F471539
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 638 | 287 | 638 | 220 |
Family's Representative Sequence
| Representative Sequence | 3300044719|Ga0466971_0023271|Ga0466971_0023271_510_1265 |
| Length | 251 |
| Sequence | LRIGLHVRRSAGPELSAALITVPNVRLLVARCEVRYSGRLDALLPEALRLIIIKADGSVLVHADAGGYKPLNWMTPPTVIEESSELMVVRKRAGSSEDRLEISLREVLSDVSHDMGTPDEDTALTKDGVEAHLQELLAEQPHWCGEGLRLVRREWPTDIGPVDLMCRDLEEQWVAVEIKRVAGIEAVEQLTRYLERIRLDPAFVSCRGVLAAQLIKPQARVLAGARGIDCVEVDLAVLRGERQPDLKLFAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 54 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 82 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 88 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 89 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 90 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 133 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 134 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 135 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 136 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 137 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 138 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 139 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 140 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 141 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 142 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 143 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 144 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 145 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 146 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 147 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 148 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 149 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 150 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 151 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 152 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 153 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 154 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 157 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 158 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 159 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 160 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 161 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 162 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 163 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 164 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 165 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 166 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 167 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 168 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 169 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 170 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 171 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 172 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 173 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 174 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 175 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 176 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 177 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 178 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 179 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 180 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 222 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 223 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 224 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 225 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 226 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 229 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 230 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 231 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 232 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 233 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 234 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 235 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 268 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 269 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 270 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 271 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 285 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 287 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.37 |
| Metatranscriptomes | 0.63 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.78 |
| Nodule | 0 |
| Rhizoplane | 8.15 |
| Rhizosphere | 84.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10010674 | 3300002077 | Bacteria | 1880 |
| 2 | Ga0070658_10202883 | 3300005327 | Bacteria | 1673 |
| 3 | Ga0070658_10290290 | 3300005327 | Bacteria | 1393 |
| 4 | Ga0070683_100012762 | 3300005329 | Bacteria | 7307 |
| 5 | Ga0070683_100427051 | 3300005329 | Bacteria | 1264 |
| 6 | Ga0070690_100018738 | 3300005330 | Bacteria | 4186 |
| 7 | Ga0068869_100165812 | 3300005334 | Bacteria | 1723 |
| 8 | Ga0070680_100002327 | 3300005336 | Bacteria | 14026 |
| 9 | Ga0070680_100148678 | 3300005336 | Bacteria | 1966 |
| 10 | Ga0070682_100029770 | 3300005337 | Bacteria | 3290 |
| 11 | Ga0068868_100093729 | 3300005338 | Bacteria | 2421 |
| 12 | Ga0068868_100274750 | 3300005338 | Bacteria | 1424 |
| 13 | Ga0070660_100007570 | 3300005339 | Bacteria | 7568 |
| 14 | Ga0070660_100096113 | 3300005339 | Unclassified | 2342 |
| 15 | Ga0070687_100008486 | 3300005343 | Bacteria | 4357 |
| 16 | Ga0070687_100198201 | 3300005343 | Bacteria | 1215 |
| 17 | Ga0070661_100008448 | 3300005344 | Bacteria | 7121 |
| 18 | Ga0070692_10407171 | 3300005345 | Bacteria | 860 |
| 19 | Ga0070668_100184506 | 3300005347 | Bacteria | 1706 |
| 20 | Ga0070668_100460714 | 3300005347 | Bacteria | 1095 |
| 21 | Ga0070669_100700385 | 3300005353 | Bacteria | 855 |
| 22 | Ga0070671_100031215 | 3300005355 | Bacteria | 4400 |
| 23 | Ga0070674_100015392 | 3300005356 | Bacteria | 4775 |
| 24 | Ga0070688_100248507 | 3300005365 | Bacteria | 1265 |
| 25 | Ga0070659_100016250 | 3300005366 | Bacteria | 5586 |
| 26 | Ga0070659_100073669 | 3300005366 | Bacteria | 2718 |
| 27 | Ga0070659_100107801 | 3300005366 | Bacteria | 2246 |
| 28 | Ga0070659_100258754 | 3300005366 | Bacteria | 1444 |
| 29 | Ga0070714_100018537 | 3300005435 | Bacteria | 5656 |
| 30 | Ga0070714_100056593 | 3300005435 | Bacteria | 3355 |
| 31 | Ga0070714_100160037 | 3300005435 | Bacteria | 2036 |
| 32 | Ga0070714_100374846 | 3300005435 | Bacteria | 1341 |
| 33 | Ga0070714_100402748 | 3300005435 | Bacteria | 1294 |
| 34 | Ga0070714_100550348 | 3300005435 | Bacteria | 1105 |
| 35 | Ga0070713_100019157 | 3300005436 | Bacteria | 5217 |
| 36 | Ga0070713_100031459 | 3300005436 | Bacteria | 4227 |
| 37 | Ga0070713_100264978 | 3300005436 | Bacteria | 1571 |
| 38 | Ga0070710_10006000 | 3300005437 | Bacteria | 5805 |
| 39 | Ga0070701_10001596 | 3300005438 | Bacteria | 8438 |
| 40 | Ga0070711_100434604 | 3300005439 | Bacteria | 1072 |
| 41 | Ga0070700_100017943 | 3300005441 | Bacteria | 4059 |
| 42 | Ga0070700_100165268 | 3300005441 | Bacteria | 1527 |
| 43 | Ga0070694_100078469 | 3300005444 | Bacteria | 2290 |
| 44 | Ga0070708_100882887 | 3300005445 | Bacteria | 840 |
| 45 | Ga0070662_100057740 | 3300005457 | Bacteria | 2821 |
| 46 | Ga0070681_10035917 | 3300005458 | Bacteria | 4978 |
| 47 | Ga0070681_10224447 | 3300005458 | Bacteria | 1793 |
| 48 | Ga0070681_10360229 | 3300005458 | Bacteria | 1365 |
| 49 | Ga0070681_10505456 | 3300005458 | Bacteria | 1122 |
| 50 | Ga0068867_100001986 | 3300005459 | Bacteria | 14268 |
| 51 | Ga0070685_10019049 | 3300005466 | Bacteria | 3699 |
| 52 | Ga0070699_100572458 | 3300005518 | Bacteria | 1029 |
| 53 | Ga0070679_100026448 | 3300005530 | Bacteria | 5700 |
| 54 | Ga0070679_100124608 | 3300005530 | Bacteria | 2559 |
| 55 | Ga0070684_100174751 | 3300005535 | Bacteria | 1952 |
| 56 | Ga0070684_100227481 | 3300005535 | Unclassified | 1703 |
| 57 | Ga0070697_100658005 | 3300005536 | Bacteria | 923 |
| 58 | Ga0068853_100083654 | 3300005539 | Bacteria | 2796 |
| 59 | Ga0068853_100519898 | 3300005539 | Bacteria | 1125 |
| 60 | Ga0068853_100565856 | 3300005539 | Bacteria | 1078 |
| 61 | Ga0070686_100001306 | 3300005544 | Bacteria | 14081 |
| 62 | Ga0070696_100012789 | 3300005546 | Bacteria | 5636 |
| 63 | Ga0070693_100114253 | 3300005547 | Bacteria | 1665 |
| 64 | Ga0070665_100538555 | 3300005548 | Bacteria | 1179 |
| 65 | Ga0070704_100032451 | 3300005549 | Bacteria | 3523 |
| 66 | Ga0068854_100045259 | 3300005578 | Bacteria | 3128 |
| 67 | Ga0068856_100925053 | 3300005614 | Bacteria | 891 |
| 68 | Ga0070702_100086353 | 3300005615 | Bacteria | 1892 |
| 69 | Ga0068852_100185740 | 3300005616 | Bacteria | 1958 |
| 70 | Ga0068852_100502267 | 3300005616 | Bacteria | 1208 |
| 71 | Ga0068859_100425366 | 3300005617 | Bacteria | 1424 |
| 72 | Ga0068866_10020230 | 3300005718 | Bacteria | 3047 |
| 73 | Ga0068866_10069515 | 3300005718 | Bacteria | 1855 |
| 74 | Ga0068861_100018009 | 3300005719 | Bacteria | 5023 |
| 75 | Ga0068861_100067605 | 3300005719 | Bacteria | 2758 |
| 76 | Ga0068858_100180928 | 3300005842 | Bacteria | 1991 |
| 77 | Ga0068862_100252829 | 3300005844 | Bacteria | 1607 |
| 78 | Ga0081538_10001726 | 3300005981 | Bacteria | 22212 |
| 79 | Ga0081538_10005377 | 3300005981 | Bacteria | 11513 |
| 80 | Ga0081538_10015590 | 3300005981 | Bacteria | 5874 |
| 81 | Ga0081539_10101701 | 3300005985 | Bacteria | 1463 |
| 82 | Ga0070717_10014762 | 3300006028 | Bacteria | 6009 |
| 83 | Ga0070717_10024989 | 3300006028 | Bacteria | 4745 |
| 84 | Ga0070717_10047485 | 3300006028 | Bacteria | 3518 |
| 85 | Ga0070717_10465501 | 3300006028 | Bacteria | 1140 |
| 86 | Ga0070717_10671871 | 3300006028 | Bacteria | 941 |
| 87 | Ga0075364_10036616 | 3300006051 | Bacteria | 3173 |
| 88 | Ga0070716_100090231 | 3300006173 | Bacteria | 1853 |
| 89 | Ga0070712_100018561 | 3300006175 | Bacteria | 4520 |
| 90 | Ga0070712_100113399 | 3300006175 | Bacteria | 2027 |
| 91 | Ga0068871_100044002 | 3300006358 | Bacteria | 3588 |
| 92 | Ga0075428_100037894 | 3300006844 | Bacteria | 5306 |
| 93 | Ga0075428_100314695 | 3300006844 | Bacteria | 1683 |
| 94 | Ga0075431_100046842 | 3300006847 | Bacteria | 4459 |
| 95 | Ga0075433_10094751 | 3300006852 | Bacteria | 2642 |
| 96 | Ga0075433_10432254 | 3300006852 | Bacteria | 1161 |
| 97 | Ga0075434_100080236 | 3300006871 | Bacteria | 3259 |
| 98 | Ga0075434_100130145 | 3300006871 | Bacteria | 2535 |
| 99 | Ga0075429_100230296 | 3300006880 | Bacteria | 1623 |
| 100 | Ga0068865_100015718 | 3300006881 | Bacteria | 4829 |
| 101 | Ga0068865_100051365 | 3300006881 | Bacteria | 2853 |
| 102 | Ga0075436_100013781 | 3300006914 | Bacteria | 5537 |
| 103 | Ga0097620_100425357 | 3300006931 | Bacteria | 1424 |
| 104 | Ga0075435_100060567 | 3300007076 | Bacteria | 3069 |
| 105 | Ga0075435_100124926 | 3300007076 | Bacteria | 2150 |
| 106 | Ga0105245_10072800 | 3300009098 | Bacteria | 3123 |
| 107 | Ga0105245_10105095 | 3300009098 | Bacteria | 2619 |
| 108 | Ga0114129_10006658 | 3300009147 | Bacteria | 16406 |
| 109 | Ga0114129_10096414 | 3300009147 | Bacteria | 4095 |
| 110 | Ga0114129_10226877 | 3300009147 | Bacteria | 2517 |
| 111 | Ga0105243_10041003 | 3300009148 | Bacteria | 3619 |
| 112 | Ga0105243_10206287 | 3300009148 | Bacteria | 1727 |
| 113 | Ga0105243_10539662 | 3300009148 | Bacteria | 1112 |
