1_65_637 143
3 3300049744 Ga0501083_0569675 Ga0501083_0569675_31_621 144
4 3300013306 Ga0163162_10886361 Ga0163162_108863612 153
5 3300046531 Ga0495665_0080189 Ga0495665_0080189_28_540 154
6 3300048907 Ga0496104_0338389 Ga0496104_0338389_23_640 154
7 3300046680 Ga0495646_0125171 Ga0495646_0125171_815_1438 165
8 3300037068 Ga0373925_0346983 Ga0373925_0346983_488_1165 170
9 3300046455 Ga0495603_0007570 Ga0495603_0007570_563_1240 170
10 3300046461 Ga0495641_0134061 Ga0495641_0134061_425_1096 170
11 3300046517 Ga0495630_0262199 Ga0495630_0262199_594_1295 170
12 3300046642 Ga0495634_0029954 Ga0495634_0029954_2674_3351 170
13 3300046681 Ga0495647_0079646 Ga0495647_0079646_556_1233 170
14 3300046689 Ga0495613_0012677 Ga0495613_0012677_2537_3214 170
15 3300046689 Ga0495613_0332992 Ga0495613_0332992_222_923 170
16 3300053085 Ga0495619_0084045 Ga0495619_0084045_808_1509 170
17 3300050490 nmdc:mga03n38_37482_c1 nmdc:mga03n38_37482_c1_1096_1755 172
18 3300050491 nmdc:mga00v17_235458_c1 nmdc:mga00v17_235458_c1_36_695 172
19 3300050496 nmdc:mga07m45_240461_c1 nmdc:mga07m45_240461_c1_271_930 172
20 3300046681 Ga0495647_0033918 Ga0495647_0033918_1248_1859 173
21 3300006051 Ga0075364_10036616 Ga0075364_100366162 174
22 3300045049 Ga0466959_0710608 Ga0466959_0710608_42_653 176
23 3300046455 Ga0495603_0047885 Ga0495603_0047885_1543_2121 176
24 3300046473 Ga0495582_0092130 Ga0495582_0092130_156_734 176
25 3300046683 Ga0495658_0035435 Ga0495658_0035435_1472_2050 176
26 3300046689 Ga0495613_0205474 Ga0495613_0205474_702_1280 176
27 3300048912 Ga0496109_0298425 Ga0496109_0298425_17_625 176
28 3300049582 Ga0501048_0021652 Ga0501048_0021652_3282_3884 176
29 3300006852 Ga0075433_10432254 Ga0075433_104322542 178
30 3300006871 Ga0075434_100080236 Ga0075434_1000802363 178
31 3300009553 Ga0105249_10165729 Ga0105249_101657292 178
32 3300013296 Ga0157374_10782209 Ga0157374_107822091 178
33 3300014745 Ga0157377_10061972 Ga0157377_100619722 178
34 3300025927 Ga0207687_10435085 Ga0207687_104350851 178
35 3300048903 Ga0496100_0034935 Ga0496100_0034935_550_1227 178
36 3300048904 Ga0496101_0090734 Ga0496101_0090734_390_1067 178
37 3300048907 Ga0496104_0093699 Ga0496104_0093699_2000_2677 178
38 3300048911 Ga0496108_0141236 Ga0496108_0141236_1312_1989 178
39 3300048913 Ga0496110_0023147 Ga0496110_0023147_3764_4441 178
40 3300048914 Ga0496111_0033355 Ga0496111_0033355_2207_2884 178
41 3300044684 Ga0466966_0016985 Ga0466966_0016985_1855_2538 179
42 3300044693 Ga0466961_0004704 Ga0466961_0004704_2829_3512 179
43 3300044694 Ga0466963_0013255 Ga0466963_0013255_2190_2873 179
44 3300044719 Ga0466971_0005233 Ga0466971_0005233_348_1031 179
45 3300044842 Ga0466957_0177667 Ga0466957_0177667_354_1037 179
46 3300045049 Ga0466959_0018636 Ga0466959_0018636_1527_2210 179
47 3300061719 Ga0466962_0077362 Ga0466962_0077362_633_1316 179
48 3300009551 Ga0105238_10087200 Ga0105238_100872004 180
49 3300013104 Ga0157370_10011112 Ga0157370_100111129 180
50 3300025945 Ga0207679_10348869 Ga0207679_103488692 180
51 3300026142 Ga0207698_10191504 Ga0207698_101915043 180
52 3300044735 Ga0466968_0233436 Ga0466968_0233436_19_693 180
53 3300045049 Ga0466959_0053107 Ga0466959_0053107_1619_2302 180
54 3300044684 Ga0466966_0273347 Ga0466966_0273347_123_812 181
55 3300045976 Ga0466967_0361383 Ga0466967_0361383_397_1068 182
56 3300039437 Ga0436365_1758755 Ga0436365_1758755_1966_2592 184
57 3300039450 Ga0436363_0760459 Ga0436363_0760459_12414_13040 184
58 3300005458 Ga0070681_10224447 Ga0070681_102244472 185
59 3300005539 Ga0068853_100083654 Ga0068853_1000836543 185
60 3300013307 Ga0157372_10264823 Ga0157372_102648233 185
61 3300025918 Ga0207662_10113456 Ga0207662_101134563 185
62 3300025919 Ga0207657_10417656 Ga0207657_104176562 185
63 3300025945 Ga0207679_10056979 Ga0207679_100569794 185
64 3300037853 Ga0436364_0811094 Ga0436364_0811094_3083_3766 185
65 3300049574 Ga0501038_0432809 Ga0501038_0432809_137_850 188
66 3300049578 Ga0501042_0097932 Ga0501042_0097932_1100_1732 188
67 3300049587 Ga0501071_0543306 Ga0501071_0543306_124_837 188
68 3300049593 Ga0501077_0088916 Ga0501077_0088916_1102_1815 188
69 3300049743 Ga0501081_0547884 Ga0501081_0547884_133_846 188
70 3300061734 Ga0530510_0279685 Ga0530510_0279685_248_961 188
71 3300044656 Ga0466969_0029449 Ga0466969_0029449_1404_2078 189
72 3300044693 Ga0466961_0076742 Ga0466961_0076742_959_1633 189
73 3300044694 Ga0466963_0000104 Ga0466963_0000104_7355_8029 189
74 3300044765 Ga0466970_0014568 Ga0466970_0014568_432_1106 189
75 3300045049 Ga0466959_0012687 Ga0466959_0012687_4683_5357 189
76 3300045836 Ga0466958_0004120 Ga0466958_0004120_2273_2947 189
77 3300037466 Ga0395898_0000894 Ga0395898_0000894_7970_8662 192
78 3300046615 Ga0495656_0127186 Ga0495656_0127186_527_1153 192
79 3300049593 Ga0501077_0091785 Ga0501077_0091785_771_1451 196
80 3300049743 Ga0501081_0548602 Ga0501081_0548602_160_840 196
81 3300049824 Ga0501045_0214904 Ga0501045_0214904_403_1083 196
82 3300061734 Ga0530510_0712344 Ga0530510_0712344_10_690 196
83 3300006847 Ga0075431_100046842 Ga0075431_1000468426 197
84 3300032002 Ga0307416_100572323 Ga0307416_1005723232 197
85 3300039450 Ga0436363_0595893 Ga0436363_0595893_626_1309 197