| 114 | Ga0105242_10058370 | 3300009176 | Bacteria | 3163 |
| 115 | Ga0105242_10068762 | 3300009176 | Bacteria | 2931 |
| 116 | Ga0105248_10048411 | 3300009177 | Bacteria | 4769 |
| 117 | Ga0105238_10087200 | 3300009551 | Bacteria | 3108 |
| 118 | Ga0105238_10275056 | 3300009551 | Bacteria | 1665 |
| 119 | Ga0105238_10562093 | 3300009551 | Bacteria | 1146 |
| 120 | Ga0105249_10010542 | 3300009553 | Bacteria | 8120 |
| 121 | Ga0105249_10033962 | 3300009553 | Bacteria | 4620 |
| 122 | Ga0105249_10165729 | 3300009553 | Bacteria | 2139 |
| 123 | Ga0105239_10002157 | 3300010375 | Bacteria | 25329 |
| 124 | Ga0105239_10250605 | 3300010375 | Bacteria | 1989 |
| 125 | Ga0105239_11206251 | 3300010375 | Bacteria | 872 |
| 126 | Ga0157370_10011112 | 3300013104 | Bacteria | 9439 |
| 127 | Ga0157370_10133223 | 3300013104 | Bacteria | 2317 |
| 128 | Ga0157369_10166132 | 3300013105 | Bacteria | 2327 |
| 129 | Ga0157374_10012163 | 3300013296 | Bacteria | 7477 |
| 130 | Ga0157374_10782209 | 3300013296 | Unclassified | 970 |
| 131 | Ga0157378_10037430 | 3300013297 | Bacteria | 4297 |
| 132 | Ga0163162_10001769 | 3300013306 | Bacteria | 20249 |
| 133 | Ga0163162_10886361 | 3300013306 | Bacteria | 1006 |
| 134 | Ga0157372_10198145 | 3300013307 | Bacteria | 2326 |
| 135 | Ga0157372_10264823 | 3300013307 | Bacteria | 1996 |
| 136 | Ga0157372_11309152 | 3300013307 | Bacteria | 836 |
| 137 | Ga0157380_10017229 | 3300014326 | Bacteria | 5344 |
| 138 | Ga0157380_10036935 | 3300014326 | Bacteria | 3783 |
| 139 | Ga0182008_10223456 | 3300014497 | Bacteria | 964 |
| 140 | Ga0157377_10061972 | 3300014745 | Bacteria | 2139 |
| 141 | Ga0157376_10046520 | 3300014969 | Bacteria | 3578 |
| 142 | Ga0163161_10207025 | 3300017792 | Bacteria | 1514 |
| 143 | Ga0206354_11348025 | 3300020081 | Bacteria | 2394 |
| 144 | Ga0206353_10596252 | 3300020082 | Bacteria | 5631 |
| 145 | Ga0206353_10863355 | 3300020082 | Bacteria | 2387 |
| 146 | Ga0206353_11434632 | 3300020082 | Bacteria | 2643 |
| 147 | Ga0213874_10000005 | 3300021377 | Bacteria | 27808 |
| 148 | Ga0213874_10048479 | 3300021377 | Bacteria | 1296 |
| 149 | Ga0213874_10085101 | 3300021377 | Bacteria | 1030 |
| 150 | Ga0213876_10006232 | 3300021384 | Bacteria | 6506 |
| 151 | Ga0213876_10016494 | 3300021384 | Bacteria | 3905 |
| 152 | Ga0213876_10059078 | 3300021384 | Bacteria | 2024 |
| 153 | Ga0213876_10101855 | 3300021384 | Bacteria | 1522 |
| 154 | Ga0213876_10147870 | 3300021384 | Bacteria | 1249 |
| 155 | Ga0213876_10150506 | 3300021384 | Bacteria | 1238 |
| 156 | Ga0213875_10006473 | 3300021388 | Bacteria | 6141 |
| 157 | Ga0213875_10009519 | 3300021388 | Bacteria | 4920 |
| 158 | Ga0213875_10016639 | 3300021388 | Bacteria | 3564 |
| 159 | Ga0213875_10083886 | 3300021388 | Bacteria | 1487 |
| 160 | Ga0207692_10145259 | 3300025898 | Bacteria | 1353 |
| 161 | Ga0207642_10012082 | 3300025899 | Bacteria | 3105 |
| 162 | Ga0207699_10027001 | 3300025906 | Bacteria | 3173 |
| 163 | Ga0207705_10217250 | 3300025909 | Bacteria | 1451 |
| 164 | Ga0207707_10135132 | 3300025912 | Bacteria | 2156 |
| 165 | Ga0207707_10157467 | 3300025912 | Bacteria | 1986 |
| 166 | Ga0207707_10294270 | 3300025912 | Bacteria | 1404 |
| 167 | Ga0207707_10338547 | 3300025912 | Bacteria | 1297 |
| 168 | Ga0207693_10002345 | 3300025915 | Bacteria | 16445 |
| 169 | Ga0207693_10046637 | 3300025915 | Bacteria | 3405 |
| 170 | Ga0207693_10210332 | 3300025915 | Bacteria | 1529 |
| 171 | Ga0207693_10212928 | 3300025915 | Bacteria | 1519 |
| 172 | Ga0207663_10015163 | 3300025916 | Bacteria | 4244 |
| 173 | Ga0207663_10090167 | 3300025916 | Bacteria | 2032 |
| 174 | Ga0207663_10107181 | 3300025916 | Bacteria | 1889 |
| 175 | Ga0207660_10041075 | 3300025917 | Bacteria | 3240 |
| 176 | Ga0207660_10154969 | 3300025917 | Bacteria | 1763 |
| 177 | Ga0207660_10298995 | 3300025917 | Bacteria | 1281 |
| 178 | Ga0207662_10113456 | 3300025918 | Bacteria | 1692 |
| 179 | Ga0207657_10012783 | 3300025919 | Bacteria | 8263 |
| 180 | Ga0207657_10017863 | 3300025919 | Bacteria | 6788 |
| 181 | Ga0207657_10018530 | 3300025919 | Bacteria | 6640 |
| 182 | Ga0207657_10049707 | 3300025919 | Bacteria | 3651 |
| 183 | Ga0207657_10417656 | 3300025919 | Bacteria | 1054 |
| 184 | Ga0207652_10023986 | 3300025921 | Bacteria | 5060 |
| 185 | Ga0207652_10098505 | 3300025921 | Bacteria | 2578 |
| 186 | Ga0207652_10142052 | 3300025921 | Bacteria | 2147 |
| 187 | Ga0207694_10414532 | 3300025924 | Bacteria | 1121 |
| 188 | Ga0207694_10614443 | 3300025924 | Bacteria | 914 |
| 189 | Ga0207687_10435085 | 3300025927 | Unclassified | 1085 |
| 190 | Ga0207687_10438226 | 3300025927 | Bacteria | 1082 |
| 191 | Ga0207687_10700241 | 3300025927 | Bacteria | 860 |
| 192 | Ga0207700_10017046 | 3300025928 | Bacteria | 4841 |
| 193 | Ga0207700_10035952 | 3300025928 | Bacteria | 3573 |
| 194 | Ga0207700_10091210 | 3300025928 | Bacteria | 2406 |
| 195 | Ga0207664_10001411 | 3300025929 | Bacteria | 15808 |
| 196 | Ga0207664_10028937 | 3300025929 | Bacteria | 4217 |
| 197 | Ga0207664_10050177 | 3300025929 | Bacteria | 3289 |
| 198 | Ga0207664_10050634 | 3300025929 | Bacteria | 3276 |
| 199 | Ga0207664_10313078 | 3300025929 | Bacteria | 1383 |
| 200 | Ga0207644_10047535 | 3300025931 | Bacteria | 3063 |
| 201 | Ga0207690_10060649 | 3300025932 | Bacteria | 2568 |
| 202 | Ga0207690_10287668 | 3300025932 | Bacteria | 1282 |
| 203 | Ga0207686_10039731 | 3300025934 | Bacteria | 2856 |
| 204 | Ga0207686_10145429 | 3300025934 | Bacteria | 1644 |
| 205 | Ga0207709_10062717 | 3300025935 | Bacteria | 2328 |
| 206 | Ga0207669_10025080 | 3300025937 | Bacteria | 3215 |
| 207 | Ga0207704_10015400 | 3300025938 | Bacteria | 3895 |
| 208 | Ga0207704_10613006 | 3300025938 | Bacteria | 892 |
| 209 | Ga0207665_10583332 | 3300025939 | Bacteria | 872 |
| 210 | Ga0207665_10841294 | 3300025939 | Bacteria | 726 |
| 211 | Ga0207691_10171852 | 3300025940 | Bacteria | 1898 |
| 212 | Ga0207691_10486579 | 3300025940 | Bacteria | 1048 |
| 213 | Ga0207689_10834376 | 3300025942 | Bacteria | 778 |
| 214 | Ga0207661_10022852 | 3300025944 | Bacteria | 4716 |
| 215 | Ga0207679_10056979 | 3300025945 | Bacteria | 2888 |
| 216 | Ga0207679_10348869 | 3300025945 | Bacteria | 1289 |
| 217 | Ga0207679_10688867 | 3300025945 | Bacteria | 927 |
| 218 | Ga0207667_10267732 | 3300025949 | Bacteria | 1747 |
| 219 | Ga0207667_10512455 | 3300025949 | Bacteria | 1216 |
| 220 | Ga0207712_10152968 | 3300025961 | Bacteria | 1784 |
| 221 | Ga0207668_10103327 | 3300025972 | Bacteria | 2122 |
| 222 | Ga0207668_10187024 | 3300025972 | Bacteria | 1638 |
| 223 | Ga0207640_10736552 | 3300025981 | Bacteria | 849 |
| 224 | Ga0207658_10165780 | 3300025986 | Bacteria | 1815 |
| 225 | Ga0207677_10338979 | 3300026023 | Bacteria | 1255 |
| 226 | Ga0207639_10209385 | 3300026041 | Bacteria | 1677 |
| 227 | Ga0207639_10436749 | 3300026041 | Bacteria | 1186 |
| 228 | Ga0207678_10055213 | 3300026067 | Bacteria | 3421 |
| 229 | Ga0207708_10018961 | 3300026075 | Bacteria | 5181 |
| 230 | Ga0207708_10035685 | 3300026075 | Bacteria | 3784 |
| 231 | Ga0207702_10198515 | 3300026078 | Bacteria | 1858 |
| 232 | Ga0207702_10471384 | 3300026078 | Bacteria | 1221 |
| 233 | Ga0207648_10000947 | 3300026089 | Bacteria | 32821 |
| 234 | Ga0207676_10346929 | 3300026095 | Bacteria | 1372 |
| 235 | Ga0207675_100034760 | 3300026118 | Bacteria | 4700 |
| 236 | Ga0207675_100038595 | 3300026118 | Bacteria | 4456 |
| 237 | Ga0207683_10005535 | 3300026121 | Bacteria | 10827 |
| 238 | Ga0207683_10331012 | 3300026121 | Bacteria | 1396 |
| 239 | Ga0207698_10191504 | 3300026142 | Bacteria | 1822 |
| 240 | Ga0207698_10631754 | 3300026142 | Bacteria | 1059 |
| 241 | Ga0268265_10047046 | 3300028380 | Unclassified | 3230 |
| 242 | Ga0265337_1005371 | 3300028556 | Bacteria | 5095 |
| 243 | Ga0265326_10000282 | 3300028558 | Bacteria | 23309 |
| 244 | Ga0265319_1000065 | 3300028563 | Bacteria | 85273 |
| 245 | Ga0265318_10008234 | 3300028577 | Bacteria | 4656 |
| 246 | Ga0265322_10006583 | 3300028654 | Bacteria | 3417 |
| 247 | Ga0265336_10000001 | 3300028666 | Bacteria | 916179 |
| 248 | Ga0265338_10000004 | 3300028800 | Bacteria | 644793 |
| 249 | Ga0265338_10030889 | 3300028800 | Bacteria | 5263 |
| 250 | Ga0265338_10195970 | 3300028800 | Bacteria | 1527 |
| 251 | Ga0265328_10115089 | 3300031239 | Bacteria | 1001 |
| 252 | Ga0265320_10156864 | 3300031240 | Bacteria | 1026 |
| 253 | Ga0265340_10000002 | 3300031247 | Bacteria | 711693 |
| 254 | Ga0265327_10030508 | 3300031251 | Bacteria | 3046 |
| 255 | Ga0265342_10251476 | 3300031712 | Bacteria | 943 |
| 256 | Ga0307413_10056524 | 3300031824 | Bacteria | 2394 |
| 257 | Ga0307413_10525810 | 3300031824 | Bacteria | 955 |
| 258 | Ga0307410_10488781 | 3300031852 | Bacteria | 1011 |
| 259 | Ga0307406_10259615 | 3300031901 | Bacteria | 1313 |
| 260 | Ga0307406_10582182 | 3300031901 | Bacteria | 920 |
| 261 | Ga0307407_10187715 | 3300031903 | Bacteria | 1375 |
| 262 | Ga0307412_10719590 | 3300031911 | Bacteria | 859 |
| 263 | Ga0307409_100331132 | 3300031995 | Bacteria | 1429 |
| 264 | Ga0307416_100572323 | 3300032002 | Bacteria | 1206 |
| 265 | Ga0307415_100010737 | 3300032126 | Bacteria | 5202 |
| 266 | Ga0307415_100058533 | 3300032126 | Bacteria | 2653 |
| 267 | Ga0373924_0055216 | 3300035410 | Bacteria | 1653 |
| 268 | Ga0373933_0023248 | 3300035724 | Bacteria | 3539 |
| 269 | Ga0373933_0376801 | 3300035724 | Bacteria | 924 |
| 270 | Ga0373937_0153973 | 3300036401 | Bacteria | 2154 |
| 271 | Ga0373925_0280645 | 3300037068 | Bacteria | 1341 |
| 272 | Ga0373925_0346983 | 3300037068 | Bacteria | 1205 |
| 273 | Ga0395899_0084568 | 3300037312 | Unclassified | 2306 |
| 274 | Ga0395899_0214702 | 3300037312 | Unclassified | 1335 |
| 275 | Ga0395900_0004135 | 3300037418 | Bacteria | 15451 |
| 276 | Ga0395900_0026510 | 3300037418 | Bacteria | 5934 |
| 277 | Ga0395900_0034090 | 3300037418 | Bacteria | 5240 |
| 278 | Ga0395900_0053454 | 3300037418 | Bacteria | 4157 |
| 279 | Ga0395900_0065982 | 3300037418 | Bacteria | 3719 |
| 280 | Ga0395900_0094185 | 3300037418 | Bacteria | 3076 |
| 281 | Ga0395900_0151152 | 3300037418 | Bacteria | 2372 |
| 282 | Ga0395898_0000894 | 3300037466 | Bacteria | 48455 |
| 283 | Ga0395898_0006669 | 3300037466 | Bacteria | 12312 |
| 284 | Ga0395898_0021885 | 3300037466 | Bacteria | 6477 |
| 285 | Ga0395898_0050565 | 3300037466 | Bacteria | 4067 |
| 286 | Ga0395905_0017576 | 3300037471 | Bacteria | 6786 |
| 287 | Ga0395905_0027590 | 3300037471 | Bacteria | 5354 |
| 288 | Ga0395905_0040789 | 3300037471 | Bacteria | 4355 |
| 289 | Ga0395905_0237994 | 3300037471 | Bacteria | 1702 |
| 290 | Ga0436364_0159150 | 3300037853 | Bacteria | 9191 |
| 291 | Ga0436364_0159207 | 3300037853 | Bacteria | 28255 |
| 292 | Ga0436364_0263937 | 3300037853 | Bacteria | 1047 |
| 293 | Ga0436364_0334646 | 3300037853 | Bacteria | 5280 |
| 294 | Ga0436364_0418406 | 3300037853 | Bacteria | 5504 |
| 295 | Ga0436364_0424870 | 3300037853 | Bacteria | 994 |
| 296 | Ga0436364_0793605 | 3300037853 | Bacteria | 3185 |
| 297 | Ga0436364_0811094 | 3300037853 | Bacteria | 4923 |
| 298 | Ga0436364_1339551 | 3300037853 | Bacteria | 15044 |
| 299 | Ga0436364_1346518 | 3300037853 | Bacteria | 4089 |
| 300 | Ga0395901_0003054 | 3300038443 | Bacteria | 16863 |
| 301 | Ga0395901_0011629 | 3300038443 | Bacteria | 8913 |
| 302 | Ga0395901_0020589 | 3300038443 | Bacteria | 6751 |
| 303 | Ga0395901_0133342 | 3300038443 | Bacteria | 2610 |
| 304 | Ga0395901_0476002 | 3300038443 | Bacteria | 1274 |
| 305 | Ga0395901_0523142 | 3300038443 | Bacteria | 1205 |