86 3300005981 Ga0081538_10001726 Ga0081538_1000172614 198
87 3300031824 Ga0307413_10525810 Ga0307413_105258101 198
88 3300031852 Ga0307410_10488781 Ga0307410_104887812 198
89 3300031901 Ga0307406_10582182 Ga0307406_105821821 198
90 3300031995 Ga0307409_100331132 Ga0307409_1003311322 198
91 3300046477 Ga0495664_0000036 Ga0495664_0000036_58248_58934 198
92 3300046500 Ga0495596_0197542 Ga0495596_0197542_35_694 198
93 3300048907 Ga0496104_0000033 Ga0496104_0000033_159343_160029 198
94 3300048913 Ga0496110_0000046 Ga0496110_0000046_39447_40133 198
95 3300048914 Ga0496111_0002403 Ga0496111_0002403_4846_5532 198
96 3300006844 Ga0075428_100037894 Ga0075428_1000378946 199
97 3300006880 Ga0075429_100230296 Ga0075429_1002302961 199
98 3300009147 Ga0114129_10226877 Ga0114129_102268775 199
99 3300049592 Ga0501076_0534007 Ga0501076_0534007_73_774 199
100 3300050507 nmdc:mga05p37_19787_c1 nmdc:mga05p37_19787_c1_6375_7046 199
101 3300050509 nmdc:mga0qj67_94156_c1 nmdc:mga0qj67_94156_c1_1469_2140 199
102 3300050511 nmdc:mga08y16_734401_c1 nmdc:mga08y16_734401_c1_284_955 199
103 3300005329 Ga0070683_100427051 Ga0070683_1004270512 200
104 3300005336 Ga0070680_100002327 Ga0070680_10000232711 200
105 3300005344 Ga0070661_100008448 Ga0070661_1000084484 200
106 3300005366 Ga0070659_100073669 Ga0070659_1000736693 200
107 3300005435 Ga0070714_100374846 Ga0070714_1003748462 200
108 3300005436 Ga0070713_100019157 Ga0070713_1000191573 200
109 3300005439 Ga0070711_100434604 Ga0070711_1004346042 200
110 3300005539 Ga0068853_100519898 Ga0068853_1005198982 200
111 3300005616 Ga0068852_100502267 Ga0068852_1005022672 200
112 3300006173 Ga0070716_100090231 Ga0070716_1000902312 200
113 3300006844 Ga0075428_100314695 Ga0075428_1003146952 200
114 3300010375 Ga0105239_11206251 Ga0105239_112062511 200
115 3300013105 Ga0157369_10166132 Ga0157369_101661324 200
116 3300020081 Ga0206354_11348025 Ga0206354_113480251 200
117 3300020082 Ga0206353_10596252 Ga0206353_105962526 200
118 3300021384 Ga0213876_10150506 Ga0213876_101505061 200
119 3300025909 Ga0207705_10217250 Ga0207705_102172503 200
120 3300025912 Ga0207707_10135132 Ga0207707_101351322 200
121 3300025915 Ga0207693_10212928 Ga0207693_102129282 200
122 3300025916 Ga0207663_10107181 Ga0207663_101071812 200
123 3300025917 Ga0207660_10298995 Ga0207660_102989952 200
124 3300025919 Ga0207657_10049707 Ga0207657_100497073 200
125 3300025921 Ga0207652_10142052 Ga0207652_101420523 200
126 3300025928 Ga0207700_10017046 Ga0207700_100170465 200
127 3300025932 Ga0207690_10060649 Ga0207690_100606492 200
128 3300026041 Ga0207639_10209385 Ga0207639_102093851 200
129 3300026078 Ga0207702_10198515 Ga0207702_101985153 200
130 3300028556 Ga0265337_1005371 Ga0265337_10053714 200
131 3300028558 Ga0265326_10000282 Ga0265326_1000028213 200
132 3300028563 Ga0265319_1000065 Ga0265319_100006560 200
133 3300028577 Ga0265318_10008234 Ga0265318_100082345 200
134 3300028654 Ga0265322_10006583 Ga0265322_100065833 200
135 3300028666 Ga0265336_10000001 Ga0265336_10000001377 200
136 3300028800 Ga0265338_10000004 Ga0265338_10000004505 200
137 3300031240 Ga0265320_10156864 Ga0265320_101568642 200
138 3300031247 Ga0265340_10000002 Ga0265340_10000002505 200
139 3300031824 Ga0307413_10056524 Ga0307413_100565242 200
140 3300031901 Ga0307406_10259615 Ga0307406_102596152 200
141 3300031903 Ga0307407_10187715 Ga0307407_101877152 200
142 3300031911 Ga0307412_10719590 Ga0307412_107195901 200
143 3300032126 Ga0307415_100010737 Ga0307415_1000107376 200
144 3300032126 Ga0307415_100058533 Ga0307415_1000585332 200
145 3300037068 Ga0373925_0280645 Ga0373925_0280645_299_991 200
146 3300037418 Ga0395900_0094185 Ga0395900_0094185_2130_2795 200
147 3300037418 Ga0395900_0151152 Ga0395900_0151152_33_686 200
148 3300037471 Ga0395905_0027590 Ga0395905_0027590_4639_5304 200
149 3300038443 Ga0395901_0133342 Ga0395901_0133342_245_910 200
150 3300038443 Ga0395901_0523142 Ga0395901_0523142_60_728 200
151 3300039437 Ga0436365_1906563 Ga0436365_1906563_68_754 200
152 3300044694 Ga0466963_0408613 Ga0466963_0408613_236_901 200
153 3300045976 Ga0466967_0007977 Ga0466967_0007977_1720_2385 200
154 3300045976 Ga0466967_0080963 Ga0466967_0080963_1539_2207 200
155 3300045976 Ga0466967_0661002 Ga0466967_0661002_204_896 200
156 3300046472 Ga0495580_0456348 Ga0495580_0456348_132_824 200
157 3300046514 Ga0495618_0000875 Ga0495618_0000875_1149_1865 200
158 3300046526 Ga0495666_0231874 Ga0495666_0231874_74_766 200
159 3300047321 Ga0495676_0071399 Ga0495676_0071399_1115_1807 200
160 3300048903 Ga0496100_0334780 Ga0496100_0334780_105_758 200
161 3300049568 Ga0501031_0018002 Ga0501031_0018002_2607_3272 200
162 3300049568 Ga0501031_0107433 Ga0501031_0107433_1136_1804 200
163 3300049569 Ga0501032_0006397 Ga0501032_0006397_2351_3016 200
164 3300049570 Ga0501033_0041858 Ga0501033_0041858_403_1068 200
165 3300049571 Ga0501034_0116761 Ga0501034_0116761_1220_1885 200
166 3300049572 Ga0501036_0040505 Ga0501036_0040505_1635_2300 200
167 3300049573 Ga0501037_0063847 Ga0501037_0063847_786_1451 200
168 3300049574 Ga0501038_0015020 Ga0501038_0015020_4212_4877 200
169 3300049575 Ga0501039_0048377 Ga0501039_0048377_1225_1890 200
170 3300049578 Ga0501042_0072657 Ga0501042_0072657_1452_2117 200
171 3300049579 Ga0501043_0066021 Ga0501043_0066021_772_1437 200
172 3300049580 Ga0501046_0012939 Ga0501046_0012939_2017_2682 200
173 3300049581 Ga0501047_0062404 Ga0501047_0062404_1710_2375 200
174 3300049582 Ga0501048_0046928 Ga0501048_0046928_1422_2087 200
175 3300049583 Ga0501067_0017910 Ga0501067_0017910_1465_2130 200
176 3300049584 Ga0501068_0268462 Ga0501068_0268462_163_828 200
177 3300049585 Ga0501069_0026213 Ga0501069_0026213_1449_2114 200
178 3300049586 Ga0501070_0078679 Ga0501070_0078679_517_1182 200
179 3300049589 Ga0501073_0003796 Ga0501073_0003796_5998_6663 200
180 3300049590 Ga0501074_0036830 Ga0501074_0036830_1426_2091 200
181 3300049744 Ga0501083_0087312 Ga0501083_0087312_1358_2023 200
182 3300049823 Ga0501044_0141694 Ga0501044_0141694_222_887 200
183 3300053078 Ga0495612_0000103 Ga0495612_0000103_1289_2017 200
184 3300053085 Ga0495619_0098198 Ga0495619_0098198_74_766 200
185 3300060353 Ga0501082_0007829 Ga0501082_0007829_1430_2095 200
186 3300005327 Ga0070658_10202883 Ga0070658_102028832 201
187 3300005327 Ga0070658_10290290 Ga0070658_102902902 201
188 3300005329 Ga0070683_100012762 Ga0070683_1000127627 201
189 3300005336 Ga0070680_100148678 Ga0070680_1001486781 201
190 3300005339 Ga0070660_100007570 Ga0070660_1000075709 201
191 3300005339 Ga0070660_100096113 Ga0070660_1000961133 201
192 3300005366 Ga0070659_100258754 Ga0070659_1002587542 201
193 3300005435 Ga0070714_100018537 Ga0070714_1000185374 201
194 3300005435 Ga0070714_100402748 Ga0070714_1004027482 201
195 3300005441 Ga0070700_100165268 Ga0070700_1001652682 201
196 3300005458 Ga0070681_10035917 Ga0070681_100359176 201
197 3300005458 Ga0070681_10360229 Ga0070681_103602292 201
198 3300005458 Ga0070681_10505456 Ga0070681_105054561 201
199 3300005518 Ga0070699_100572458 Ga0070699_1005724582 201
200 3300005530 Ga0070679_100026448 Ga0070679_1000264486 201
201 3300005530 Ga0070679_100124608 Ga0070679_1001246083 201
202 3300005535 Ga0070684_100174751 Ga0070684_1001747512 201
203 3300005535 Ga0070684_100227481 Ga0070684_1002274812 201
204 3300005616 Ga0068852_100185740 Ga0068852_1001857403 201
205 3300005981 Ga0081538_10005377 Ga0081538_100053774 201
206 3300006852 Ga0075433_10094751 Ga0075433_100947513 201
207 3300006871 Ga0075434_100130145 Ga0075434_1001301454 201
208 3300006914 Ga0075436_100013781 Ga0075436_1000137815 201
209 3300007076 Ga0075435_100060567 Ga0075435_1000605672 201
210 3300007076 Ga0075435_100124926 Ga0075435_1001249264 201
211 3300009147 Ga0114129_10096414 Ga0114129_100964144 201
212 3300009551 Ga0105238_10562093 Ga0105238_105620931 201
213 3300013104 Ga0157370_10133223 Ga0157370_101332233 201
214 3300013307 Ga0157372_10198145 Ga0157372_101981452 201
215 3300014497 Ga0182008_10223456 Ga0182008_102234561 201
216 3300020082 Ga0206353_10863355 Ga0206353_108633553 201
217 3300020082 Ga0206353_11434632 Ga0206353_114346322 201
218 3300025912 Ga0207707_10157467 Ga0207707_101574672 201
219 3300025912 Ga0207707_10294270 Ga0207707_102942701 201
220 3300025912 Ga0207707_10338547 Ga0207707_103385472 201
221 3300025917 Ga0207660_10041075 Ga0207660_100410753 201
222 3300025919 Ga0207657_10012783 Ga0207657_100127839 201
223 3300025919 Ga0207657_10017863 Ga0207657_100178638 201
224 3300025921 Ga0207652_10023986 Ga0207652_100239864 201
225 3300025921 Ga0207652_10098505 Ga0207652_100985053 201
226 3300025924 Ga0207694_10414532 Ga0207694_104145321 201
227 3300025929 Ga0207664_10050177 Ga0207664_100501772 201
228 3300025929 Ga0207664_10313078 Ga0207664_103130783 201
229 3300025932 Ga0207690_10287668 Ga0207690_102876682 201
230 3300025939 Ga0207665_10583332 Ga0207665_105833322 201
231 3300025939 Ga0207665_10841294 Ga0207665_108412941 201
232 3300025944 Ga0207661_10022852 Ga0207661_100228522 201
233 3300025949 Ga0207667_10267732 Ga0207667_102677321 201
234 3300025981 Ga0207640_10736552 Ga0207640_107365521 201
235 3300026075 Ga0207708_10035685 Ga0207708_100356852 201
236 3300026142 Ga0207698_10631754 Ga0207698_106317542 201
237 3300028800 Ga0265338_10030889 Ga0265338_100308897 201
238 3300031239 Ga0265328_10115089 Ga0265328_101150892 201
239 3300031251 Ga0265327_10030508 Ga0265327_100305082 201
240 3300031712 Ga0265342_10251476 Ga0265342_102514761 201
241 3300035724 Ga0373933_0376801 Ga0373933_0376801_229_897 201
242 3300036401 Ga0373937_0153973 Ga0373937_0153973_1210_1878 201
243 3300037312 Ga0395899_0084568 Ga0395899_0084568_34_690 201
244 3300037418 Ga0395900_0004135 Ga0395900_0004135_1420_2079 201
245 3300037418 Ga0395900_0026510 Ga0395900_0026510_1321_1977 201
246 3300037418 Ga0395900_0065982 Ga0395900_0065982_2959_3615 201
247 3300037466 Ga0395898_0006669 Ga0395898_0006669_2471_3127 201
248 3300037466 Ga0395898_0050565 Ga0395898_0050565_540_1196 201
249 3300037471 Ga0395905_0040789 Ga0395905_0040789_2981_3637 201
250 3300037471 Ga0395905_0237994 Ga0395905_0237994_654_1313 201
251 3300038443 Ga0395901_0003054 Ga0395901_0003054_6643_7299 201
252 3300038443 Ga0395901_0020589 Ga0395901_0020589_4727_5386 201
253 3300038443 Ga0395901_0476002 Ga0395901_0476002_509_1165 201
254 3300044693 Ga0466961_0387963 Ga0466961_0387963_139_816 201
255 3300045049 Ga0466959_0079682 Ga0466959_0079682_1412_2089 201