| 306 | Ga0395901_0630799 | 3300038443 | Bacteria | 1077 |
| 307 | Ga0242420_059665 | 3300038996 | Bacteria | 759 |
| 308 | Ga0436365_0004038 | 3300039437 | Bacteria | 26265 |
| 309 | Ga0436365_0168949 | 3300039437 | Bacteria | 4102 |
| 310 | Ga0436365_0186047 | 3300039437 | Bacteria | 1555 |
| 311 | Ga0436365_0896130 | 3300039437 | Bacteria | 22043 |
| 312 | Ga0436365_1001279 | 3300039437 | Bacteria | 29327 |
| 313 | Ga0436365_1282173 | 3300039437 | Bacteria | 7766 |
| 314 | Ga0436365_1315914 | 3300039437 | Bacteria | 1974 |
| 315 | Ga0436365_1510673 | 3300039437 | Bacteria | 7863 |
| 316 | Ga0436365_1758755 | 3300039437 | Bacteria | 3726 |
| 317 | Ga0436365_1790130 | 3300039437 | Bacteria | 6598 |
| 318 | Ga0436365_1809914 | 3300039437 | Bacteria | 2888 |
| 319 | Ga0436365_1843863 | 3300039437 | Bacteria | 9695 |
| 320 | Ga0436365_1906563 | 3300039437 | Bacteria | 2176 |
| 321 | Ga0436360_0896315 | 3300039438 | Bacteria | 1304 |
| 322 | Ga0436363_0212212 | 3300039450 | Bacteria | 1613 |
| 323 | Ga0436363_0595893 | 3300039450 | Bacteria | 2279 |
| 324 | Ga0436363_0760459 | 3300039450 | Bacteria | 34430 |
| 325 | Ga0436363_0843533 | 3300039450 | Bacteria | 7913 |
| 326 | Ga0436363_0896388 | 3300039450 | Bacteria | 1859 |
| 327 | Ga0436363_0985997 | 3300039450 | Bacteria | 1073 |
| 328 | Ga0436363_1078326 | 3300039450 | Bacteria | 1860 |
| 329 | Ga0436363_1691717 | 3300039450 | Bacteria | 5219 |
| 330 | Ga0436362_0325995 | 3300039453 | Bacteria | 913 |
| 331 | Ga0436362_0993185 | 3300039453 | Bacteria | 777 |
| 332 | Ga0466969_0017968 | 3300044656 | Bacteria | 3689 |
| 333 | Ga0466969_0026626 | 3300044656 | Bacteria | 2964 |
| 334 | Ga0466969_0029449 | 3300044656 | Bacteria | 2803 |
| 335 | Ga0466969_0183497 | 3300044656 | Bacteria | 957 |
| 336 | Ga0466965_0026614 | 3300044683 | Bacteria | 2804 |
| 337 | Ga0466965_0081916 | 3300044683 | Bacteria | 1632 |
| 338 | Ga0466966_0016985 | 3300044684 | Bacteria | 4810 |
| 339 | Ga0466966_0031037 | 3300044684 | Bacteria | 3466 |
| 340 | Ga0466966_0195381 | 3300044684 | Bacteria | 1225 |
| 341 | Ga0466966_0273347 | 3300044684 | Bacteria | 1017 |
| 342 | Ga0466961_0004704 | 3300044693 | Bacteria | 8585 |
| 343 | Ga0466961_0076742 | 3300044693 | Bacteria | 2117 |
| 344 | Ga0466961_0078710 | 3300044693 | Bacteria | 2088 |
| 345 | Ga0466961_0081110 | 3300044693 | Bacteria | 2053 |
| 346 | Ga0466961_0095342 | 3300044693 | Bacteria | 1876 |
| 347 | Ga0466961_0387963 | 3300044693 | Bacteria | 848 |
| 348 | Ga0466963_0000104 | 3300044694 | Bacteria | 30306 |
| 349 | Ga0466963_0007807 | 3300044694 | Bacteria | 6400 |
| 350 | Ga0466963_0013255 | 3300044694 | Bacteria | 5060 |
| 351 | Ga0466963_0050761 | 3300044694 | Bacteria | 2746 |
| 352 | Ga0466963_0118470 | 3300044694 | Bacteria | 1821 |
| 353 | Ga0466963_0170911 | 3300044694 | Bacteria | 1515 |
| 354 | Ga0466963_0408613 | 3300044694 | Bacteria | 957 |
| 355 | Ga0466971_0005233 | 3300044719 | Bacteria | 5617 |
| 356 | Ga0466971_0023271 | 3300044719 | Bacteria | 2760 |
| 357 | Ga0466971_0028325 | 3300044719 | Bacteria | 2507 |
| 358 | Ga0466968_0033615 | 3300044735 | Bacteria | 2137 |
| 359 | Ga0466968_0233436 | 3300044735 | Bacteria | 869 |
| 360 | Ga0466970_0014568 | 3300044765 | Bacteria | 4039 |
| 361 | Ga0466970_0033730 | 3300044765 | Bacteria | 2707 |
| 362 | Ga0466957_0001380 | 3300044842 | Bacteria | 12675 |
| 363 | Ga0466957_0005549 | 3300044842 | Bacteria | 7086 |
| 364 | Ga0466957_0034550 | 3300044842 | Bacteria | 3033 |
| 365 | Ga0466957_0177667 | 3300044842 | Bacteria | 1389 |
| 366 | Ga0466957_0242061 | 3300044842 | Bacteria | 1197 |
| 367 | Ga0466960_0005487 | 3300044901 | Bacteria | 5029 |
| 368 | Ga0466959_0009139 | 3300045049 | Bacteria | 7039 |
| 369 | Ga0466959_0012687 | 3300045049 | Bacteria | 6096 |
| 370 | Ga0466959_0018636 | 3300045049 | Bacteria | 5098 |
| 371 | Ga0466959_0053107 | 3300045049 | Bacteria | 2964 |
| 372 | Ga0466959_0062978 | 3300045049 | Bacteria | 2694 |
| 373 | Ga0466959_0079682 | 3300045049 | Bacteria | 2361 |
| 374 | Ga0466959_0110111 | 3300045049 | Bacteria | 1966 |
| 375 | Ga0466959_0132945 | 3300045049 | Bacteria | 1762 |
| 376 | Ga0466959_0150528 | 3300045049 | Bacteria | 1640 |
| 377 | Ga0466959_0710608 | 3300045049 | Bacteria | 673 |
| 378 | Ga0466958_0000233 | 3300045836 | Bacteria | 21201 |
| 379 | Ga0466958_0001574 | 3300045836 | Bacteria | 10946 |
| 380 | Ga0466958_0004120 | 3300045836 | Bacteria | 7630 |
| 381 | Ga0466958_0021100 | 3300045836 | Bacteria | 3803 |
| 382 | Ga0466958_0023271 | 3300045836 | Bacteria | 3634 |
| 383 | Ga0466958_0039365 | 3300045836 | Bacteria | 2840 |
| 384 | Ga0466958_0041198 | 3300045836 | Bacteria | 2778 |
| 385 | Ga0466958_0060810 | 3300045836 | Bacteria | 2300 |
| 386 | Ga0466958_0069955 | 3300045836 | Bacteria | 2147 |
| 387 | Ga0466958_0224159 | 3300045836 | Bacteria | 1200 |
| 388 | Ga0466958_0240136 | 3300045836 | Bacteria | 1158 |
| 389 | Ga0466967_0007977 | 3300045976 | Bacteria | 7704 |
| 390 | Ga0466967_0008602 | 3300045976 | Bacteria | 7502 |
| 391 | Ga0466967_0080963 | 3300045976 | Bacteria | 2932 |
| 392 | Ga0466967_0211681 | 3300045976 | Bacteria | 1839 |
| 393 | Ga0466967_0222003 | 3300045976 | Bacteria | 1796 |
| 394 | Ga0466967_0361383 | 3300045976 | Bacteria | 1407 |
| 395 | Ga0466967_0396298 | 3300045976 | Bacteria | 1342 |
| 396 | Ga0466967_0398970 | 3300045976 | Bacteria | 1338 |
| 397 | Ga0466967_0661002 | 3300045976 | Bacteria | 1034 |
| 398 | Ga0466967_0830978 | 3300045976 | Bacteria | 918 |
| 399 | Ga0495592_0076660 | 3300046454 | Bacteria | 2425 |
| 400 | Ga0495592_0346917 | 3300046454 | Bacteria | 953 |
| 401 | Ga0495603_0007570 | 3300046455 | Bacteria | 6534 |
| 402 | Ga0495603_0047885 | 3300046455 | Bacteria | 2545 |
| 403 | Ga0495641_0134061 | 3300046461 | Unclassified | 1106 |
| 404 | Ga0495651_0006559 | 3300046462 | Bacteria | 8886 |
| 405 | Ga0495653_0028675 | 3300046463 | Bacteria | 4449 |
| 406 | Ga0495653_0132989 | 3300046463 | Bacteria | 1758 |
| 407 | Ga0495650_0000053 | 3300046471 | Bacteria | 316684 |
| 408 | Ga0495580_0456348 | 3300046472 | Bacteria | 857 |
| 409 | Ga0495582_0092130 | 3300046473 | Bacteria | 1690 |
| 410 | Ga0495664_0000036 | 3300046477 | Bacteria | 71543 |
| 411 | Ga0495584_0076277 | 3300046491 | Bacteria | 1686 |
| 412 | Ga0495594_0268053 | 3300046499 | Bacteria | 973 |
| 413 | Ga0495596_0197542 | 3300046500 | Bacteria | 782 |
| 414 | Ga0495608_0057911 | 3300046511 | Bacteria | 2555 |
| 415 | Ga0495608_0191266 | 3300046511 | Bacteria | 1292 |
| 416 | Ga0495618_0000875 | 3300046514 | Bacteria | 20807 |
| 417 | Ga0495618_0009790 | 3300046514 | Bacteria | 5794 |
| 418 | Ga0495628_0036020 | 3300046516 | Bacteria | 3974 |
| 419 | Ga0495630_0180663 | 3300046517 | Bacteria | 1609 |
| 420 | Ga0495630_0262199 | 3300046517 | Bacteria | 1320 |
| 421 | Ga0495630_0403544 | 3300046517 | Bacteria | 1047 |
| 422 | Ga0495666_0231874 | 3300046526 | Bacteria | 844 |
| 423 | Ga0495652_0028874 | 3300046529 | Bacteria | 4876 |
| 424 | Ga0495652_0035637 | 3300046529 | Bacteria | 4330 |
| 425 | Ga0495665_0080189 | 3300046531 | Bacteria | 1717 |
| 426 | Ga0495640_0036389 | 3300046533 | Bacteria | 3478 |
| 427 | Ga0495587_0234375 | 3300046536 | Bacteria | 1034 |
| 428 | Ga0495645_0091105 | 3300046543 | Bacteria | 2178 |
| 429 | Ga0495667_0001023 | 3300046559 | Bacteria | 18094 |
| 430 | Ga0495667_0159055 | 3300046559 | Bacteria | 1453 |
| 431 | Ga0495656_0127186 | 3300046615 | Bacteria | 1209 |
| 432 | Ga0495634_0023315 | 3300046642 | Bacteria | 4352 |
| 433 | Ga0495634_0029954 | 3300046642 | Bacteria | 3763 |
| 434 | Ga0495635_0079599 | 3300046663 | Bacteria | 2242 |
| 435 | Ga0495635_0083822 | 3300046663 | Bacteria | 2181 |
| 436 | Ga0495657_0021964 | 3300046675 | Bacteria | 4575 |
| 437 | Ga0495657_0183327 | 3300046675 | Bacteria | 1283 |
| 438 | Ga0495657_0365758 | 3300046675 | Bacteria | 852 |
| 439 | Ga0495646_0040775 | 3300046680 | Bacteria | 2857 |
| 440 | Ga0495646_0125171 | 3300046680 | Bacteria | 1451 |
| 441 | Ga0495647_0033918 | 3300046681 | Bacteria | 1910 |
| 442 | Ga0495647_0079646 | 3300046681 | Bacteria | 1326 |
| 443 | Ga0495658_0035435 | 3300046683 | Bacteria | 2746 |
| 444 | Ga0495613_0012677 | 3300046689 | Bacteria | 6268 |
| 445 | Ga0495613_0128797 | 3300046689 | Bacteria | 1813 |
| 446 | Ga0495613_0205474 | 3300046689 | Bacteria | 1387 |
| 447 | Ga0495613_0332992 | 3300046689 | Bacteria | 1046 |
| 448 | Ga0495624_0178431 | 3300046690 | Bacteria | 1295 |
| 449 | Ga0495600_0125680 | 3300046809 | Bacteria | 1668 |
| 450 | Ga0495604_0334136 | 3300047317 | Bacteria | 1010 |
| 451 | Ga0495674_0084744 | 3300047319 | Bacteria | 2715 |
| 452 | Ga0495674_0155618 | 3300047319 | Bacteria | 1915 |
| 453 | Ga0495674_0206862 | 3300047319 | Bacteria | 1627 |
| 454 | Ga0495676_0071399 | 3300047321 | Bacteria | 2669 |
| 455 | Ga0495680_0009812 | 3300047322 | Bacteria | 8587 |
| 456 | Ga0495680_0080447 | 3300047322 | Bacteria | 2462 |
| 457 | Ga0495684_0014186 | 3300047471 | Bacteria | 6130 |
| 458 | Ga0495684_0015619 | 3300047471 | Bacteria | 5844 |
| 459 | Ga0495684_0057504 | 3300047471 | Bacteria | 2964 |
| 460 | Ga0495602_0057336 | 3300048088 | Bacteria | 3417 |
| 461 | Ga0496100_0034935 | 3300048903 | Bacteria | 3159 |
| 462 | Ga0496100_0044855 | 3300048903 | Bacteria | 2834 |
| 463 | Ga0496100_0086206 | 3300048903 | Bacteria | 2132 |
| 464 | Ga0496100_0329586 | 3300048903 | Bacteria | 1149 |
| 465 | Ga0496100_0334780 | 3300048903 | Bacteria | 1140 |
| 466 | Ga0496101_0071832 | 3300048904 | Bacteria | 2538 |
| 467 | Ga0496101_0090734 | 3300048904 | Bacteria | 2273 |
| 468 | Ga0496101_0403433 | 3300048904 | Bacteria | 1077 |
| 469 | Ga0496102_0031622 | 3300048905 | Bacteria | 4748 |
| 470 | Ga0496102_0152077 | 3300048905 | Bacteria | 2175 |
| 471 | Ga0496104_0000033 | 3300048907 | Bacteria | 189758 |
| 472 | Ga0496104_0007061 | 3300048907 | Bacteria | 9904 |
| 473 | Ga0496104_0012549 | 3300048907 | Bacteria | 7624 |
| 474 | Ga0496104_0093699 | 3300048907 | Bacteria | 2873 |
| 475 | Ga0496104_0338389 | 3300048907 | Bacteria | 1418 |
| 476 | Ga0496104_1040083 | 3300048907 | Bacteria | 723 |
| 477 | Ga0496105_0015422 | 3300048908 | Bacteria | 6090 |
| 478 | Ga0496105_0099074 | 3300048908 | Bacteria | 2407 |
| 479 | Ga0496105_0164230 | 3300048908 | Bacteria | 1822 |
| 480 | Ga0496106_0036395 | 3300048909 | Bacteria | 3682 |
| 481 | Ga0496106_0049891 | 3300048909 | Bacteria | 3153 |
| 482 | Ga0496107_0007930 | 3300048910 | Bacteria | 7329 |
| 483 | Ga0496107_0041472 | 3300048910 | Bacteria | 3304 |
| 484 | Ga0496107_0070849 | 3300048910 | Bacteria | 2532 |
| 485 | Ga0496108_0006408 | 3300048911 | Bacteria | 9542 |
| 486 | Ga0496108_0141236 | 3300048911 | Bacteria | 2075 |
| 487 | Ga0496108_0337704 | 3300048911 | Bacteria | 1314 |
| 488 | Ga0496108_0684660 | 3300048911 | Bacteria | 890 |
| 489 | Ga0496109_0000119 | 3300048912 | Bacteria | 81869 |
| 490 | Ga0496109_0035786 | 3300048912 | Bacteria | 4482 |
| 491 | Ga0496109_0253050 | 3300048912 | Bacteria | 1659 |
| 492 | Ga0496109_0298425 | 3300048912 | Bacteria | 1519 |
| 493 | Ga0496109_0473793 | 3300048912 | Bacteria | 1182 |
| 494 | Ga0496110_0000046 | 3300048913 | Bacteria | 60653 |
| 495 | Ga0496110_0010360 | 3300048913 | Bacteria | 7579 |
| 496 | Ga0496110_0023147 | 3300048913 | Bacteria | 5283 |
| 497 | Ga0496111_0002403 | 3300048914 | Bacteria | 11299 |
| 498 | Ga0496111_0002592 | 3300048914 | Bacteria | 10944 |
| 499 | Ga0496111_0033355 | 3300048914 | Bacteria | 3671 |
| 500 | Ga0496111_0036337 | 3300048914 | Bacteria | 3522 |
| 501 | Ga0496112_0002347 | 3300048915 | Bacteria | 15192 |
| 502 | Ga0496112_0005144 | 3300048915 | Bacteria | 11247 |
| 503 | Ga0496112_0034280 | 3300048915 | Bacteria | 4939 |
| 504 | Ga0496112_0144060 | 3300048915 | Bacteria | 2351 |
| 505 | Ga0496112_0369705 | 3300048915 | Bacteria | 1375 |
| 506 | Ga0496113_0002780 | 3300048916 | Bacteria | 10293 |
| 507 | Ga0496113_0009800 | 3300048916 | Bacteria | 6302 |
| 508 | Ga0496113_0093058 | 3300048916 | Bacteria | 2326 |
| 509 | Ga0496114_0001493 | 3300048917 | Bacteria | 17771 |
| 510 | Ga0496114_0013504 | 3300048917 | Bacteria | 6550 |
| 511 | Ga0496114_0093555 | 3300048917 | Bacteria | 2556 |
| 512 | Ga0496115_0370071 | 3300048918 | Bacteria | 1166 |
| 513 | Ga0496119_0078970 | 3300048922 | Bacteria | 1902 |
| 514 | Ga0501031_0018002 | 3300049568 | Bacteria | 4596 |
| 515 | Ga0501031_0107433 | 3300049568 | Bacteria | 1822 |
| 516 | Ga0501032_0006397 | 3300049569 | Bacteria | 8668 |
| 517 | Ga0501032_0010737 | 3300049569 | Bacteria | 6592 |
| 518 | Ga0501032_0126199 | 3300049569 | Bacteria | 1690 |
| 519 | Ga0501032_0275405 | 3300049569 | Bacteria | 1090 |
| 520 | Ga0501033_0006867 | 3300049570 | Bacteria | 8888 |
| 521 | Ga0501033_0041858 | 3300049570 | Bacteria | 3416 |
| 522 | Ga0501034_0036214 | 3300049571 | Bacteria | 5000 |
| 523 | Ga0501034_0116761 | 3300049571 | Bacteria | 2656 |
| 524 | Ga0501036_0009924 | 3300049572 | Bacteria | 7843 |
| 525 | Ga0501036_0040505 | 3300049572 | Bacteria | 3940 |
| 526 | Ga0501036_0043491 | 3300049572 | Bacteria | 3804 |
| 527 | Ga0501037_0010808 | 3300049573 | Bacteria | 6709 |
| 528 | Ga0501037_0063847 | 3300049573 | Bacteria | 2684 |
| 529 | Ga0501037_0102158 | 3300049573 | Bacteria | 2068 |
| 530 | Ga0501037_0612052 | 3300049573 | Bacteria | 731 |
| 531 | Ga0501038_0015020 | 3300049574 | Bacteria | 7053 |
| 532 | Ga0501038_0026437 | 3300049574 | Bacteria | 5169 |
| 533 | Ga0501038_0432809 | 3300049574 | Bacteria | 1014 |
| 534 | Ga0501038_0587441 | 3300049574 | Bacteria | 844 |
| 535 | Ga0501039_0048377 | 3300049575 | Bacteria | 3287 |
| 536 | Ga0501040_0003675 | 3300049576 | Bacteria | 9935 |
| 537 | Ga0501040_0018215 | 3300049576 | Bacteria | 4662 |
| 538 | Ga0501040_0108162 | 3300049576 | Bacteria | 1944 |
| 539 | Ga0501040_0347425 | 3300049576 | Bacteria | 1062 |
| 540 | Ga0501041_0078505 | 3300049577 | Bacteria | 2031 |
| 541 | Ga0501041_0227689 | 3300049577 | Bacteria | 1170 |
| 542 | Ga0501042_0002692 | 3300049578 | Bacteria | 10937 |
| 543 | Ga0501042_0072657 | 3300049578 | Bacteria | 2461 |
| 544 | Ga0501042_0097932 | 3300049578 | Bacteria | 2108 |
| 545 | Ga0501042_0275569 | 3300049578 | Bacteria | 1215 |
| 546 | Ga0501043_0007275 | 3300049579 | Bacteria | 8787 |
| 547 | Ga0501043_0066021 | 3300049579 | Bacteria | 2841 |
| 548 | Ga0501046_0012939 | 3300049580 | Bacteria | 7090 |
| 549 | Ga0501046_0043183 | 3300049580 | Bacteria | 3590 |
| 550 | Ga0501047_0035150 | 3300049581 | Bacteria | 4841 |
| 551 | Ga0501047_0062404 | 3300049581 | Bacteria | 3594 |
| 552 | Ga0501048_0006396 | 3300049582 | Bacteria | 8955 |
| 553 | Ga0501048_0021652 | 3300049582 | Bacteria | 4705 |
| 554 | Ga0501048_0046928 | 3300049582 | Bacteria | 3083 |
| 555 | Ga0501048_0068149 | 3300049582 | Bacteria | 2514 |
| 556 | Ga0501067_0017910 | 3300049583 | Bacteria | 3922 |
| 557 | Ga0501068_0000910 | 3300049584 | Bacteria | 15453 |
| 558 | Ga0501068_0079806 | 3300049584 | Bacteria | 2007 |
| 559 | Ga0501068_0268462 | 3300049584 | Bacteria | 1089 |
| 560 | Ga0501069_0008925 | 3300049585 | Bacteria | 5286 |
| 561 | Ga0501069_0026213 | 3300049585 | Bacteria | 3192 |
| 562 | Ga0501070_0001280 | 3300049586 | Bacteria | 22582 |
| 563 | Ga0501070_0078679 | 3300049586 | Bacteria | 2728 |
| 564 | Ga0501070_0150529 | 3300049586 | Bacteria | 1920 |
| 565 | Ga0501070_0441395 | 3300049586 | Bacteria | 1050 |
| 566 | Ga0501071_0009751 | 3300049587 | Bacteria | 6407 |
| 567 | Ga0501071_0032431 | 3300049587 | Bacteria | 3709 |
| 568 | Ga0501071_0042360 | 3300049587 | Bacteria | 3262 |
| 569 | Ga0501071_0543306 | 3300049587 | Bacteria | 892 |
| 570 | Ga0501072_0008261 | 3300049588 | Bacteria | 7908 |
| 571 | Ga0501072_0016558 | 3300049588 | Bacteria | 5663 |
| 572 | Ga0501073_0003796 | 3300049589 | Bacteria | 11355 |
| 573 | Ga0501073_0007749 | 3300049589 | Bacteria | 7972 |
| 574 | Ga0501074_0015585 | 3300049590 | Bacteria | 5524 |
| 575 | Ga0501074_0036830 | 3300049590 | Bacteria | 3544 |
| 576 | Ga0501075_0043194 | 3300049591 | Bacteria | 3380 |
| 577 | Ga0501076_0013410 | 3300049592 | Bacteria | 6145 |
| 578 | Ga0501076_0013836 | 3300049592 | Bacteria | 6056 |
| 579 | Ga0501076_0021274 | 3300049592 | Bacteria | 4975 |
| 580 | Ga0501076_0534007 | 3300049592 | Bacteria | 967 |
| 581 | Ga0501077_0005005 | 3300049593 | Bacteria | 8035 |
| 582 | Ga0501077_0037863 | 3300049593 | Bacteria | 3071 |
| 583 | Ga0501077_0088916 | 3300049593 | Bacteria | 1958 |
| 584 | Ga0501077_0091785 | 3300049593 | Bacteria | 1924 |
| 585 | Ga0501080_0008481 | 3300049742 | Bacteria | 9314 |
| 586 | Ga0501081_0008063 | 3300049743 | Bacteria | 6836 |
| 587 | Ga0501081_0020598 | 3300049743 | Bacteria | 4395 |
| 588 | Ga0501081_0381018 | 3300049743 | Bacteria | 1042 |
| 589 | Ga0501081_0547884 | 3300049743 | Bacteria | 864 |
| 590 | Ga0501081_0548602 | 3300049743 | Unclassified | 863 |
| 591 | Ga0501083_0012763 | 3300049744 | Bacteria | 5875 |
| 592 | Ga0501083_0087312 | 3300049744 | Bacteria | 2062 |
| 593 | Ga0501083_0569675 | 3300049744 | Bacteria | 737 |
| 594 | Ga0501035_0309251 | 3300049822 | Bacteria | 1330 |
| 595 | Ga0501044_0020066 | 3300049823 | Bacteria | 7136 |
| 596 | Ga0501044_0141694 | 3300049823 | Bacteria | 2392 |
| 597 | Ga0501045_0010528 | 3300049824 | Bacteria | 6476 |
| 598 | Ga0501045_0214904 | 3300049824 | Bacteria | 1432 |
| 599 | Ga0501045_0272405 | 3300049824 | Bacteria | 1260 |
| 600 | nmdc:mga03n38_37482_c1 | 3300050490 | Bacteria | 2091 |
| 601 | nmdc:mga00v17_235458_c1 | 3300050491 | Bacteria | 1187 |
| 602 | nmdc:mga0yw44_41270_c1 | 3300050492 | Bacteria | 1622 |
| 603 | nmdc:mga07m45_240461_c1 | 3300050496 | Bacteria | 1053 |
| 604 | nmdc:mga05p37_19361_c1 | 3300050507 | Bacteria | 8233 |
| 605 | nmdc:mga05p37_19787_c1 | 3300050507 | Bacteria | 8143 |
| 606 | nmdc:mga05p37_55699_c1 | 3300050507 | Bacteria | 4867 |
| 607 | nmdc:mga0qj67_94156_c1 | 3300050509 | Bacteria | 2409 |
| 608 | nmdc:mga06r32_500796_c1 | 3300050510 | Bacteria | 1192 |
| 609 | nmdc:mga08y16_734401_c1 | 3300050511 | Bacteria | 984 |
| 610 | nmdc:mga0n895_279587_c1 | 3300050512 | Bacteria | 1693 |
| 611 | nmdc:mga0n895_454364_c1 | 3300050512 | Bacteria | 1293 |
| 612 | nmdc:mga0rr50_42833_c1 | 3300050513 | Bacteria | 3309 |
| 613 | nmdc:mga0rr50_7412_c1 | 3300050513 | Bacteria | 6765 |
| 614 | nmdc:mga08x19_7111_c1 | 3300050514 | Bacteria | 6644 |
| 615 | nmdc:mga08x19_842411_c1 | 3300050514 | Unclassified | 651 |
| 616 | nmdc:mga08x19_98170_c1 | 3300050514 | Bacteria | 1940 |
| 617 | nmdc:mga0a205_42204_c1 | 3300050515 | Bacteria | 4395 |
| 618 | Ga0495601_0136022 | 3300053077 | Bacteria | 1602 |
| 619 | Ga0495612_0000103 | 3300053078 | Bacteria | 36230 |
| 620 | Ga0495612_0016370 | 3300053078 | Bacteria | 2972 |
| 621 | Ga0495612_0076012 | 3300053078 | Bacteria | 1406 |
| 622 | Ga0495595_0010720 | 3300053084 | Bacteria | 3818 |
| 623 | Ga0495595_0014354 | 3300053084 | Bacteria | 3360 |
| 624 | Ga0495619_0011725 | 3300053085 | Bacteria | 5523 |
| 625 | Ga0495619_0084045 | 3300053085 | Bacteria | 2148 |
| 626 | Ga0495619_0098198 | 3300053085 | Bacteria | 1991 |
| 627 | Ga0501084_0098013 | 3300054114 | Bacteria | 2461 |
| 628 | Ga0590077_020669 | 3300059426 | Bacteria | 1398 |
| 629 | Ga0501082_0007829 | 3300060353 | Bacteria | 9223 |
| 630 | Ga0501082_0118613 | 3300060353 | Bacteria | 2292 |
| 631 | Ga0466962_0049330 | 3300061719 | Bacteria | 2012 |
| 632 | Ga0466962_0077362 | 3300061719 | Bacteria | 1590 |
| 633 | Ga0530510_0004994 | 3300061734 | Bacteria | 9161 |
| 634 | Ga0530510_0145467 | 3300061734 | Bacteria | 1748 |
| 635 | Ga0530510_0279685 | 3300061734 | Bacteria | 1246 |
| 636 | Ga0530510_0436858 | 3300061734 | Bacteria | 989 |
| 637 | Ga0530510_0494277 | 3300061734 | Bacteria | 927 |
| 638 | Ga0530510_0712344 | 3300061734 | Unclassified | 765 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050512 | nmdc:mga0n895_454364_c1 | nmdc:mga0n895_454364_c1_705_1277 | 143 |
| 2 | 3300050514 | nmdc:mga08x19_842411_c1 | nmdc:mga08x19_842411_c1_65_637 | 143 |
| 3 | 3300049744 | Ga0501083_0569675 | Ga0501083_0569675_31_621 | 144 |
| 4 | 3300013306 | Ga0163162_10886361 | Ga0163162_108863612 | 153 |
| 5 | 3300046531 | Ga0495665_0080189 | Ga0495665_0080189_28_540 | 154 |
| 6 | 3300048907 | Ga0496104_0338389 | Ga0496104_0338389_23_640 | 154 |
| 7 | 3300046680 | Ga0495646_0125171 | Ga0495646_0125171_815_1438 | 165 |
| 8 | 3300037068 | Ga0373925_0346983 | Ga0373925_0346983_488_1165 | 170 |
| 9 | 3300046455 | Ga0495603_0007570 | Ga0495603_0007570_563_1240 | 170 |
| 10 | 3300046461 | Ga0495641_0134061 | Ga0495641_0134061_425_1096 | 170 |
| 11 | 3300046517 | Ga0495630_0262199 | Ga0495630_0262199_594_1295 | 170 |
| 12 | 3300046642 | Ga0495634_0029954 | Ga0495634_0029954_2674_3351 | 170 |
| 13 | 3300046681 | Ga0495647_0079646 | Ga0495647_0079646_556_1233 | 170 |
| 14 | 3300046689 | Ga0495613_0012677 | Ga0495613_0012677_2537_3214 | 170 |
| 15 | 3300046689 | Ga0495613_0332992 | Ga0495613_0332992_222_923 | 170 |
| 16 | 3300053085 | Ga0495619_0084045 | Ga0495619_0084045_808_1509 | 170 |
| 17 | 3300050490 | nmdc:mga03n38_37482_c1 | nmdc:mga03n38_37482_c1_1096_1755 | 172 |
| 18 | 3300050491 | nmdc:mga00v17_235458_c1 | nmdc:mga00v17_235458_c1_36_695 | 172 |
| 19 | 3300050496 | nmdc:mga07m45_240461_c1 | nmdc:mga07m45_240461_c1_271_930 | 172 |
| 20 | 3300046681 | Ga0495647_0033918 | Ga0495647_0033918_1248_1859 | 173 |
| 21 | 3300006051 | Ga0075364_10036616 | Ga0075364_100366162 | 174 |
| 22 | 3300045049 | Ga0466959_0710608 | Ga0466959_0710608_42_653 | 176 |
| 23 | 3300046455 | Ga0495603_0047885 | Ga0495603_0047885_1543_2121 | 176 |
| 24 | 3300046473 | Ga0495582_0092130 | Ga0495582_0092130_156_734 | 176 |
| 25 | 3300046683 | Ga0495658_0035435 | Ga0495658_0035435_1472_2050 | 176 |
| 26 | 3300046689 | Ga0495613_0205474 | Ga0495613_0205474_702_1280 | 176 |
| 27 | 3300048912 | Ga0496109_0298425 | Ga0496109_0298425_17_625 | 176 |
| 28 | 3300049582 | Ga0501048_0021652 | Ga0501048_0021652_3282_3884 | 176 |
| 29 | 3300006852 | Ga0075433_10432254 | Ga0075433_104322542 | 178 |
| 30 | 3300006871 | Ga0075434_100080236 | Ga0075434_1000802363 | 178 |
| 31 | 3300009553 | Ga0105249_10165729 | Ga0105249_101657292 | 178 |
| 32 | 3300013296 | Ga0157374_10782209 | Ga0157374_107822091 | 178 |
| 33 | 3300014745 | Ga0157377_10061972 | Ga0157377_100619722 | 178 |
| 34 | 3300025927 | Ga0207687_10435085 | Ga0207687_104350851 | 178 |
| 35 | 3300048903 | Ga0496100_0034935 | Ga0496100_0034935_550_1227 | 178 |
| 36 | 3300048904 | Ga0496101_0090734 | Ga0496101_0090734_390_1067 | 178 |
| 37 | 3300048907 | Ga0496104_0093699 | Ga0496104_0093699_2000_2677 | 178 |
| 38 | 3300048911 | Ga0496108_0141236 | Ga0496108_0141236_1312_1989 | 178 |
| 39 | 3300048913 | Ga0496110_0023147 | Ga0496110_0023147_3764_4441 | 178 |
| 40 | 3300048914 | Ga0496111_0033355 | Ga0496111_0033355_2207_2884 | 178 |
| 41 | 3300044684 | Ga0466966_0016985 | Ga0466966_0016985_1855_2538 | 179 |
| 42 | 3300044693 | Ga0466961_0004704 | Ga0466961_0004704_2829_3512 | 179 |