256 3300045836 Ga0466958_0240136 Ga0466958_0240136_443_1126 201
257 3300045976 Ga0466967_0222003 Ga0466967_0222003_965_1633 201
258 3300046454 Ga0495592_0346917 Ga0495592_0346917_172_840 201
259 3300046463 Ga0495653_0028675 Ga0495653_0028675_12_680 201
260 3300046463 Ga0495653_0132989 Ga0495653_0132989_438_1106 201
261 3300046511 Ga0495608_0191266 Ga0495608_0191266_131_799 201
262 3300046517 Ga0495630_0403544 Ga0495630_0403544_338_1006 201
263 3300046559 Ga0495667_0159055 Ga0495667_0159055_722_1390 201
264 3300046642 Ga0495634_0023315 Ga0495634_0023315_1469_2137 201
265 3300046663 Ga0495635_0083822 Ga0495635_0083822_486_1154 201
266 3300046675 Ga0495657_0183327 Ga0495657_0183327_314_982 201
267 3300046809 Ga0495600_0125680 Ga0495600_0125680_131_799 201
268 3300047322 Ga0495680_0009812 Ga0495680_0009812_481_1149 201
269 3300047471 Ga0495684_0015619 Ga0495684_0015619_1998_2666 201
270 3300047471 Ga0495684_0057504 Ga0495684_0057504_2262_2930 201
271 3300048904 Ga0496101_0403433 Ga0496101_0403433_121_792 201
272 3300048905 Ga0496102_0152077 Ga0496102_0152077_377_1045 201
273 3300048909 Ga0496106_0049891 Ga0496106_0049891_676_1344 201
274 3300048910 Ga0496107_0007930 Ga0496107_0007930_628_1296 201
275 3300048912 Ga0496109_0035786 Ga0496109_0035786_2140_2808 201
276 3300048912 Ga0496109_0473793 Ga0496109_0473793_81_749 201
277 3300048914 Ga0496111_0036337 Ga0496111_0036337_2565_3233 201
278 3300048915 Ga0496112_0002347 Ga0496112_0002347_314_982 201
279 3300048915 Ga0496112_0144060 Ga0496112_0144060_1144_1812 201
280 3300048915 Ga0496112_0369705 Ga0496112_0369705_169_837 201
281 3300048916 Ga0496113_0093058 Ga0496113_0093058_453_1121 201
282 3300048922 Ga0496119_0078970 Ga0496119_0078970_1128_1805 201
283 3300050507 nmdc:mga05p37_55699_c1 nmdc:mga05p37_55699_c1_3183_3839 201
284 3300050510 nmdc:mga06r32_500796_c1 nmdc:mga06r32_500796_c1_273_956 201
285 3300050512 nmdc:mga0n895_279587_c1 nmdc:mga0n895_279587_c1_311_994 201
286 3300050513 nmdc:mga0rr50_42833_c1 nmdc:mga0rr50_42833_c1_2296_2979 201
287 3300050513 nmdc:mga0rr50_7412_c1 nmdc:mga0rr50_7412_c1_1769_2425 201
288 3300050514 nmdc:mga08x19_7111_c1 nmdc:mga08x19_7111_c1_1217_1873 201
289 3300050514 nmdc:mga08x19_98170_c1 nmdc:mga08x19_98170_c1_997_1680 201
290 3300050515 nmdc:mga0a205_42204_c1 nmdc:mga0a205_42204_c1_3075_3731 201
291 3300053084 Ga0495595_0014354 Ga0495595_0014354_396_1064 201
292 3300005366 Ga0070659_100016250 Ga0070659_1000162505 202
293 3300005435 Ga0070714_100056593 Ga0070714_1000565934 202
294 3300005436 Ga0070713_100031459 Ga0070713_1000314594 202
295 3300005536 Ga0070697_100658005 Ga0070697_1006580051 202
296 3300006028 Ga0070717_10047485 Ga0070717_100474855 202
297 3300009147 Ga0114129_10006658 Ga0114129_100066589 202
298 3300013296 Ga0157374_10012163 Ga0157374_100121631 202
299 3300025915 Ga0207693_10210332 Ga0207693_102103322 202
300 3300025927 Ga0207687_10438226 Ga0207687_104382262 202
301 3300025928 Ga0207700_10035952 Ga0207700_100359524 202
302 3300025929 Ga0207664_10028937 Ga0207664_100289374 202
303 3300025929 Ga0207664_10050634 Ga0207664_100506344 202
304 3300026067 Ga0207678_10055213 Ga0207678_100552133 202
305 3300026078 Ga0207702_10471384 Ga0207702_104713841 202
306 3300037312 Ga0395899_0214702 Ga0395899_0214702_554_1225 202
307 3300037418 Ga0395900_0034090 Ga0395900_0034090_4537_5208 202
308 3300037418 Ga0395900_0053454 Ga0395900_0053454_2070_2750 202
309 3300037466 Ga0395898_0021885 Ga0395898_0021885_1067_1738 202
310 3300037471 Ga0395905_0017576 Ga0395905_0017576_555_1226 202
311 3300038443 Ga0395901_0011629 Ga0395901_0011629_1426_2097 202
312 3300038443 Ga0395901_0630799 Ga0395901_0630799_59_811 202
313 3300038996 Ga0242420_059665 Ga0242420_059665_42_722 202
314 3300046499 Ga0495594_0268053 Ga0495594_0268053_66_746 202
315 3300048904 Ga0496101_0071832 Ga0496101_0071832_593_1252 202
316 3300048907 Ga0496104_0007061 Ga0496104_0007061_4516_5175 202
317 3300048907 Ga0496104_1040083 Ga0496104_1040083_48_707 202
318 3300048908 Ga0496105_0015422 Ga0496105_0015422_4906_5565 202
319 3300048910 Ga0496107_0070849 Ga0496107_0070849_163_822 202
320 3300048911 Ga0496108_0006408 Ga0496108_0006408_3835_4494 202
321 3300048912 Ga0496109_0000119 Ga0496109_0000119_50989_51648 202
322 3300048913 Ga0496110_0010360 Ga0496110_0010360_3121_3780 202
323 3300048914 Ga0496111_0002592 Ga0496111_0002592_3861_4520 202
324 3300048915 Ga0496112_0005144 Ga0496112_0005144_6726_7385 202
325 3300048916 Ga0496113_0002780 Ga0496113_0002780_6640_7299 202
326 3300048917 Ga0496114_0013504 Ga0496114_0013504_3866_4525 202
327 3300049573 Ga0501037_0612052 Ga0501037_0612052_30_710 202
328 3300049576 Ga0501040_0347425 Ga0501040_0347425_79_759 202
329 3300050492 nmdc:mga0yw44_41270_c1 nmdc:mga0yw44_41270_c1_63_734 202
330 3300050507 nmdc:mga05p37_19361_c1 nmdc:mga05p37_19361_c1_7143_7802 202
331 3300059426 Ga0590077_020669 Ga0590077_020669_484_1164 202
332 3300061734 Ga0530510_0436858 Ga0530510_0436858_45_728 202
333 3300002077 JGI24744J21845_10010674 JGI24744J21845_100106741 203
334 3300005330 Ga0070690_100018738 Ga0070690_1000187385 203
335 3300005334 Ga0068869_100165812 Ga0068869_1001658121 203