| 43 | 3300044694 | Ga0466963_0013255 | Ga0466963_0013255_2190_2873 | 179 |
| 44 | 3300044719 | Ga0466971_0005233 | Ga0466971_0005233_348_1031 | 179 |
| 45 | 3300044842 | Ga0466957_0177667 | Ga0466957_0177667_354_1037 | 179 |
| 46 | 3300045049 | Ga0466959_0018636 | Ga0466959_0018636_1527_2210 | 179 |
| 47 | 3300061719 | Ga0466962_0077362 | Ga0466962_0077362_633_1316 | 179 |
| 48 | 3300009551 | Ga0105238_10087200 | Ga0105238_100872004 | 180 |
| 49 | 3300013104 | Ga0157370_10011112 | Ga0157370_100111129 | 180 |
| 50 | 3300025945 | Ga0207679_10348869 | Ga0207679_103488692 | 180 |
| 51 | 3300026142 | Ga0207698_10191504 | Ga0207698_101915043 | 180 |
| 52 | 3300044735 | Ga0466968_0233436 | Ga0466968_0233436_19_693 | 180 |
| 53 | 3300045049 | Ga0466959_0053107 | Ga0466959_0053107_1619_2302 | 180 |
| 54 | 3300044684 | Ga0466966_0273347 | Ga0466966_0273347_123_812 | 181 |
| 55 | 3300045976 | Ga0466967_0361383 | Ga0466967_0361383_397_1068 | 182 |
| 56 | 3300039437 | Ga0436365_1758755 | Ga0436365_1758755_1966_2592 | 184 |
| 57 | 3300039450 | Ga0436363_0760459 | Ga0436363_0760459_12414_13040 | 184 |
| 58 | 3300005458 | Ga0070681_10224447 | Ga0070681_102244472 | 185 |
| 59 | 3300005539 | Ga0068853_100083654 | Ga0068853_1000836543 | 185 |
| 60 | 3300013307 | Ga0157372_10264823 | Ga0157372_102648233 | 185 |
| 61 | 3300025918 | Ga0207662_10113456 | Ga0207662_101134563 | 185 |
| 62 | 3300025919 | Ga0207657_10417656 | Ga0207657_104176562 | 185 |
| 63 | 3300025945 | Ga0207679_10056979 | Ga0207679_100569794 | 185 |
| 64 | 3300037853 | Ga0436364_0811094 | Ga0436364_0811094_3083_3766 | 185 |
| 65 | 3300049574 | Ga0501038_0432809 | Ga0501038_0432809_137_850 | 188 |
| 66 | 3300049578 | Ga0501042_0097932 | Ga0501042_0097932_1100_1732 | 188 |
| 67 | 3300049587 | Ga0501071_0543306 | Ga0501071_0543306_124_837 | 188 |
| 68 | 3300049593 | Ga0501077_0088916 | Ga0501077_0088916_1102_1815 | 188 |
| 69 | 3300049743 | Ga0501081_0547884 | Ga0501081_0547884_133_846 | 188 |
| 70 | 3300061734 | Ga0530510_0279685 | Ga0530510_0279685_248_961 | 188 |
| 71 | 3300044656 | Ga0466969_0029449 | Ga0466969_0029449_1404_2078 | 189 |
| 72 | 3300044693 | Ga0466961_0076742 | Ga0466961_0076742_959_1633 | 189 |
| 73 | 3300044694 | Ga0466963_0000104 | Ga0466963_0000104_7355_8029 | 189 |
| 74 | 3300044765 | Ga0466970_0014568 | Ga0466970_0014568_432_1106 | 189 |
| 75 | 3300045049 | Ga0466959_0012687 | Ga0466959_0012687_4683_5357 | 189 |
| 76 | 3300045836 | Ga0466958_0004120 | Ga0466958_0004120_2273_2947 | 189 |
| 77 | 3300037466 | Ga0395898_0000894 | Ga0395898_0000894_7970_8662 | 192 |
| 78 | 3300046615 | Ga0495656_0127186 | Ga0495656_0127186_527_1153 | 192 |
| 79 | 3300049593 | Ga0501077_0091785 | Ga0501077_0091785_771_1451 | 196 |
| 80 | 3300049743 | Ga0501081_0548602 | Ga0501081_0548602_160_840 | 196 |
| 81 | 3300049824 | Ga0501045_0214904 | Ga0501045_0214904_403_1083 | 196 |
| 82 | 3300061734 | Ga0530510_0712344 | Ga0530510_0712344_10_690 | 196 |
| 83 | 3300006847 | Ga0075431_100046842 | Ga0075431_1000468426 | 197 |
| 84 | 3300032002 | Ga0307416_100572323 | Ga0307416_1005723232 | 197 |
| 85 | 3300039450 | Ga0436363_0595893 | Ga0436363_0595893_626_1309 | 197 |
| 86 | 3300005981 | Ga0081538_10001726 | Ga0081538_1000172614 | 198 |
| 87 | 3300031824 | Ga0307413_10525810 | Ga0307413_105258101 | 198 |
| 88 | 3300031852 | Ga0307410_10488781 | Ga0307410_104887812 | 198 |
| 89 | 3300031901 | Ga0307406_10582182 | Ga0307406_105821821 | 198 |
| 90 | 3300031995 | Ga0307409_100331132 | Ga0307409_1003311322 | 198 |
| 91 | 3300046477 | Ga0495664_0000036 | Ga0495664_0000036_58248_58934 | 198 |
| 92 | 3300046500 | Ga0495596_0197542 | Ga0495596_0197542_35_694 | 198 |
| 93 | 3300048907 | Ga0496104_0000033 | Ga0496104_0000033_159343_160029 | 198 |
| 94 | 3300048913 | Ga0496110_0000046 | Ga0496110_0000046_39447_40133 | 198 |
| 95 | 3300048914 | Ga0496111_0002403 | Ga0496111_0002403_4846_5532 | 198 |
| 96 | 3300006844 | Ga0075428_100037894 | Ga0075428_1000378946 | 199 |
| 97 | 3300006880 | Ga0075429_100230296 | Ga0075429_1002302961 | 199 |
| 98 | 3300009147 | Ga0114129_10226877 | Ga0114129_102268775 | 199 |
| 99 | 3300049592 | Ga0501076_0534007 | Ga0501076_0534007_73_774 | 199 |
| 100 | 3300050507 | nmdc:mga05p37_19787_c1 | nmdc:mga05p37_19787_c1_6375_7046 | 199 |
| 101 | 3300050509 | nmdc:mga0qj67_94156_c1 | nmdc:mga0qj67_94156_c1_1469_2140 | 199 |
| 102 | 3300050511 | nmdc:mga08y16_734401_c1 | nmdc:mga08y16_734401_c1_284_955 | 199 |
| 103 | 3300005329 | Ga0070683_100427051 | Ga0070683_1004270512 | 200 |
| 104 | 3300005336 | Ga0070680_100002327 | Ga0070680_10000232711 | 200 |
| 105 | 3300005344 | Ga0070661_100008448 | Ga0070661_1000084484 | 200 |
| 106 | 3300005366 | Ga0070659_100073669 | Ga0070659_1000736693 | 200 |
| 107 | 3300005435 | Ga0070714_100374846 | Ga0070714_1003748462 | 200 |
| 108 | 3300005436 | Ga0070713_100019157 | Ga0070713_1000191573 | 200 |
| 109 | 3300005439 | Ga0070711_100434604 | Ga0070711_1004346042 | 200 |
| 110 | 3300005539 | Ga0068853_100519898 | Ga0068853_1005198982 | 200 |
| 111 | 3300005616 | Ga0068852_100502267 | Ga0068852_1005022672 | 200 |
| 112 | 3300006173 | Ga0070716_100090231 | Ga0070716_1000902312 | 200 |
| 113 | 3300006844 | Ga0075428_100314695 | Ga0075428_1003146952 | 200 |
| 114 | 3300010375 | Ga0105239_11206251 | Ga0105239_112062511 | 200 |
| 115 | 3300013105 | Ga0157369_10166132 | Ga0157369_101661324 | 200 |
| 116 | 3300020081 | Ga0206354_11348025 | Ga0206354_113480251 | 200 |
| 117 | 3300020082 | Ga0206353_10596252 | Ga0206353_105962526 | 200 |
| 118 | 3300021384 | Ga0213876_10150506 | Ga0213876_101505061 | 200 |
| 119 | 3300025909 | Ga0207705_10217250 | Ga0207705_102172503 | 200 |
| 120 | 3300025912 | Ga0207707_10135132 | Ga0207707_101351322 | 200 |
| 121 | 3300025915 | Ga0207693_10212928 | Ga0207693_102129282 | 200 |
| 122 | 3300025916 | Ga0207663_10107181 | Ga0207663_101071812 | 200 |
| 123 | 3300025917 | Ga0207660_10298995 | Ga0207660_102989952 | 200 |
| 124 | 3300025919 | Ga0207657_10049707 | Ga0207657_100497073 | 200 |
| 125 | 3300025921 | Ga0207652_10142052 | Ga0207652_101420523 | 200 |
| 126 | 3300025928 | Ga0207700_10017046 | Ga0207700_100170465 | 200 |
| 127 | 3300025932 | Ga0207690_10060649 | Ga0207690_100606492 | 200 |
| 128 | 3300026041 | Ga0207639_10209385 | Ga0207639_102093851 | 200 |
| 129 | 3300026078 | Ga0207702_10198515 | Ga0207702_101985153 | 200 |
| 130 | 3300028556 | Ga0265337_1005371 | Ga0265337_10053714 | 200 |
| 131 | 3300028558 | Ga0265326_10000282 | Ga0265326_1000028213 | 200 |
| 132 | 3300028563 | Ga0265319_1000065 | Ga0265319_100006560 | 200 |
| 133 | 3300028577 | Ga0265318_10008234 | Ga0265318_100082345 | 200 |
| 134 | 3300028654 | Ga0265322_10006583 | Ga0265322_100065833 | 200 |
| 135 | 3300028666 | Ga0265336_10000001 | Ga0265336_10000001377 | 200 |
| 136 | 3300028800 | Ga0265338_10000004 | Ga0265338_10000004505 | 200 |
| 137 | 3300031240 | Ga0265320_10156864 | Ga0265320_101568642 | 200 |
| 138 | 3300031247 | Ga0265340_10000002 | Ga0265340_10000002505 | 200 |
| 139 | 3300031824 | Ga0307413_10056524 | Ga0307413_100565242 | 200 |
| 140 | 3300031901 | Ga0307406_10259615 | Ga0307406_102596152 | 200 |
| 141 | 3300031903 | Ga0307407_10187715 | Ga0307407_101877152 | 200 |
| 142 | 3300031911 | Ga0307412_10719590 | Ga0307412_107195901 | 200 |
| 143 | 3300032126 | Ga0307415_100010737 | Ga0307415_1000107376 | 200 |
| 144 | 3300032126 | Ga0307415_100058533 | Ga0307415_1000585332 | 200 |
| 145 | 3300037068 | Ga0373925_0280645 | Ga0373925_0280645_299_991 | 200 |
| 146 | 3300037418 | Ga0395900_0094185 | Ga0395900_0094185_2130_2795 | 200 |
| 147 | 3300037418 | Ga0395900_0151152 | Ga0395900_0151152_33_686 | 200 |
| 148 | 3300037471 | Ga0395905_0027590 | Ga0395905_0027590_4639_5304 | 200 |
| 149 | 3300038443 | Ga0395901_0133342 | Ga0395901_0133342_245_910 | 200 |
| 150 | 3300038443 | Ga0395901_0523142 | Ga0395901_0523142_60_728 | 200 |
| 151 | 3300039437 | Ga0436365_1906563 | Ga0436365_1906563_68_754 | 200 |
| 152 | 3300044694 | Ga0466963_0408613 | Ga0466963_0408613_236_901 | 200 |
| 153 | 3300045976 | Ga0466967_0007977 | Ga0466967_0007977_1720_2385 | 200 |
| 154 | 3300045976 | Ga0466967_0080963 | Ga0466967_0080963_1539_2207 | 200 |
| 155 | 3300045976 | Ga0466967_0661002 | Ga0466967_0661002_204_896 | 200 |
| 156 | 3300046472 | Ga0495580_0456348 | Ga0495580_0456348_132_824 | 200 |
| 157 | 3300046514 | Ga0495618_0000875 | Ga0495618_0000875_1149_1865 | 200 |
| 158 | 3300046526 | Ga0495666_0231874 | Ga0495666_0231874_74_766 | 200 |
| 159 | 3300047321 | Ga0495676_0071399 | Ga0495676_0071399_1115_1807 | 200 |
| 160 | 3300048903 | Ga0496100_0334780 | Ga0496100_0334780_105_758 | 200 |
| 161 | 3300049568 | Ga0501031_0018002 | Ga0501031_0018002_2607_3272 | 200 |
| 162 | 3300049568 | Ga0501031_0107433 | Ga0501031_0107433_1136_1804 | 200 |
| 163 | 3300049569 | Ga0501032_0006397 | Ga0501032_0006397_2351_3016 | 200 |
| 164 | 3300049570 | Ga0501033_0041858 | Ga0501033_0041858_403_1068 | 200 |
| 165 | 3300049571 | Ga0501034_0116761 | Ga0501034_0116761_1220_1885 | 200 |
| 166 | 3300049572 | Ga0501036_0040505 | Ga0501036_0040505_1635_2300 | 200 |
| 167 | 3300049573 | Ga0501037_0063847 | Ga0501037_0063847_786_1451 | 200 |
| 168 | 3300049574 | Ga0501038_0015020 | Ga0501038_0015020_4212_4877 | 200 |
| 169 | 3300049575 | Ga0501039_0048377 | Ga0501039_0048377_1225_1890 | 200 |
| 170 | 3300049578 | Ga0501042_0072657 | Ga0501042_0072657_1452_2117 | 200 |
| 171 | 3300049579 | Ga0501043_0066021 | Ga0501043_0066021_772_1437 | 200 |
| 172 | 3300049580 | Ga0501046_0012939 | Ga0501046_0012939_2017_2682 | 200 |
| 173 | 3300049581 | Ga0501047_0062404 | Ga0501047_0062404_1710_2375 | 200 |
| 174 | 3300049582 | Ga0501048_0046928 | Ga0501048_0046928_1422_2087 | 200 |
| 175 | 3300049583 | Ga0501067_0017910 | Ga0501067_0017910_1465_2130 | 200 |
| 176 | 3300049584 | Ga0501068_0268462 | Ga0501068_0268462_163_828 | 200 |
| 177 | 3300049585 | Ga0501069_0026213 | Ga0501069_0026213_1449_2114 | 200 |
| 178 | 3300049586 | Ga0501070_0078679 | Ga0501070_0078679_517_1182 | 200 |
| 179 | 3300049589 | Ga0501073_0003796 | Ga0501073_0003796_5998_6663 | 200 |
| 180 | 3300049590 | Ga0501074_0036830 | Ga0501074_0036830_1426_2091 | 200 |
| 181 | 3300049744 | Ga0501083_0087312 | Ga0501083_0087312_1358_2023 | 200 |
| 182 | 3300049823 | Ga0501044_0141694 | Ga0501044_0141694_222_887 | 200 |
| 183 | 3300053078 | Ga0495612_0000103 | Ga0495612_0000103_1289_2017 | 200 |
| 184 | 3300053085 | Ga0495619_0098198 | Ga0495619_0098198_74_766 | 200 |
| 185 | 3300060353 | Ga0501082_0007829 | Ga0501082_0007829_1430_2095 | 200 |
| 186 | 3300005327 | Ga0070658_10202883 | Ga0070658_102028832 | 201 |
| 187 | 3300005327 | Ga0070658_10290290 | Ga0070658_102902902 | 201 |
| 188 | 3300005329 | Ga0070683_100012762 | Ga0070683_1000127627 | 201 |
| 189 | 3300005336 | Ga0070680_100148678 | Ga0070680_1001486781 | 201 |
| 190 | 3300005339 | Ga0070660_100007570 | Ga0070660_1000075709 | 201 |
| 191 | 3300005339 | Ga0070660_100096113 | Ga0070660_1000961133 | 201 |
| 192 | 3300005366 | Ga0070659_100258754 | Ga0070659_1002587542 | 201 |
| 193 | 3300005435 | Ga0070714_100018537 | Ga0070714_1000185374 | 201 |
| 194 | 3300005435 | Ga0070714_100402748 | Ga0070714_1004027482 | 201 |
| 195 | 3300005441 | Ga0070700_100165268 | Ga0070700_1001652682 | 201 |
| 196 | 3300005458 | Ga0070681_10035917 | Ga0070681_100359176 | 201 |
| 197 | 3300005458 | Ga0070681_10360229 | Ga0070681_103602292 | 201 |
| 198 | 3300005458 | Ga0070681_10505456 | Ga0070681_105054561 | 201 |
| 199 | 3300005518 | Ga0070699_100572458 | Ga0070699_1005724582 | 201 |