336 3300005337 Ga0070682_100029770 Ga0070682_1000297705 203
337 3300005338 Ga0068868_100093729 Ga0068868_1000937293 203
338 3300005338 Ga0068868_100274750 Ga0068868_1002747502 203
339 3300005343 Ga0070687_100008486 Ga0070687_1000084865 203
340 3300005343 Ga0070687_100198201 Ga0070687_1001982011 203
341 3300005345 Ga0070692_10407171 Ga0070692_104071711 203
342 3300005347 Ga0070668_100184506 Ga0070668_1001845063 203
343 3300005347 Ga0070668_100460714 Ga0070668_1004607141 203
344 3300005353 Ga0070669_100700385 Ga0070669_1007003851 203
345 3300005355 Ga0070671_100031215 Ga0070671_1000312153 203
346 3300005356 Ga0070674_100015392 Ga0070674_1000153925 203
347 3300005365 Ga0070688_100248507 Ga0070688_1002485072 203
348 3300005366 Ga0070659_100107801 Ga0070659_1001078013 203
349 3300005435 Ga0070714_100160037 Ga0070714_1001600372 203
350 3300005435 Ga0070714_100550348 Ga0070714_1005503482 203
351 3300005436 Ga0070713_100264978 Ga0070713_1002649783 203
352 3300005437 Ga0070710_10006000 Ga0070710_100060005 203
353 3300005438 Ga0070701_10001596 Ga0070701_100015966 203
354 3300005441 Ga0070700_100017943 Ga0070700_1000179435 203
355 3300005444 Ga0070694_100078469 Ga0070694_1000784692 203
356 3300005445 Ga0070708_100882887 Ga0070708_1008828871 203
357 3300005457 Ga0070662_100057740 Ga0070662_1000577402 203
358 3300005459 Ga0068867_100001986 Ga0068867_10000198611 203
359 3300005466 Ga0070685_10019049 Ga0070685_100190494 203
360 3300005539 Ga0068853_100565856 Ga0068853_1005658561 203
361 3300005544 Ga0070686_100001306 Ga0070686_1000013067 203
362 3300005546 Ga0070696_100012789 Ga0070696_1000127894 203
363 3300005547 Ga0070693_100114253 Ga0070693_1001142531 203
364 3300005548 Ga0070665_100538555 Ga0070665_1005385553 203
365 3300005549 Ga0070704_100032451 Ga0070704_1000324512 203
366 3300005578 Ga0068854_100045259 Ga0068854_1000452592 203
367 3300005614 Ga0068856_100925053 Ga0068856_1009250532 203
368 3300005615 Ga0070702_100086353 Ga0070702_1000863532 203
369 3300005617 Ga0068859_100425366 Ga0068859_1004253661 203
370 3300005718 Ga0068866_10020230 Ga0068866_100202303 203
371 3300005718 Ga0068866_10069515 Ga0068866_100695154 203
372 3300005719 Ga0068861_100018009 Ga0068861_1000180093 203
373 3300005719 Ga0068861_100067605 Ga0068861_1000676054 203
374 3300005842 Ga0068858_100180928 Ga0068858_1001809282 203
375 3300005844 Ga0068862_100252829 Ga0068862_1002528292 203
376 3300005981 Ga0081538_10015590 Ga0081538_100155902 203
377 3300005985 Ga0081539_10101701 Ga0081539_101017012 203
378 3300006028 Ga0070717_10014762 Ga0070717_100147623 203
379 3300006028 Ga0070717_10024989 Ga0070717_100249896 203
380 3300006028 Ga0070717_10465501 Ga0070717_104655012 203
381 3300006028 Ga0070717_10671871 Ga0070717_106718711 203
382 3300006175 Ga0070712_100018561 Ga0070712_1000185614 203
383 3300006175 Ga0070712_100113399 Ga0070712_1001133992 203
384 3300006358 Ga0068871_100044002 Ga0068871_1000440023 203
385 3300006881 Ga0068865_100015718 Ga0068865_1000157183 203
386 3300006881 Ga0068865_100051365 Ga0068865_1000513654 203
387 3300006931 Ga0097620_100425357 Ga0097620_1004253571 203
388 3300009098 Ga0105245_10072800 Ga0105245_100728002 203
389 3300009098 Ga0105245_10105095 Ga0105245_101050952 203
390 3300009148 Ga0105243_10041003 Ga0105243_100410031 203
391 3300009148 Ga0105243_10206287 Ga0105243_102062873 203
392 3300009148 Ga0105243_10539662 Ga0105243_105396621 203
393 3300009176 Ga0105242_10058370 Ga0105242_100583703 203
394 3300009176 Ga0105242_10068762 Ga0105242_100687623 203
395 3300009177 Ga0105248_10048411 Ga0105248_100484113 203
396 3300009551 Ga0105238_10275056 Ga0105238_102750561 203
397 3300009553 Ga0105249_10010542 Ga0105249_100105427 203
398 3300009553 Ga0105249_10033962 Ga0105249_100339622 203
399 3300010375 Ga0105239_10002157 Ga0105239_100021571 203
400 3300010375 Ga0105239_10250605 Ga0105239_102506052 203
401 3300013297 Ga0157378_10037430 Ga0157378_100374303 203
402 3300013306 Ga0163162_10001769 Ga0163162_1000176910 203
403 3300013307 Ga0157372_11309152 Ga0157372_113091521 203
404 3300014326 Ga0157380_10017229 Ga0157380_100172295 203
405 3300014326 Ga0157380_10036935 Ga0157380_100369352 203
406 3300014969 Ga0157376_10046520 Ga0157376_100465203 203
407 3300017792 Ga0163161_10207025 Ga0163161_102070251 203
408 3300021377 Ga0213874_10000005 Ga0213874_1000000515 203
409 3300021377 Ga0213874_10048479 Ga0213874_100484792 203
410 3300021377 Ga0213874_10085101 Ga0213874_100851012 203
411 3300021384 Ga0213876_10006232 Ga0213876_100062323 203
412 3300021384 Ga0213876_10016494 Ga0213876_100164944 203
413 3300021384 Ga0213876_10059078 Ga0213876_100590782 203
414 3300021384 Ga0213876_10101855 Ga0213876_101018552 203
415 3300021384 Ga0213876_10147870 Ga0213876_101478702 203
416 3300021388 Ga0213875_10006473 Ga0213875_100064736 203
417 3300021388 Ga0213875_10009519 Ga0213875_100095194 203
418 3300021388 Ga0213875_10016639 Ga0213875_100166395 203
419 3300021388 Ga0213875_10083886 Ga0213875_100838862 203
420 3300025898 Ga0207692_10145259 Ga0207692_101452591 203
421 3300025899 Ga0207642_10012082 Ga0207642_100120823 203
422 3300025906 Ga0207699_10027001 Ga0207699_100270012 203
423 3300025915 Ga0207693_10002345 Ga0207693_1000234511 203
424 3300025915 Ga0207693_10046637 Ga0207693_100466375 203
425 3300025916 Ga0207663_10015163 Ga0207663_100151633 203
426 3300025916 Ga0207663_10090167 Ga0207663_100901674 203
427 3300025917 Ga0207660_10154969 Ga0207660_101549691 203
428 3300025919 Ga0207657_10018530 Ga0207657_100185303 203
429 3300025924 Ga0207694_10614443 Ga0207694_106144431 203
430 3300025927 Ga0207687_10700241 Ga0207687_107002411 203
431 3300025928 Ga0207700_10091210 Ga0207700_100912102 203
432 3300025929 Ga0207664_10001411 Ga0207664_100014119 203
433 3300025931 Ga0207644_10047535 Ga0207644_100475355 203
434 3300025934 Ga0207686_10039731 Ga0207686_100397315 203
435 3300025934 Ga0207686_10145429 Ga0207686_101454291 203
436 3300025935 Ga0207709_10062717 Ga0207709_100627173 203
437 3300025937 Ga0207669_10025080 Ga0207669_100250803 203
438 3300025938 Ga0207704_10015400 Ga0207704_100154004 203
439 3300025938 Ga0207704_10613006 Ga0207704_106130061 203
440 3300025940 Ga0207691_10171852 Ga0207691_101718524 203
441 3300025940 Ga0207691_10486579 Ga0207691_104865791 203
442 3300025942 Ga0207689_10834376 Ga0207689_108343761 203
443 3300025945 Ga0207679_10688867 Ga0207679_106888671 203
444 3300025949 Ga0207667_10512455 Ga0207667_105124552 203
445 3300025961 Ga0207712_10152968 Ga0207712_101529681 203
446 3300025972 Ga0207668_10103327 Ga0207668_101033272 203
447 3300025972 Ga0207668_10187024 Ga0207668_101870242 203
448 3300025986 Ga0207658_10165780 Ga0207658_101657803 203
449 3300026023 Ga0207677_10338979 Ga0207677_103389791 203
450 3300026041 Ga0207639_10436749 Ga0207639_104367492 203
451 3300026075 Ga0207708_10018961 Ga0207708_100189615 203
452 3300026089 Ga0207648_10000947 Ga0207648_100009478 203
453 3300026095 Ga0207676_10346929 Ga0207676_103469293 203
454 3300026118 Ga0207675_100034760 Ga0207675_1000347602 203
455 3300026118 Ga0207675_100038595 Ga0207675_1000385955 203
456 3300026121 Ga0207683_10005535 Ga0207683_1000553512 203
457 3300026121 Ga0207683_10331012 Ga0207683_103310122 203
458 3300028380 Ga0268265_10047046 Ga0268265_100470461 203
459 3300028800 Ga0265338_10195970 Ga0265338_101959702 203
460 3300035410 Ga0373924_0055216 Ga0373924_0055216_180_869 203
461 3300035724 Ga0373933_0023248 Ga0373933_0023248_1931_2620 203
462 3300037853 Ga0436364_0159150 Ga0436364_0159150_5797_6480 203
463 3300037853 Ga0436364_0159207 Ga0436364_0159207_14776_15459 203
464 3300037853 Ga0436364_0263937 Ga0436364_0263937_57_785 203
465 3300037853 Ga0436364_0334646 Ga0436364_0334646_3839_4522 203
466 3300037853 Ga0436364_0418406 Ga0436364_0418406_2884_3573 203
467 3300037853 Ga0436364_0424870 Ga0436364_0424870_128_811 203
468 3300037853 Ga0436364_0793605 Ga0436364_0793605_1465_2148 203
469 3300037853 Ga0436364_1339551 Ga0436364_1339551_5701_6384 203
470 3300037853 Ga0436364_1346518 Ga0436364_1346518_3133_3816 203
471 3300039437 Ga0436365_0004038 Ga0436365_0004038_6779_7462 203
472 3300039437 Ga0436365_0168949 Ga0436365_0168949_2643_3326 203
473 3300039437 Ga0436365_0186047 Ga0436365_0186047_747_1430 203
474 3300039437 Ga0436365_0896130 Ga0436365_0896130_3873_4556 203
475 3300039437 Ga0436365_1001279 Ga0436365_1001279_20619_21302 203
476 3300039437 Ga0436365_1282173 Ga0436365_1282173_2432_3115 203
477 3300039437 Ga0436365_1315914 Ga0436365_1315914_1260_1949 203
478 3300039437 Ga0436365_1510673 Ga0436365_1510673_387_1070 203
479 3300039437 Ga0436365_1790130 Ga0436365_1790130_4561_5250 203
480 3300039437 Ga0436365_1809914 Ga0436365_1809914_1048_1737 203
481 3300039437 Ga0436365_1843863 Ga0436365_1843863_608_1291 203
482 3300039438 Ga0436360_0896315 Ga0436360_0896315_340_1023 203
483 3300039450 Ga0436363_0212212 Ga0436363_0212212_401_1084 203
484 3300039450 Ga0436363_0843533 Ga0436363_0843533_3465_4148 203
485 3300039450 Ga0436363_0896388 Ga0436363_0896388_523_1206 203
486 3300039450 Ga0436363_0985997 Ga0436363_0985997_171_854 203
487 3300039450 Ga0436363_1078326 Ga0436363_1078326_1011_1694 203
488 3300039450 Ga0436363_1691717 Ga0436363_1691717_1162_1845 203
489 3300039453 Ga0436362_0325995 Ga0436362_0325995_64_747 203
490 3300039453 Ga0436362_0993185 Ga0436362_0993185_59_748 203
491 3300044656 Ga0466969_0017968 Ga0466969_0017968_782_1474 203
492 3300044656 Ga0466969_0026626 Ga0466969_0026626_1242_1925 203
493 3300044656 Ga0466969_0183497 Ga0466969_0183497_83_766 203
494 3300044683 Ga0466965_0026614 Ga0466965_0026614_10_693 203
495 3300044683 Ga0466965_0081916 Ga0466965_0081916_171_854 203
496 3300044684 Ga0466966_0031037 Ga0466966_0031037_702_1394 203
497 3300044684 Ga0466966_0195381 Ga0466966_0195381_279_962 203
498 3300044693 Ga0466961_0078710 Ga0466961_0078710_1223_1921 203
499 3300044693 Ga0466961_0081110 Ga0466961_0081110_803_1486 203
500 3300044693 Ga0466961_0095342 Ga0466961_0095342_637_1329 203
501 3300044694 Ga0466963_0007807 Ga0466963_0007807_2761_3444 203
502 3300044694 Ga0466963_0050761 Ga0466963_0050761_1104_1802 203
503 3300044694 Ga0466963_0118470 Ga0466963_0118470_20_703 203
504 3300044694 Ga0466963_0170911 Ga0466963_0170911_459_1142 203
505 3300044719 Ga0466971_0023271 Ga0466971_0023271_510_1265 203
506 3300044719 Ga0466971_0028325 Ga0466971_0028325_1229_1927 203
507 3300044735 Ga0466968_0033615 Ga0466968_0033615_721_1404 203
508 3300044765 Ga0466970_0033730 Ga0466970_0033730_453_1136 203
509 3300044842 Ga0466957_0001380 Ga0466957_0001380_11659_12342 203
510 3300044842 Ga0466957_0005549 Ga0466957_0005549_2518_3273 203
511 3300044842 Ga0466957_0034550 Ga0466957_0034550_810_1508 203
512 3300044842 Ga0466957_0242061 Ga0466957_0242061_96_779 203
513 3300044901 Ga0466960_0005487 Ga0466960_0005487_51_743 203
514 3300045049 Ga0466959_0009139 Ga0466959_0009139_2950_3633 203
515 3300045049 Ga0466959_0062978 Ga0466959_0062978_748_1431 203
516 3300045049 Ga0466959_0110111 Ga0466959_0110111_777_1460 203
517 3300045049 Ga0466959_0132945 Ga0466959_0132945_285_968 203
518 3300045049 Ga0466959_0150528 Ga0466959_0150528_133_825 203
519 3300045836 Ga0466958_0000233 Ga0466958_0000233_2472_3155 203
520 3300045836 Ga0466958_0001574 Ga0466958_0001574_8358_9041 203
521 3300045836 Ga0466958_0021100 Ga0466958_0021100_3061_3759 203
522 3300045836 Ga0466958_0023271 Ga0466958_0023271_2243_2998 203
523 3300045836 Ga0466958_0039365 Ga0466958_0039365_595_1293 203
524 3300045836 Ga0466958_0041198 Ga0466958_0041198_1841_2524 203
525 3300045836 Ga0466958_0060810 Ga0466958_0060810_275_958 203
526 3300045836 Ga0466958_0069955 Ga0466958_0069955_1195_1878 203
527 3300045836 Ga0466958_0224159 Ga0466958_0224159_287_970 203
528 3300045976 Ga0466967_0008602 Ga0466967_0008602_1470_2153 203
529 3300045976 Ga0466967_0211681 Ga0466967_0211681_819_1517 203
530 3300045976 Ga0466967_0396298 Ga0466967_0396298_450_1133 203
531 3300045976 Ga0466967_0398970 Ga0466967_0398970_571_1254 203
532 3300045976 Ga0466967_0830978 Ga0466967_0830978_79_771 203
533 3300046454 Ga0495592_0076660 Ga0495592_0076660_952_1641 203
534 3300046462 Ga0495651_0006559 Ga0495651_0006559_6715_7404 203
535 3300046471 Ga0495650_0000053 Ga0495650_0000053_287803_288489 203
536 3300046491 Ga0495584_0076277 Ga0495584_0076277_650_1312 203
537 3300046511 Ga0495608_0057911 Ga0495608_0057911_605_1294 203
538 3300046514 Ga0495618_0009790 Ga0495618_0009790_2581_3270 203
539 3300046516 Ga0495628_0036020 Ga0495628_0036020_2451_3140 203
540 3300046517 Ga0495630_0180663 Ga0495630_0180663_739_1422 203
541 3300046529 Ga0495652_0028874 Ga0495652_0028874_2194_2883 203
542 3300046529 Ga0495652_0035637 Ga0495652_0035637_1282_1980 203
543 3300046533 Ga0495640_0036389 Ga0495640_0036389_875_1564 203
544 3300046536 Ga0495587_0234375 Ga0495587_0234375_58_756 203
545 3300046543 Ga0495645_0091105 Ga0495645_0091105_688_1377 203
546 3300046559 Ga0495667_0001023 Ga0495667_0001023_11318_12007 203
547 3300046663 Ga0495635_0079599 Ga0495635_0079599_276_965 203
548 3300046675 Ga0495657_0021964 Ga0495657_0021964_2549_3238 203
549 3300046675 Ga0495657_0365758 Ga0495657_0365758_130_813 203
550 3300046680 Ga0495646_0040775 Ga0495646_0040775_196_885 203
551 3300046689 Ga0495613_0128797 Ga0495613_0128797_889_1578 203
552 3300046690 Ga0495624_0178431 Ga0495624_0178431_236_919 203
553 3300047317 Ga0495604_0334136 Ga0495604_0334136_265_948 203
554 3300047319 Ga0495674_0084744 Ga0495674_0084744_1261_1950 203
555 3300047319 Ga0495674_0155618 Ga0495674_0155618_920_1603 203
556 3300047319 Ga0495674_0206862 Ga0495674_0206862_572_1270 203
557 3300047322 Ga0495680_0080447 Ga0495680_0080447_1420_2109 203
558 3300047471 Ga0495684_0014186 Ga0495684_0014186_1229_1918 203
559 3300048088 Ga0495602_0057336 Ga0495602_0057336_662_1351 203
560 3300048903 Ga0496100_0044855 Ga0496100_0044855_1234_1917 203
561 3300048903 Ga0496100_0086206 Ga0496100_0086206_206_865 203
562 3300048903 Ga0496100_0329586 Ga0496100_0329586_409_1095 203
563 3300048905 Ga0496102_0031622 Ga0496102_0031622_3349_4008 203
564 3300048907 Ga0496104_0012549 Ga0496104_0012549_2542_3231 203
565 3300048908 Ga0496105_0099074 Ga0496105_0099074_1163_1852 203
566 3300048908 Ga0496105_0164230 Ga0496105_0164230_501_1190 203
567 3300048909 Ga0496106_0036395 Ga0496106_0036395_1883_2542 203
568 3300048910 Ga0496107_0041472 Ga0496107_0041472_1610_2269 203
569 3300048911 Ga0496108_0337704 Ga0496108_0337704_14_703 203
570 3300048911 Ga0496108_0684660 Ga0496108_0684660_77_766 203
571 3300048912 Ga0496109_0253050 Ga0496109_0253050_953_1642 203
572 3300048915 Ga0496112_0034280 Ga0496112_0034280_817_1506 203
573 3300048916 Ga0496113_0009800 Ga0496113_0009800_2822_3511 203
574 3300048917 Ga0496114_0001493 Ga0496114_0001493_2896_3555 203
575 3300048917 Ga0496114_0093555 Ga0496114_0093555_415_1104 203
576 3300048918 Ga0496115_0370071 Ga0496115_0370071_311_970 203
577 3300049569 Ga0501032_0010737 Ga0501032_0010737_1035_1718 203
578 3300049569 Ga0501032_0126199 Ga0501032_0126199_55_738 203
579 3300049569 Ga0501032_0275405 Ga0501032_0275405_335_1018 203
580 3300049570 Ga0501033_0006867 Ga0501033_0006867_3726_4409 203
581 3300049571 Ga0501034_0036214 Ga0501034_0036214_2858_3541 203
582 3300049572 Ga0501036_0009924 Ga0501036_0009924_4892_5575 203
583 3300049572 Ga0501036_0043491 Ga0501036_0043491_1866_2549 203
584 3300049573 Ga0501037_0010808 Ga0501037_0010808_3169_3852 203
585 3300049573 Ga0501037_0102158 Ga0501037_0102158_920_1603 203
586 3300049574 Ga0501038_0026437 Ga0501038_0026437_1004_1687 203
587 3300049574 Ga0501038_0587441 Ga0501038_0587441_145_828 203
588 3300049576 Ga0501040_0003675 Ga0501040_0003675_5187_5870 203
589 3300049576 Ga0501040_0018215 Ga0501040_0018215_3533_4216 203
590 3300049576 Ga0501040_0108162 Ga0501040_0108162_549_1232 203
591 3300049577 Ga0501041_0078505 Ga0501041_0078505_568_1251 203
592 3300049577 Ga0501041_0227689 Ga0501041_0227689_104_787 203
593 3300049578 Ga0501042_0002692 Ga0501042_0002692_4865_5548 203
594 3300049578 Ga0501042_0275569 Ga0501042_0275569_453_1136 203
595 3300049579 Ga0501043_0007275 Ga0501043_0007275_4958_5641 203
596 3300049580 Ga0501046_0043183 Ga0501046_0043183_604_1287 203
597 3300049581 Ga0501047_0035150 Ga0501047_0035150_1604_2287 203
598 3300049582 Ga0501048_0006396 Ga0501048_0006396_4369_5052 203
599 3300049582 Ga0501048_0068149 Ga0501048_0068149_1694_2377 203
600 3300049584 Ga0501068_0000910 Ga0501068_0000910_9876_10559 203
601 3300049584 Ga0501068_0079806 Ga0501068_0079806_981_1664 203
602 3300049585 Ga0501069_0008925 Ga0501069_0008925_1435_2118 203
603 3300049586 Ga0501070_0001280 Ga0501070_0001280_3885_4568 203
604 3300049586 Ga0501070_0150529 Ga0501070_0150529_650_1333 203
605 3300049586 Ga0501070_0441395 Ga0501070_0441395_221_904 203
606 3300049587 Ga0501071_0009751 Ga0501071_0009751_876_1559 203
607 3300049587 Ga0501071_0032431 Ga0501071_0032431_1872_2555 203
608 3300049587 Ga0501071_0042360 Ga0501071_0042360_943_1626 203
609 3300049588 Ga0501072_0008261 Ga0501072_0008261_3230_3913 203
610 3300049588 Ga0501072_0016558 Ga0501072_0016558_4843_5526 203
611 3300049589 Ga0501073_0007749 Ga0501073_0007749_4173_4856 203
612 3300049590 Ga0501074_0015585 Ga0501074_0015585_2211_2894 203
613 3300049591 Ga0501075_0043194 Ga0501075_0043194_991_1674 203
614 3300049592 Ga0501076_0013410 Ga0501076_0013410_3042_3725 203
615 3300049592 Ga0501076_0013836 Ga0501076_0013836_1627_2310 203
616 3300049592 Ga0501076_0021274 Ga0501076_0021274_2236_2919 203
617 3300049593 Ga0501077_0005005 Ga0501077_0005005_3178_3861 203
618 3300049593 Ga0501077_0037863 Ga0501077_0037863_688_1371 203
619 3300049742 Ga0501080_0008481 Ga0501080_0008481_3610_4293 203
620 3300049743 Ga0501081_0008063 Ga0501081_0008063_2269_2952 203
621 3300049743 Ga0501081_0020598 Ga0501081_0020598_3203_3886 203
622 3300049743 Ga0501081_0381018 Ga0501081_0381018_23_706 203
623 3300049744 Ga0501083_0012763 Ga0501083_0012763_3109_3792 203
624 3300049822 Ga0501035_0309251 Ga0501035_0309251_329_1012 203
625 3300049823 Ga0501044_0020066 Ga0501044_0020066_6091_6774 203
626 3300049824 Ga0501045_0010528 Ga0501045_0010528_4046_4729 203
627 3300049824 Ga0501045_0272405 Ga0501045_0272405_485_1168 203
628 3300053077 Ga0495601_0136022 Ga0495601_0136022_612_1310 203
629 3300053078 Ga0495612_0016370 Ga0495612_0016370_1385_2074 203
630 3300053078 Ga0495612_0076012 Ga0495612_0076012_264_947 203
631 3300053084 Ga0495595_0010720 Ga0495595_0010720_1460_2149 203
632 3300053085 Ga0495619_0011725 Ga0495619_0011725_3599_4288 203
633 3300054114 Ga0501084_0098013 Ga0501084_0098013_1004_1687 203
634 3300060353 Ga0501082_0118613 Ga0501082_0118613_695_1378 203
635 3300061719 Ga0466962_0049330 Ga0466962_0049330_1301_1984 203
636 3300061734 Ga0530510_0004994 Ga0530510_0004994_5437_6120 203
637 3300061734 Ga0530510_0145467 Ga0530510_0145467_143_826 203
638 3300061734 Ga0530510_0494277 Ga0530510_0494277_217_900 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01939

NucS_C

Endonuclease NucS C-terminal domain

129

247

0.97

PF21003

NucS_N

Endonuclease NucS N-terminal PH-like domain

22

120

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7r81-assembly1.cif.gz_c1 structure of the translating neurospora crassa ribosome arrested by cycloheximide 0.9145 159 186
8cg8-assembly1.cif.gz_M translocation intermediate 3 (ti-3) of 80s s. cerevisiae ribosome with ligands and eef2 in the presence of sordarin 0.8928 159 186
8b2l-assembly1.cif.gz_f3 cryo-em structure of the plant 80s ribosome 0.8867 159 186
7qiz-assembly1.cif.gz_c specific features and methylation sites of a plant 80s ribosome 0.8839 159 186
8ink-assembly1.cif.gz_L human nuclear pre-60s ribosomal particle - state d 0.8357 156 186
ID Description Score Start End Superfamily
af_P9WIY5_101_213_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.9523 81 186 3.40.1350.10
af_P9WIY5_101_213_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8869 81 186 3.40.1350.10
4w20a02 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.8606 158 186 3.100.10.10
af_P9WIY5_1_96_2.70.180.20 Mainly Beta;Distorted Sandwich;Protein Yojf; Chain: A;; 0.8597 2 76 2.70.180.20
2vldB01 Mainly Beta;Distorted Sandwich;Protein Yojf; Chain: A;; 0.8071 2 77 2.70.180.20
ID Description Score Start End GO Terms
AF-A0A1V3XH57-F1-model_v4 Endonuclease NucS C-terminal domain-containing protein 0.987 83 192 GO:0003677
GO:0004519
AF-A0A3D5GPY0-F1-model_v4 Endonuclease 0.9661 84 147 GO:0003677
GO:0004519
AF-A0A7C3XCH8-F1-model_v4 DUF91 domain-containing protein 0.959 86 186 GO:0003676
AF-X8F319-F1-model_v4 deleted 0.9461 87 183
AF-A0A2V3J8L5-F1-model_v4 Endonuclease NucS C-terminal domain-containing protein 0.9461 86 186 GO:0003677
GO:0004519
GO:0016020

Feature Viewer

pLDDT pTM Quality
85.85 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map