| 200 | 3300005530 | Ga0070679_100026448 | Ga0070679_1000264486 | 201 |
| 201 | 3300005530 | Ga0070679_100124608 | Ga0070679_1001246083 | 201 |
| 202 | 3300005535 | Ga0070684_100174751 | Ga0070684_1001747512 | 201 |
| 203 | 3300005535 | Ga0070684_100227481 | Ga0070684_1002274812 | 201 |
| 204 | 3300005616 | Ga0068852_100185740 | Ga0068852_1001857403 | 201 |
| 205 | 3300005981 | Ga0081538_10005377 | Ga0081538_100053774 | 201 |
| 206 | 3300006852 | Ga0075433_10094751 | Ga0075433_100947513 | 201 |
| 207 | 3300006871 | Ga0075434_100130145 | Ga0075434_1001301454 | 201 |
| 208 | 3300006914 | Ga0075436_100013781 | Ga0075436_1000137815 | 201 |
| 209 | 3300007076 | Ga0075435_100060567 | Ga0075435_1000605672 | 201 |
| 210 | 3300007076 | Ga0075435_100124926 | Ga0075435_1001249264 | 201 |
| 211 | 3300009147 | Ga0114129_10096414 | Ga0114129_100964144 | 201 |
| 212 | 3300009551 | Ga0105238_10562093 | Ga0105238_105620931 | 201 |
| 213 | 3300013104 | Ga0157370_10133223 | Ga0157370_101332233 | 201 |
| 214 | 3300013307 | Ga0157372_10198145 | Ga0157372_101981452 | 201 |
| 215 | 3300014497 | Ga0182008_10223456 | Ga0182008_102234561 | 201 |
| 216 | 3300020082 | Ga0206353_10863355 | Ga0206353_108633553 | 201 |
| 217 | 3300020082 | Ga0206353_11434632 | Ga0206353_114346322 | 201 |
| 218 | 3300025912 | Ga0207707_10157467 | Ga0207707_101574672 | 201 |
| 219 | 3300025912 | Ga0207707_10294270 | Ga0207707_102942701 | 201 |
| 220 | 3300025912 | Ga0207707_10338547 | Ga0207707_103385472 | 201 |
| 221 | 3300025917 | Ga0207660_10041075 | Ga0207660_100410753 | 201 |
| 222 | 3300025919 | Ga0207657_10012783 | Ga0207657_100127839 | 201 |
| 223 | 3300025919 | Ga0207657_10017863 | Ga0207657_100178638 | 201 |
| 224 | 3300025921 | Ga0207652_10023986 | Ga0207652_100239864 | 201 |
| 225 | 3300025921 | Ga0207652_10098505 | Ga0207652_100985053 | 201 |
| 226 | 3300025924 | Ga0207694_10414532 | Ga0207694_104145321 | 201 |
| 227 | 3300025929 | Ga0207664_10050177 | Ga0207664_100501772 | 201 |
| 228 | 3300025929 | Ga0207664_10313078 | Ga0207664_103130783 | 201 |
| 229 | 3300025932 | Ga0207690_10287668 | Ga0207690_102876682 | 201 |
| 230 | 3300025939 | Ga0207665_10583332 | Ga0207665_105833322 | 201 |
| 231 | 3300025939 | Ga0207665_10841294 | Ga0207665_108412941 | 201 |
| 232 | 3300025944 | Ga0207661_10022852 | Ga0207661_100228522 | 201 |
| 233 | 3300025949 | Ga0207667_10267732 | Ga0207667_102677321 | 201 |
| 234 | 3300025981 | Ga0207640_10736552 | Ga0207640_107365521 | 201 |
| 235 | 3300026075 | Ga0207708_10035685 | Ga0207708_100356852 | 201 |
| 236 | 3300026142 | Ga0207698_10631754 | Ga0207698_106317542 | 201 |
| 237 | 3300028800 | Ga0265338_10030889 | Ga0265338_100308897 | 201 |
| 238 | 3300031239 | Ga0265328_10115089 | Ga0265328_101150892 | 201 |
| 239 | 3300031251 | Ga0265327_10030508 | Ga0265327_100305082 | 201 |
| 240 | 3300031712 | Ga0265342_10251476 | Ga0265342_102514761 | 201 |
| 241 | 3300035724 | Ga0373933_0376801 | Ga0373933_0376801_229_897 | 201 |
| 242 | 3300036401 | Ga0373937_0153973 | Ga0373937_0153973_1210_1878 | 201 |
| 243 | 3300037312 | Ga0395899_0084568 | Ga0395899_0084568_34_690 | 201 |
| 244 | 3300037418 | Ga0395900_0004135 | Ga0395900_0004135_1420_2079 | 201 |
| 245 | 3300037418 | Ga0395900_0026510 | Ga0395900_0026510_1321_1977 | 201 |
| 246 | 3300037418 | Ga0395900_0065982 | Ga0395900_0065982_2959_3615 | 201 |
| 247 | 3300037466 | Ga0395898_0006669 | Ga0395898_0006669_2471_3127 | 201 |
| 248 | 3300037466 | Ga0395898_0050565 | Ga0395898_0050565_540_1196 | 201 |
| 249 | 3300037471 | Ga0395905_0040789 | Ga0395905_0040789_2981_3637 | 201 |
| 250 | 3300037471 | Ga0395905_0237994 | Ga0395905_0237994_654_1313 | 201 |
| 251 | 3300038443 | Ga0395901_0003054 | Ga0395901_0003054_6643_7299 | 201 |
| 252 | 3300038443 | Ga0395901_0020589 | Ga0395901_0020589_4727_5386 | 201 |
| 253 | 3300038443 | Ga0395901_0476002 | Ga0395901_0476002_509_1165 | 201 |
| 254 | 3300044693 | Ga0466961_0387963 | Ga0466961_0387963_139_816 | 201 |
| 255 | 3300045049 | Ga0466959_0079682 | Ga0466959_0079682_1412_2089 | 201 |
| 256 | 3300045836 | Ga0466958_0240136 | Ga0466958_0240136_443_1126 | 201 |
| 257 | 3300045976 | Ga0466967_0222003 | Ga0466967_0222003_965_1633 | 201 |
| 258 | 3300046454 | Ga0495592_0346917 | Ga0495592_0346917_172_840 | 201 |
| 259 | 3300046463 | Ga0495653_0028675 | Ga0495653_0028675_12_680 | 201 |
| 260 | 3300046463 | Ga0495653_0132989 | Ga0495653_0132989_438_1106 | 201 |
| 261 | 3300046511 | Ga0495608_0191266 | Ga0495608_0191266_131_799 | 201 |
| 262 | 3300046517 | Ga0495630_0403544 | Ga0495630_0403544_338_1006 | 201 |
| 263 | 3300046559 | Ga0495667_0159055 | Ga0495667_0159055_722_1390 | 201 |
| 264 | 3300046642 | Ga0495634_0023315 | Ga0495634_0023315_1469_2137 | 201 |
| 265 | 3300046663 | Ga0495635_0083822 | Ga0495635_0083822_486_1154 | 201 |
| 266 | 3300046675 | Ga0495657_0183327 | Ga0495657_0183327_314_982 | 201 |
| 267 | 3300046809 | Ga0495600_0125680 | Ga0495600_0125680_131_799 | 201 |
| 268 | 3300047322 | Ga0495680_0009812 | Ga0495680_0009812_481_1149 | 201 |
| 269 | 3300047471 | Ga0495684_0015619 | Ga0495684_0015619_1998_2666 | 201 |
| 270 | 3300047471 | Ga0495684_0057504 | Ga0495684_0057504_2262_2930 | 201 |
| 271 | 3300048904 | Ga0496101_0403433 | Ga0496101_0403433_121_792 | 201 |
| 272 | 3300048905 | Ga0496102_0152077 | Ga0496102_0152077_377_1045 | 201 |
| 273 | 3300048909 | Ga0496106_0049891 | Ga0496106_0049891_676_1344 | 201 |
| 274 | 3300048910 | Ga0496107_0007930 | Ga0496107_0007930_628_1296 | 201 |
| 275 | 3300048912 | Ga0496109_0035786 | Ga0496109_0035786_2140_2808 | 201 |
| 276 | 3300048912 | Ga0496109_0473793 | Ga0496109_0473793_81_749 | 201 |
| 277 | 3300048914 | Ga0496111_0036337 | Ga0496111_0036337_2565_3233 | 201 |
| 278 | 3300048915 | Ga0496112_0002347 | Ga0496112_0002347_314_982 | 201 |
| 279 | 3300048915 | Ga0496112_0144060 | Ga0496112_0144060_1144_1812 | 201 |
| 280 | 3300048915 | Ga0496112_0369705 | Ga0496112_0369705_169_837 | 201 |
| 281 | 3300048916 | Ga0496113_0093058 | Ga0496113_0093058_453_1121 | 201 |
| 282 | 3300048922 | Ga0496119_0078970 | Ga0496119_0078970_1128_1805 | 201 |
| 283 | 3300050507 | nmdc:mga05p37_55699_c1 | nmdc:mga05p37_55699_c1_3183_3839 | 201 |
| 284 | 3300050510 | nmdc:mga06r32_500796_c1 | nmdc:mga06r32_500796_c1_273_956 | 201 |
| 285 | 3300050512 | nmdc:mga0n895_279587_c1 | nmdc:mga0n895_279587_c1_311_994 | 201 |
| 286 | 3300050513 | nmdc:mga0rr50_42833_c1 | nmdc:mga0rr50_42833_c1_2296_2979 | 201 |
| 287 | 3300050513 | nmdc:mga0rr50_7412_c1 | nmdc:mga0rr50_7412_c1_1769_2425 | 201 |
| 288 | 3300050514 | nmdc:mga08x19_7111_c1 | nmdc:mga08x19_7111_c1_1217_1873 | 201 |
| 289 | 3300050514 | nmdc:mga08x19_98170_c1 | nmdc:mga08x19_98170_c1_997_1680 | 201 |
| 290 | 3300050515 | nmdc:mga0a205_42204_c1 | nmdc:mga0a205_42204_c1_3075_3731 | 201 |
| 291 | 3300053084 | Ga0495595_0014354 | Ga0495595_0014354_396_1064 | 201 |
| 292 | 3300005366 | Ga0070659_100016250 | Ga0070659_1000162505 | 202 |
| 293 | 3300005435 | Ga0070714_100056593 | Ga0070714_1000565934 | 202 |
| 294 | 3300005436 | Ga0070713_100031459 | Ga0070713_1000314594 | 202 |
| 295 | 3300005536 | Ga0070697_100658005 | Ga0070697_1006580051 | 202 |
| 296 | 3300006028 | Ga0070717_10047485 | Ga0070717_100474855 | 202 |
| 297 | 3300009147 | Ga0114129_10006658 | Ga0114129_100066589 | 202 |
| 298 | 3300013296 | Ga0157374_10012163 | Ga0157374_100121631 | 202 |
| 299 | 3300025915 | Ga0207693_10210332 | Ga0207693_102103322 | 202 |
| 300 | 3300025927 | Ga0207687_10438226 | Ga0207687_104382262 | 202 |
| 301 | 3300025928 | Ga0207700_10035952 | Ga0207700_100359524 | 202 |
| 302 | 3300025929 | Ga0207664_10028937 | Ga0207664_100289374 | 202 |
| 303 | 3300025929 | Ga0207664_10050634 | Ga0207664_100506344 | 202 |
| 304 | 3300026067 | Ga0207678_10055213 | Ga0207678_100552133 | 202 |
| 305 | 3300026078 | Ga0207702_10471384 | Ga0207702_104713841 | 202 |
| 306 | 3300037312 | Ga0395899_0214702 | Ga0395899_0214702_554_1225 | 202 |
| 307 | 3300037418 | Ga0395900_0034090 | Ga0395900_0034090_4537_5208 | 202 |
| 308 | 3300037418 | Ga0395900_0053454 | Ga0395900_0053454_2070_2750 | 202 |
| 309 | 3300037466 | Ga0395898_0021885 | Ga0395898_0021885_1067_1738 | 202 |
| 310 | 3300037471 | Ga0395905_0017576 | Ga0395905_0017576_555_1226 | 202 |
| 311 | 3300038443 | Ga0395901_0011629 | Ga0395901_0011629_1426_2097 | 202 |
| 312 | 3300038443 | Ga0395901_0630799 | Ga0395901_0630799_59_811 | 202 |
| 313 | 3300038996 | Ga0242420_059665 | Ga0242420_059665_42_722 | 202 |
| 314 | 3300046499 | Ga0495594_0268053 | Ga0495594_0268053_66_746 | 202 |
| 315 | 3300048904 | Ga0496101_0071832 | Ga0496101_0071832_593_1252 | 202 |
| 316 | 3300048907 | Ga0496104_0007061 | Ga0496104_0007061_4516_5175 | 202 |
| 317 | 3300048907 | Ga0496104_1040083 | Ga0496104_1040083_48_707 | 202 |
| 318 | 3300048908 | Ga0496105_0015422 | Ga0496105_0015422_4906_5565 | 202 |
| 319 | 3300048910 | Ga0496107_0070849 | Ga0496107_0070849_163_822 | 202 |
| 320 | 3300048911 | Ga0496108_0006408 | Ga0496108_0006408_3835_4494 | 202 |
| 321 | 3300048912 | Ga0496109_0000119 | Ga0496109_0000119_50989_51648 | 202 |
| 322 | 3300048913 | Ga0496110_0010360 | Ga0496110_0010360_3121_3780 | 202 |
| 323 | 3300048914 | Ga0496111_0002592 | Ga0496111_0002592_3861_4520 | 202 |
| 324 | 3300048915 | Ga0496112_0005144 | Ga0496112_0005144_6726_7385 | 202 |
| 325 | 3300048916 | Ga0496113_0002780 | Ga0496113_0002780_6640_7299 | 202 |
| 326 | 3300048917 | Ga0496114_0013504 | Ga0496114_0013504_3866_4525 | 202 |
| 327 | 3300049573 | Ga0501037_0612052 | Ga0501037_0612052_30_710 | 202 |
| 328 | 3300049576 | Ga0501040_0347425 | Ga0501040_0347425_79_759 | 202 |
| 329 | 3300050492 | nmdc:mga0yw44_41270_c1 | nmdc:mga0yw44_41270_c1_63_734 | 202 |
| 330 | 3300050507 | nmdc:mga05p37_19361_c1 | nmdc:mga05p37_19361_c1_7143_7802 | 202 |
| 331 | 3300059426 | Ga0590077_020669 | Ga0590077_020669_484_1164 | 202 |
| 332 | 3300061734 | Ga0530510_0436858 | Ga0530510_0436858_45_728 | 202 |
| 333 | 3300002077 | JGI24744J21845_10010674 | JGI24744J21845_100106741 | 203 |
| 334 | 3300005330 | Ga0070690_100018738 | Ga0070690_1000187385 | 203 |
| 335 | 3300005334 | Ga0068869_100165812 | Ga0068869_1001658121 | 203 |
| 336 | 3300005337 | Ga0070682_100029770 | Ga0070682_1000297705 | 203 |
| 337 | 3300005338 | Ga0068868_100093729 | Ga0068868_1000937293 | 203 |
| 338 | 3300005338 | Ga0068868_100274750 | Ga0068868_1002747502 | 203 |
| 339 | 3300005343 | Ga0070687_100008486 | Ga0070687_1000084865 | 203 |
| 340 | 3300005343 | Ga0070687_100198201 | Ga0070687_1001982011 | 203 |
| 341 | 3300005345 | Ga0070692_10407171 | Ga0070692_104071711 | 203 |
| 342 | 3300005347 | Ga0070668_100184506 | Ga0070668_1001845063 | 203 |
| 343 | 3300005347 | Ga0070668_100460714 | Ga0070668_1004607141 | 203 |
| 344 | 3300005353 | Ga0070669_100700385 | Ga0070669_1007003851 | 203 |
| 345 | 3300005355 | Ga0070671_100031215 | Ga0070671_1000312153 | 203 |
| 346 | 3300005356 | Ga0070674_100015392 | Ga0070674_1000153925 | 203 |
| 347 | 3300005365 | Ga0070688_100248507 | Ga0070688_1002485072 | 203 |
| 348 | 3300005366 | Ga0070659_100107801 | Ga0070659_1001078013 | 203 |
| 349 | 3300005435 | Ga0070714_100160037 | Ga0070714_1001600372 | 203 |
| 350 | 3300005435 | Ga0070714_100550348 | Ga0070714_1005503482 | 203 |
| 351 | 3300005436 | Ga0070713_100264978 | Ga0070713_1002649783 | 203 |
| 352 | 3300005437 | Ga0070710_10006000 | Ga0070710_100060005 | 203 |
| 353 | 3300005438 | Ga0070701_10001596 | Ga0070701_100015966 | 203 |
| 354 | 3300005441 | Ga0070700_100017943 | Ga0070700_1000179435 | 203 |
| 355 | 3300005444 | Ga0070694_100078469 | Ga0070694_1000784692 | 203 |
| 356 | 3300005445 | Ga0070708_100882887 | Ga0070708_1008828871 | 203 |
| 357 | 3300005457 | Ga0070662_100057740 | Ga0070662_1000577402 | 203 |
| 358 | 3300005459 | Ga0068867_100001986 | Ga0068867_10000198611 | 203 |
| 359 | 3300005466 | Ga0070685_10019049 | Ga0070685_100190494 | 203 |
| 360 | 3300005539 | Ga0068853_100565856 | Ga0068853_1005658561 | 203 |
| 361 | 3300005544 | Ga0070686_100001306 | Ga0070686_1000013067 | 203 |
| 362 | 3300005546 | Ga0070696_100012789 | Ga0070696_1000127894 | 203 |
| 363 | 3300005547 | Ga0070693_100114253 | Ga0070693_1001142531 | 203 |
| 364 | 3300005548 | Ga0070665_100538555 | Ga0070665_1005385553 | 203 |
| 365 | 3300005549 | Ga0070704_100032451 | Ga0070704_1000324512 | 203 |
| 366 | 3300005578 | Ga0068854_100045259 | Ga0068854_1000452592 | 203 |
| 367 | 3300005614 | Ga0068856_100925053 | Ga0068856_1009250532 | 203 |
| 368 | 3300005615 | Ga0070702_100086353 | Ga0070702_1000863532 | 203 |
| 369 | 3300005617 | Ga0068859_100425366 | Ga0068859_1004253661 | 203 |
| 370 | 3300005718 | Ga0068866_10020230 | Ga0068866_100202303 | 203 |
| 371 | 3300005718 | Ga0068866_10069515 | Ga0068866_100695154 | 203 |
| 372 | 3300005719 | Ga0068861_100018009 | Ga0068861_1000180093 | 203 |
| 373 | 3300005719 | Ga0068861_100067605 | Ga0068861_1000676054 | 203 |
| 374 | 3300005842 | Ga0068858_100180928 | Ga0068858_1001809282 | 203 |
| 375 | 3300005844 | Ga0068862_100252829 | Ga0068862_1002528292 | 203 |
| 376 | 3300005981 | Ga0081538_10015590 | Ga0081538_100155902 | 203 |
| 377 | 3300005985 | Ga0081539_10101701 | Ga0081539_101017012 | 203 |
| 378 | 3300006028 | Ga0070717_10014762 | Ga0070717_100147623 | 203 |
| 379 | 3300006028 | Ga0070717_10024989 | Ga0070717_100249896 | 203 |
| 380 | 3300006028 | Ga0070717_10465501 | Ga0070717_104655012 | 203 |
| 381 | 3300006028 | Ga0070717_10671871 | Ga0070717_106718711 | 203 |
| 382 | 3300006175 | Ga0070712_100018561 | Ga0070712_1000185614 | 203 |
| 383 | 3300006175 | Ga0070712_100113399 | Ga0070712_1001133992 | 203 |
| 384 | 3300006358 | Ga0068871_100044002 | Ga0068871_1000440023 | 203 |
| 385 | 3300006881 | Ga0068865_100015718 | Ga0068865_1000157183 | 203 |
| 386 | 3300006881 | Ga0068865_100051365 | Ga0068865_1000513654 | 203 |
| 387 | 3300006931 | Ga0097620_100425357 | Ga0097620_1004253571 | 203 |
| 388 | 3300009098 | Ga0105245_10072800 | Ga0105245_100728002 | 203 |
| 389 | 3300009098 | Ga0105245_10105095 | Ga0105245_101050952 | 203 |
| 390 | 3300009148 | Ga0105243_10041003 | Ga0105243_100410031 | 203 |
| 391 | 3300009148 | Ga0105243_10206287 | Ga0105243_102062873 | 203 |
| 392 | 3300009148 | Ga0105243_10539662 | Ga0105243_105396621 | 203 |
| 393 | 3300009176 | Ga0105242_10058370 | Ga0105242_100583703 | 203 |
| 394 | 3300009176 | Ga0105242_10068762 | Ga0105242_100687623 | 203 |
| 395 | 3300009177 | Ga0105248_10048411 | Ga0105248_100484113 | 203 |
| 396 | 3300009551 | Ga0105238_10275056 | Ga0105238_102750561 | 203 |
| 397 | 3300009553 | Ga0105249_10010542 | Ga0105249_100105427 | 203 |
| 398 | 3300009553 | Ga0105249_10033962 | Ga0105249_100339622 | 203 |
| 399 | 3300010375 | Ga0105239_10002157 | Ga0105239_100021571 | 203 |
| 400 | 3300010375 | Ga0105239_10250605 | Ga0105239_102506052 | 203 |
| 401 | 3300013297 | Ga0157378_10037430 | Ga0157378_100374303 | 203 |
| 402 | 3300013306 | Ga0163162_10001769 | Ga0163162_1000176910 | 203 |
| 403 | 3300013307 | Ga0157372_11309152 | Ga0157372_113091521 | 203 |
| 404 | 3300014326 | Ga0157380_10017229 | Ga0157380_100172295 | 203 |
| 405 | 3300014326 | Ga0157380_10036935 | Ga0157380_100369352 | 203 |
| 406 | 3300014969 | Ga0157376_10046520 | Ga0157376_100465203 | 203 |
| 407 | 3300017792 | Ga0163161_10207025 | Ga0163161_102070251 | 203 |
| 408 | 3300021377 | Ga0213874_10000005 | Ga0213874_1000000515 | 203 |
| 409 | 3300021377 | Ga0213874_10048479 | Ga0213874_100484792 | 203 |
| 410 | 3300021377 | Ga0213874_10085101 | Ga0213874_100851012 | 203 |
| 411 | 3300021384 | Ga0213876_10006232 | Ga0213876_100062323 | 203 |
| 412 | 3300021384 | Ga0213876_10016494 | Ga0213876_100164944 | 203 |
| 413 | 3300021384 | Ga0213876_10059078 | Ga0213876_100590782 | 203 |
| 414 | 3300021384 | Ga0213876_10101855 | Ga0213876_101018552 | 203 |
| 415 | 3300021384 | Ga0213876_10147870 | Ga0213876_101478702 | 203 |
| 416 | 3300021388 | Ga0213875_10006473 | Ga0213875_100064736 | 203 |
| 417 | 3300021388 | Ga0213875_10009519 | Ga0213875_100095194 | 203 |
| 418 | 3300021388 | Ga0213875_10016639 | Ga0213875_100166395 | 203 |
| 419 | 3300021388 | Ga0213875_10083886 | Ga0213875_100838862 | 203 |
| 420 | 3300025898 | Ga0207692_10145259 | Ga0207692_101452591 | 203 |
| 421 | 3300025899 | Ga0207642_10012082 | Ga0207642_100120823 | 203 |
| 422 | 3300025906 | Ga0207699_10027001 | Ga0207699_100270012 | 203 |
| 423 | 3300025915 | Ga0207693_10002345 | Ga0207693_1000234511 | 203 |
| 424 | 3300025915 | Ga0207693_10046637 | Ga0207693_100466375 | 203 |
| 425 | 3300025916 | Ga0207663_10015163 | Ga0207663_100151633 | 203 |
| 426 | 3300025916 | Ga0207663_10090167 | Ga0207663_100901674 | 203 |
| 427 | 3300025917 | Ga0207660_10154969 | Ga0207660_101549691 | 203 |
| 428 | 3300025919 | Ga0207657_10018530 | Ga0207657_100185303 | 203 |
| 429 | 3300025924 | Ga0207694_10614443 | Ga0207694_106144431 | 203 |
| 430 | 3300025927 | Ga0207687_10700241 | Ga0207687_107002411 | 203 |
| 431 | 3300025928 | Ga0207700_10091210 | Ga0207700_100912102 | 203 |
| 432 | 3300025929 | Ga0207664_10001411 | Ga0207664_100014119 | 203 |
| 433 | 3300025931 | Ga0207644_10047535 | Ga0207644_100475355 | 203 |
| 434 | 3300025934 | Ga0207686_10039731 | Ga0207686_100397315 | 203 |
| 435 | 3300025934 | Ga0207686_10145429 | Ga0207686_101454291 | 203 |
| 436 | 3300025935 | Ga0207709_10062717 | Ga0207709_100627173 | 203 |
| 437 | 3300025937 | Ga0207669_10025080 | Ga0207669_100250803 | 203 |
| 438 | 3300025938 | Ga0207704_10015400 | Ga0207704_100154004 | 203 |
| 439 | 3300025938 | Ga0207704_10613006 | Ga0207704_106130061 | 203 |
| 440 | 3300025940 | Ga0207691_10171852 | Ga0207691_101718524 | 203 |
| 441 | 3300025940 | Ga0207691_10486579 | Ga0207691_104865791 | 203 |
| 442 | 3300025942 | Ga0207689_10834376 | Ga0207689_108343761 | 203 |
| 443 | 3300025945 | Ga0207679_10688867 | Ga0207679_106888671 | 203 |
| 444 | 3300025949 | Ga0207667_10512455 | Ga0207667_105124552 | 203 |
| 445 | 3300025961 | Ga0207712_10152968 | Ga0207712_101529681 | 203 |
| 446 | 3300025972 | Ga0207668_10103327 | Ga0207668_101033272 | 203 |
| 447 | 3300025972 | Ga0207668_10187024 | Ga0207668_101870242 | 203 |
| 448 | 3300025986 | Ga0207658_10165780 | Ga0207658_101657803 | 203 |
| 449 | 3300026023 | Ga0207677_10338979 | Ga0207677_103389791 | 203 |
| 450 | 3300026041 | Ga0207639_10436749 | Ga0207639_104367492 | 203 |
| 451 | 3300026075 | Ga0207708_10018961 | Ga0207708_100189615 | 203 |
| 452 | 3300026089 | Ga0207648_10000947 | Ga0207648_100009478 | 203 |
| 453 | 3300026095 | Ga0207676_10346929 | Ga0207676_103469293 | 203 |
| 454 | 3300026118 | Ga0207675_100034760 | Ga0207675_1000347602 | 203 |
| 455 | 3300026118 | Ga0207675_100038595 | Ga0207675_1000385955 | 203 |
| 456 | 3300026121 | Ga0207683_10005535 | Ga0207683_1000553512 | 203 |
| 457 | 3300026121 | Ga0207683_10331012 | Ga0207683_103310122 | 203 |
| 458 | 3300028380 | Ga0268265_10047046 | Ga0268265_100470461 | 203 |
| 459 | 3300028800 | Ga0265338_10195970 | Ga0265338_101959702 | 203 |
| 460 | 3300035410 | Ga0373924_0055216 | Ga0373924_0055216_180_869 | 203 |
| 461 | 3300035724 | Ga0373933_0023248 | Ga0373933_0023248_1931_2620 | 203 |
| 462 | 3300037853 | Ga0436364_0159150 | Ga0436364_0159150_5797_6480 | 203 |
| 463 | 3300037853 | Ga0436364_0159207 | Ga0436364_0159207_14776_15459 | 203 |
| 464 | 3300037853 | Ga0436364_0263937 | Ga0436364_0263937_57_785 | 203 |
| 465 | 3300037853 | Ga0436364_0334646 | Ga0436364_0334646_3839_4522 | 203 |
| 466 | 3300037853 | Ga0436364_0418406 | Ga0436364_0418406_2884_3573 | 203 |
| 467 | 3300037853 | Ga0436364_0424870 | Ga0436364_0424870_128_811 | 203 |
| 468 | 3300037853 | Ga0436364_0793605 | Ga0436364_0793605_1465_2148 | 203 |
| 469 | 3300037853 | Ga0436364_1339551 | Ga0436364_1339551_5701_6384 | 203 |
| 470 | 3300037853 | Ga0436364_1346518 | Ga0436364_1346518_3133_3816 | 203 |
| 471 | 3300039437 | Ga0436365_0004038 | Ga0436365_0004038_6779_7462 | 203 |
| 472 | 3300039437 | Ga0436365_0168949 | Ga0436365_0168949_2643_3326 | 203 |
| 473 | 3300039437 | Ga0436365_0186047 | Ga0436365_0186047_747_1430 | 203 |
| 474 | 3300039437 | Ga0436365_0896130 | Ga0436365_0896130_3873_4556 | 203 |
| 475 | 3300039437 | Ga0436365_1001279 | Ga0436365_1001279_20619_21302 | 203 |
| 476 | 3300039437 | Ga0436365_1282173 | Ga0436365_1282173_2432_3115 | 203 |
| 477 | 3300039437 | Ga0436365_1315914 | Ga0436365_1315914_1260_1949 | 203 |
| 478 | 3300039437 | Ga0436365_1510673 | Ga0436365_1510673_387_1070 | 203 |
| 479 | 3300039437 | Ga0436365_1790130 | Ga0436365_1790130_4561_5250 | 203 |
| 480 | 3300039437 | Ga0436365_1809914 | Ga0436365_1809914_1048_1737 | 203 |
| 481 | 3300039437 | Ga0436365_1843863 | Ga0436365_1843863_608_1291 | 203 |
| 482 | 3300039438 | Ga0436360_0896315 | Ga0436360_0896315_340_1023 | 203 |
| 483 | 3300039450 | Ga0436363_0212212 | Ga0436363_0212212_401_1084 | 203 |
| 484 | 3300039450 | Ga0436363_0843533 | Ga0436363_0843533_3465_4148 | 203 |
| 485 | 3300039450 | Ga0436363_0896388 | Ga0436363_0896388_523_1206 | 203 |
| 486 | 3300039450 | Ga0436363_0985997 | Ga0436363_0985997_171_854 | 203 |
| 487 | 3300039450 | Ga0436363_1078326 | Ga0436363_1078326_1011_1694 | 203 |
| 488 | 3300039450 | Ga0436363_1691717 | Ga0436363_1691717_1162_1845 | 203 |
| 489 | 3300039453 | Ga0436362_0325995 | Ga0436362_0325995_64_747 | 203 |
| 490 | 3300039453 | Ga0436362_0993185 | Ga0436362_0993185_59_748 | 203 |
| 491 | 3300044656 | Ga0466969_0017968 | Ga0466969_0017968_782_1474 | 203 |
| 492 | 3300044656 | Ga0466969_0026626 | Ga0466969_0026626_1242_1925 | 203 |
| 493 | 3300044656 | Ga0466969_0183497 | Ga0466969_0183497_83_766 | 203 |
| 494 | 3300044683 | Ga0466965_0026614 | Ga0466965_0026614_10_693 | 203 |
| 495 | 3300044683 | Ga0466965_0081916 | Ga0466965_0081916_171_854 | 203 |
| 496 | 3300044684 | Ga0466966_0031037 | Ga0466966_0031037_702_1394 | 203 |
| 497 | 3300044684 | Ga0466966_0195381 | Ga0466966_0195381_279_962 | 203 |
| 498 | 3300044693 | Ga0466961_0078710 | Ga0466961_0078710_1223_1921 | 203 |
| 499 | 3300044693 | Ga0466961_0081110 | Ga0466961_0081110_803_1486 | 203 |
| 500 | 3300044693 | Ga0466961_0095342 | Ga0466961_0095342_637_1329 | 203 |
| 501 | 3300044694 | Ga0466963_0007807 | Ga0466963_0007807_2761_3444 | 203 |
| 502 | 3300044694 | Ga0466963_0050761 | Ga0466963_0050761_1104_1802 | 203 |
| 503 | 3300044694 | Ga0466963_0118470 | Ga0466963_0118470_20_703 | 203 |
| 504 | 3300044694 | Ga0466963_0170911 | Ga0466963_0170911_459_1142 | 203 |
| 505 | 3300044719 | Ga0466971_0023271 | Ga0466971_0023271_510_1265 | 203 |
| 506 | 3300044719 | Ga0466971_0028325 | Ga0466971_0028325_1229_1927 | 203 |
| 507 | 3300044735 | Ga0466968_0033615 | Ga0466968_0033615_721_1404 | 203 |
| 508 | 3300044765 | Ga0466970_0033730 | Ga0466970_0033730_453_1136 | 203 |
| 509 | 3300044842 | Ga0466957_0001380 | Ga0466957_0001380_11659_12342 | 203 |
| 510 | 3300044842 | Ga0466957_0005549 | Ga0466957_0005549_2518_3273 | 203 |
| 511 | 3300044842 | Ga0466957_0034550 | Ga0466957_0034550_810_1508 | 203 |
| 512 | 3300044842 | Ga0466957_0242061 | Ga0466957_0242061_96_779 | 203 |
| 513 | 3300044901 | Ga0466960_0005487 | Ga0466960_0005487_51_743 | 203 |
| 514 | 3300045049 | Ga0466959_0009139 | Ga0466959_0009139_2950_3633 | 203 |
| 515 | 3300045049 | Ga0466959_0062978 | Ga0466959_0062978_748_1431 | 203 |
| 516 | 3300045049 | Ga0466959_0110111 | Ga0466959_0110111_777_1460 | 203 |
| 517 | 3300045049 | Ga0466959_0132945 | Ga0466959_0132945_285_968 | 203 |
| 518 | 3300045049 | Ga0466959_0150528 | Ga0466959_0150528_133_825 | 203 |
| 519 | 3300045836 | Ga0466958_0000233 | Ga0466958_0000233_2472_3155 | 203 |
| 520 | 3300045836 | Ga0466958_0001574 | Ga0466958_0001574_8358_9041 | 203 |
| 521 | 3300045836 | Ga0466958_0021100 | Ga0466958_0021100_3061_3759 | 203 |
| 522 | 3300045836 | Ga0466958_0023271 | Ga0466958_0023271_2243_2998 | 203 |
| 523 | 3300045836 | Ga0466958_0039365 | Ga0466958_0039365_595_1293 | 203 |
| 524 | 3300045836 | Ga0466958_0041198 | Ga0466958_0041198_1841_2524 | 203 |
| 525 | 3300045836 | Ga0466958_0060810 | Ga0466958_0060810_275_958 | 203 |
| 526 | 3300045836 | Ga0466958_0069955 | Ga0466958_0069955_1195_1878 | 203 |
| 527 | 3300045836 | Ga0466958_0224159 | Ga0466958_0224159_287_970 | 203 |
| 528 | 3300045976 | Ga0466967_0008602 | Ga0466967_0008602_1470_2153 | 203 |
| 529 | 3300045976 | Ga0466967_0211681 | Ga0466967_0211681_819_1517 | 203 |
| 530 | 3300045976 | Ga0466967_0396298 | Ga0466967_0396298_450_1133 | 203 |
| 531 | 3300045976 | Ga0466967_0398970 | Ga0466967_0398970_571_1254 | 203 |
| 532 | 3300045976 | Ga0466967_0830978 | Ga0466967_0830978_79_771 | 203 |
| 533 | 3300046454 | Ga0495592_0076660 | Ga0495592_0076660_952_1641 | 203 |
| 534 | 3300046462 | Ga0495651_0006559 | Ga0495651_0006559_6715_7404 | 203 |
| 535 | 3300046471 | Ga0495650_0000053 | Ga0495650_0000053_287803_288489 | 203 |
| 536 | 3300046491 | Ga0495584_0076277 | Ga0495584_0076277_650_1312 | 203 |
| 537 | 3300046511 | Ga0495608_0057911 | Ga0495608_0057911_605_1294 | 203 |
| 538 | 3300046514 | Ga0495618_0009790 | Ga0495618_0009790_2581_3270 | 203 |
| 539 | 3300046516 | Ga0495628_0036020 | Ga0495628_0036020_2451_3140 | 203 |
| 540 | 3300046517 | Ga0495630_0180663 | Ga0495630_0180663_739_1422 | 203 |
| 541 | 3300046529 | Ga0495652_0028874 | Ga0495652_0028874_2194_2883 | 203 |
| 542 | 3300046529 | Ga0495652_0035637 | Ga0495652_0035637_1282_1980 | 203 |
| 543 | 3300046533 | Ga0495640_0036389 | Ga0495640_0036389_875_1564 | 203 |
| 544 | 3300046536 | Ga0495587_0234375 | Ga0495587_0234375_58_756 | 203 |
| 545 | 3300046543 | Ga0495645_0091105 | Ga0495645_0091105_688_1377 | 203 |
| 546 | 3300046559 | Ga0495667_0001023 | Ga0495667_0001023_11318_12007 | 203 |
| 547 | 3300046663 | Ga0495635_0079599 | Ga0495635_0079599_276_965 | 203 |
| 548 | 3300046675 | Ga0495657_0021964 | Ga0495657_0021964_2549_3238 | 203 |
| 549 | 3300046675 | Ga0495657_0365758 | Ga0495657_0365758_130_813 | 203 |
| 550 | 3300046680 | Ga0495646_0040775 | Ga0495646_0040775_196_885 | 203 |
| 551 | 3300046689 | Ga0495613_0128797 | Ga0495613_0128797_889_1578 | 203 |
| 552 | 3300046690 | Ga0495624_0178431 | Ga0495624_0178431_236_919 | 203 |
| 553 | 3300047317 | Ga0495604_0334136 | Ga0495604_0334136_265_948 | 203 |
| 554 | 3300047319 | Ga0495674_0084744 | Ga0495674_0084744_1261_1950 | 203 |
| 555 | 3300047319 | Ga0495674_0155618 | Ga0495674_0155618_920_1603 | 203 |
| 556 | 3300047319 | Ga0495674_0206862 | Ga0495674_0206862_572_1270 | 203 |
| 557 | 3300047322 | Ga0495680_0080447 | Ga0495680_0080447_1420_2109 | 203 |
| 558 | 3300047471 | Ga0495684_0014186 | Ga0495684_0014186_1229_1918 | 203 |
| 559 | 3300048088 | Ga0495602_0057336 | Ga0495602_0057336_662_1351 | 203 |
| 560 | 3300048903 | Ga0496100_0044855 | Ga0496100_0044855_1234_1917 | 203 |
| 561 | 3300048903 | Ga0496100_0086206 | Ga0496100_0086206_206_865 | 203 |
| 562 | 3300048903 | Ga0496100_0329586 | Ga0496100_0329586_409_1095 | 203 |
| 563 | 3300048905 | Ga0496102_0031622 | Ga0496102_0031622_3349_4008 | 203 |
| 564 | 3300048907 | Ga0496104_0012549 | Ga0496104_0012549_2542_3231 | 203 |
| 565 | 3300048908 | Ga0496105_0099074 | Ga0496105_0099074_1163_1852 | 203 |
| 566 | 3300048908 | Ga0496105_0164230 | Ga0496105_0164230_501_1190 | 203 |
| 567 | 3300048909 | Ga0496106_0036395 | Ga0496106_0036395_1883_2542 | 203 |
| 568 | 3300048910 | Ga0496107_0041472 | Ga0496107_0041472_1610_2269 | 203 |
| 569 | 3300048911 | Ga0496108_0337704 | Ga0496108_0337704_14_703 | 203 |
| 570 | 3300048911 | Ga0496108_0684660 | Ga0496108_0684660_77_766 | 203 |
| 571 | 3300048912 | Ga0496109_0253050 | Ga0496109_0253050_953_1642 | 203 |
| 572 | 3300048915 | Ga0496112_0034280 | Ga0496112_0034280_817_1506 | 203 |
| 573 | 3300048916 | Ga0496113_0009800 | Ga0496113_0009800_2822_3511 | 203 |
| 574 | 3300048917 | Ga0496114_0001493 | Ga0496114_0001493_2896_3555 | 203 |
| 575 | 3300048917 | Ga0496114_0093555 | Ga0496114_0093555_415_1104 | 203 |
| 576 | 3300048918 | Ga0496115_0370071 | Ga0496115_0370071_311_970 | 203 |
| 577 | 3300049569 | Ga0501032_0010737 | Ga0501032_0010737_1035_1718 | 203 |
| 578 | 3300049569 | Ga0501032_0126199 | Ga0501032_0126199_55_738 | 203 |
| 579 | 3300049569 | Ga0501032_0275405 | Ga0501032_0275405_335_1018 | 203 |
| 580 | 3300049570 | Ga0501033_0006867 | Ga0501033_0006867_3726_4409 | 203 |
| 581 | 3300049571 | Ga0501034_0036214 | Ga0501034_0036214_2858_3541 | 203 |
| 582 | 3300049572 | Ga0501036_0009924 | Ga0501036_0009924_4892_5575 | 203 |
| 583 | 3300049572 | Ga0501036_0043491 | Ga0501036_0043491_1866_2549 | 203 |
| 584 | 3300049573 | Ga0501037_0010808 | Ga0501037_0010808_3169_3852 | 203 |
| 585 | 3300049573 | Ga0501037_0102158 | Ga0501037_0102158_920_1603 | 203 |
| 586 | 3300049574 | Ga0501038_0026437 | Ga0501038_0026437_1004_1687 | 203 |
| 587 | 3300049574 | Ga0501038_0587441 | Ga0501038_0587441_145_828 | 203 |
| 588 | 3300049576 | Ga0501040_0003675 | Ga0501040_0003675_5187_5870 | 203 |
| 589 | 3300049576 | Ga0501040_0018215 | Ga0501040_0018215_3533_4216 | 203 |
| 590 | 3300049576 | Ga0501040_0108162 | Ga0501040_0108162_549_1232 | 203 |
| 591 | 3300049577 | Ga0501041_0078505 | Ga0501041_0078505_568_1251 | 203 |
| 592 | 3300049577 | Ga0501041_0227689 | Ga0501041_0227689_104_787 | 203 |
| 593 | 3300049578 | Ga0501042_0002692 | Ga0501042_0002692_4865_5548 | 203 |
| 594 | 3300049578 | Ga0501042_0275569 | Ga0501042_0275569_453_1136 | 203 |
| 595 | 3300049579 | Ga0501043_0007275 | Ga0501043_0007275_4958_5641 | 203 |
| 596 | 3300049580 | Ga0501046_0043183 | Ga0501046_0043183_604_1287 | 203 |
| 597 | 3300049581 | Ga0501047_0035150 | Ga0501047_0035150_1604_2287 | 203 |
| 598 | 3300049582 | Ga0501048_0006396 | Ga0501048_0006396_4369_5052 | 203 |
| 599 | 3300049582 | Ga0501048_0068149 | Ga0501048_0068149_1694_2377 | 203 |
| 600 | 3300049584 | Ga0501068_0000910 | Ga0501068_0000910_9876_10559 | 203 |
| 601 | 3300049584 | Ga0501068_0079806 | Ga0501068_0079806_981_1664 | 203 |
| 602 | 3300049585 | Ga0501069_0008925 | Ga0501069_0008925_1435_2118 | 203 |
| 603 | 3300049586 | Ga0501070_0001280 | Ga0501070_0001280_3885_4568 | 203 |
| 604 | 3300049586 | Ga0501070_0150529 | Ga0501070_0150529_650_1333 | 203 |
| 605 | 3300049586 | Ga0501070_0441395 | Ga0501070_0441395_221_904 | 203 |
| 606 | 3300049587 | Ga0501071_0009751 | Ga0501071_0009751_876_1559 | 203 |
| 607 | 3300049587 | Ga0501071_0032431 | Ga0501071_0032431_1872_2555 | 203 |
| 608 | 3300049587 | Ga0501071_0042360 | Ga0501071_0042360_943_1626 | 203 |
| 609 | 3300049588 | Ga0501072_0008261 | Ga0501072_0008261_3230_3913 | 203 |
| 610 | 3300049588 | Ga0501072_0016558 | Ga0501072_0016558_4843_5526 | 203 |
| 611 | 3300049589 | Ga0501073_0007749 | Ga0501073_0007749_4173_4856 | 203 |
| 612 | 3300049590 | Ga0501074_0015585 | Ga0501074_0015585_2211_2894 | 203 |
| 613 | 3300049591 | Ga0501075_0043194 | Ga0501075_0043194_991_1674 | 203 |
| 614 | 3300049592 | Ga0501076_0013410 | Ga0501076_0013410_3042_3725 | 203 |
| 615 | 3300049592 | Ga0501076_0013836 | Ga0501076_0013836_1627_2310 | 203 |
| 616 | 3300049592 | Ga0501076_0021274 | Ga0501076_0021274_2236_2919 | 203 |
| 617 | 3300049593 | Ga0501077_0005005 | Ga0501077_0005005_3178_3861 | 203 |
| 618 | 3300049593 | Ga0501077_0037863 | Ga0501077_0037863_688_1371 | 203 |
| 619 | 3300049742 | Ga0501080_0008481 | Ga0501080_0008481_3610_4293 | 203 |
| 620 | 3300049743 | Ga0501081_0008063 | Ga0501081_0008063_2269_2952 | 203 |
| 621 | 3300049743 | Ga0501081_0020598 | Ga0501081_0020598_3203_3886 | 203 |
| 622 | 3300049743 | Ga0501081_0381018 | Ga0501081_0381018_23_706 | 203 |
| 623 | 3300049744 | Ga0501083_0012763 | Ga0501083_0012763_3109_3792 | 203 |
| 624 | 3300049822 | Ga0501035_0309251 | Ga0501035_0309251_329_1012 | 203 |
| 625 | 3300049823 | Ga0501044_0020066 | Ga0501044_0020066_6091_6774 | 203 |
| 626 | 3300049824 | Ga0501045_0010528 | Ga0501045_0010528_4046_4729 | 203 |
| 627 | 3300049824 | Ga0501045_0272405 | Ga0501045_0272405_485_1168 | 203 |
| 628 | 3300053077 | Ga0495601_0136022 | Ga0495601_0136022_612_1310 | 203 |
| 629 | 3300053078 | Ga0495612_0016370 | Ga0495612_0016370_1385_2074 | 203 |
| 630 | 3300053078 | Ga0495612_0076012 | Ga0495612_0076012_264_947 | 203 |
| 631 | 3300053084 | Ga0495595_0010720 | Ga0495595_0010720_1460_2149 | 203 |
| 632 | 3300053085 | Ga0495619_0011725 | Ga0495619_0011725_3599_4288 | 203 |
| 633 | 3300054114 | Ga0501084_0098013 | Ga0501084_0098013_1004_1687 | 203 |
| 634 | 3300060353 | Ga0501082_0118613 | Ga0501082_0118613_695_1378 | 203 |
| 635 | 3300061719 | Ga0466962_0049330 | Ga0466962_0049330_1301_1984 | 203 |
| 636 | 3300061734 | Ga0530510_0004994 | Ga0530510_0004994_5437_6120 | 203 |
| 637 | 3300061734 | Ga0530510_0145467 | Ga0530510_0145467_143_826 | 203 |
| 638 | 3300061734 | Ga0530510_0494277 | Ga0530510_0494277_217_900 | 203 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7r81-assembly1.cif.gz_c1 | structure of the translating neurospora crassa ribosome arrested by cycloheximide | 0.9145 | 159 | 186 |
| 8cg8-assembly1.cif.gz_M | translocation intermediate 3 (ti-3) of 80s s. cerevisiae ribosome with ligands and eef2 in the presence of sordarin | 0.8928 | 159 | 186 |
| 8b2l-assembly1.cif.gz_f3 | cryo-em structure of the plant 80s ribosome | 0.8867 | 159 | 186 |
| 7qiz-assembly1.cif.gz_c | specific features and methylation sites of a plant 80s ribosome | 0.8839 | 159 | 186 |
| 8ink-assembly1.cif.gz_L | human nuclear pre-60s ribosomal particle - state d | 0.8357 | 156 | 186 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WIY5_101_213_3.40.1350.10 | Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; | 0.9523 | 81 | 186 | 3.40.1350.10 |
| af_P9WIY5_101_213_3.40.1350.10 | Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; | 0.8869 | 81 | 186 | 3.40.1350.10 |
| 4w20a02 | Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; | 0.8606 | 158 | 186 | 3.100.10.10 |
| af_P9WIY5_1_96_2.70.180.20 | Mainly Beta;Distorted Sandwich;Protein Yojf; Chain: A;; | 0.8597 | 2 | 76 | 2.70.180.20 |
| 2vldB01 | Mainly Beta;Distorted Sandwich;Protein Yojf; Chain: A;; | 0.8071 | 2 | 77 | 2.70.180.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1V3XH57-F1-model_v4 | Endonuclease NucS C-terminal domain-containing protein | 0.987 | 83 | 192 |
GO:0003677
GO:0004519 |
| AF-A0A3D5GPY0-F1-model_v4 | Endonuclease | 0.9661 | 84 | 147 |
GO:0003677
GO:0004519 |
| AF-A0A7C3XCH8-F1-model_v4 | DUF91 domain-containing protein | 0.959 | 86 | 186 |
GO:0003676
|
| AF-X8F319-F1-model_v4 | deleted | 0.9461 | 87 | 183 |
|
| AF-A0A2V3J8L5-F1-model_v4 | Endonuclease NucS C-terminal domain-containing protein | 0.9461 | 86 | 186 |
GO:0003677
GO:0004519 GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar