F471529

General Info

Members Datasets Scaffolds Average Seq Length
638 314 1276 87

Family's Representative Sequence

Representative Sequence 3300035111|Ga0373923_0664807|Ga0373923_0664807_36_359
Length 107
Sequence VGLHREAFAGDLLSGSGLAQTMTVHIPSALRSYTAQQGDVQVEGATLADVLAALDRRYPGIRFRIITEQDRIRPHIRIFVDEEQLQDLAAPLHRTDTVYIVCALSGG

Samples

Sample ID Description Type Environment
1 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
10 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
11 3300003380 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM Metagenome Rhizosphere
12 3300003382 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM Metagenome Rhizosphere
13 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
14 3300003397 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM Metagenome Rhizosphere
15 3300003399 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM Metagenome Rhizosphere
16 3300003405 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM Metagenome Rhizosphere
17 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
64 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
96 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
97 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
98 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
141 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
143 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
230 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
231 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
232 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
233 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
234 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
235 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
236 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
237 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
238 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
239 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
240 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
241 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
242 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
243 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
244 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
245 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
246 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
247 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
248 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
249 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
250 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
251 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
252 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
253 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
254 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
255 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
256 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
257 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
259 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
260 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
261 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
262 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
263 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
264 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
265 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
266 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
267 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
268 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
269 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
270 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
271 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
272 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
273 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
274 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
275 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
276 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
277 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
278 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
279 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
280 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
283 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
289 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
292 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
293 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
294 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
295 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
296 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
297 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
300 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
301 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
302 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
303 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
304 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
305 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
306 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
307 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
308 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
309 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
310 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
311 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
312 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
313 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
314 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 0.78
Rhizosphere 98.9
Stem 0
Stem Tuber 0
Unclassified 23.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373923_0664807 3300035111 Unclassified 516
2 RicEn_FSXC80906_b1 2010549000 Bacteria 791
3 SwRhRL2b_contig_3472728 2162886007 Unclassified 980
4 MBSR1b_contig_9222305 2162886012 Bacteria 1008
5 ARCol0yngRDRAFT_1013271 3300000652 Unclassified 613
6 JGI24739J22299_10175751 3300001989 Unclassified 631
7 JGI24737J22298_10011446 3300001990 Unclassified 2907
8 JGI24743J22301_10039448 3300001991 Bacteria 945
9 JGI26129J50193_1002131 3300003349 Bacteria 1383
10 JGI26145J50221_1000096 3300003371 Bacteria 6878
11 JGI26144J50225_101113 3300003380 Unclassified 806
12 JGI26139J50223_101073 3300003382 Unclassified 846
13 JGI26140J50224_103923 3300003383 Unclassified 557
14 JGI26133J50247_100422 3300003397 Unclassified 1133
15 JGI26136J50244_101218 3300003399 Unclassified 813
16 JGI26132J50249_103257 3300003405 Unclassified 589
17 JGI26143J51219_1009017 3300003502 Unclassified 539
18 Ga0065704_10001227 3300005289 Bacteria 11632
19 Ga0065712_10038769 3300005290 Bacteria 981
20 Ga0065712_10394654 3300005290 Bacteria 738
21 Ga0065715_10026786 3300005293 Unclassified 2202
22 Ga0065715_10136139 3300005293 Bacteria 1927
23 Ga0065707_10001748 3300005295 Bacteria 9030
24 Ga0065707_10649361 3300005295 Unclassified 647
25 Ga0070676_10004156 3300005328 Bacteria 7603
26 Ga0070683_100080862 3300005329 Bacteria 3042
27 Ga0070683_100235675 3300005329 Bacteria 1740
28 Ga0070690_100000262 3300005330 Bacteria 27093
29 Ga0070690_100000599 3300005330 Bacteria 18205
30 Ga0070690_100012894 3300005330 Unclassified 4927
31 Ga0070690_100321750 3300005330 Bacteria 1115
32 Ga0070690_101764013 3300005330 Bacteria 504
33 Ga0070670_100004744 3300005331 Bacteria 11412
34 Ga0068869_100109336 3300005334 Unclassified 2101
35 Ga0068869_100551288 3300005334 Unclassified 968
36 Ga0068869_100965029 3300005334 Unclassified 740
37 Ga0070666_10061921 3300005335 Unclassified 2534
38 Ga0070680_100017536 3300005336 Bacteria 5646
39 Ga0070680_100031613 3300005336 Bacteria 4257
40 Ga0070680_100208949 3300005336 Bacteria 1647
41 Ga0070680_100353640 3300005336 Bacteria 1249
42 Ga0070680_100601218 3300005336 Bacteria 944
43 Ga0070680_100890041 3300005336 Bacteria 768
44 Ga0070682_100029882 3300005337 Bacteria 3285
45 Ga0070682_100043784 3300005337 Bacteria 2769
46 Ga0070682_101895356 3300005337 Unclassified 522
47 Ga0068868_100010759 3300005338 Bacteria 6633
48 Ga0068868_100063529 3300005338 Bacteria 2928
49 Ga0070660_100012601 3300005339 Bacteria 6041
50 Ga0070660_100063791 3300005339 Bacteria 2864
51 Ga0070660_100637634 3300005339 Bacteria 892
52 Ga0070660_100663018 3300005339 Unclassified 874
53 Ga0070689_100000033 3300005340 Bacteria 91630
54 Ga0070689_100000804 3300005340 Bacteria 19320
55 Ga0070689_100133235 3300005340 Bacteria 1994
56 Ga0070691_10000240 3300005341 Bacteria 18772
57 Ga0070691_10284083 3300005341 Unclassified 899
58 Ga0070691_10464319 3300005341 Bacteria 725
59 Ga0070687_100001489 3300005343 Bacteria 8262
60 Ga0070687_100001696 3300005343 Bacteria 7909
61 Ga0070687_100043713 3300005343 Unclassified 2278
62 Ga0070687_100356995 3300005343 Bacteria 945
63 Ga0070661_100002485 3300005344 Bacteria 12635
64 Ga0070661_100277176 3300005344 Unclassified 1300
65 Ga0070661_100871549 3300005344 Bacteria 742
66 Ga0070692_10017069 3300005345 Bacteria 3463
67 Ga0070692_10337358 3300005345 Bacteria 932
68 Ga0070692_10614512 3300005345 Bacteria 721
69 Ga0070692_11059967 3300005345 Unclassified 570
70 Ga0070668_100033020 3300005347 Bacteria 3940
71 Ga0070668_101054397 3300005347 Bacteria 732
72 Ga0070669_100002951 3300005353 Bacteria 12262
73 Ga0070669_100800129 3300005353 Unclassified 801
74 Ga0070675_100065055 3300005354 Unclassified 3014
75 Ga0070675_100099618 3300005354 Unclassified 2447
76 Ga0070675_100235271 3300005354 Bacteria 1599
77 Ga0070675_101303626 3300005354 Bacteria 669
78 Ga0070671_100414733 3300005355 Bacteria 1153
79 Ga0070671_100856904 3300005355 Bacteria 793
80 Ga0070674_100007395 3300005356 Bacteria 6478
81 Ga0070673_100001861 3300005364 Bacteria 12606
82 Ga0070673_100254186 3300005364 Bacteria 1533
83 Ga0070673_100618692 3300005364 Unclassified 989
84 Ga0070673_100641085 3300005364 Bacteria 972
85 Ga0070673_100848921 3300005364 Bacteria 845
86 Ga0070688_100000037 3300005365 Bacteria 61098
87 Ga0070688_100003744 3300005365 Bacteria 7873
88 Ga0070688_100087620 3300005365 Bacteria 2028
89 Ga0070659_100001082 3300005366 Bacteria 19884
90 Ga0070659_100130241 3300005366 Bacteria 2043
91 Ga0070659_100224224 3300005366 Bacteria 1552
92 Ga0070659_100994542 3300005366 Bacteria 736
93 Ga0070659_101968886 3300005366 Bacteria 524
94 Ga0070667_100005324 3300005367 Bacteria 10748
95 Ga0070667_100957687 3300005367 Bacteria 798
96 Ga0070667_101892737 3300005367 Unclassified 562
97 Ga0070703_10082275 3300005406 Unclassified 1099
98 Ga0070709_10284239 3300005434 Bacteria 1203
99 Ga0070709_10649716 3300005434 Unclassified 816
100 Ga0070709_10912539 3300005434 Bacteria 695
101 Ga0070709_11130880 3300005434 Bacteria 627
102 Ga0070714_100249414 3300005435 Bacteria 1641
103 Ga0070713_100019418 3300005436 Bacteria 5189
104 Ga0070713_100469669 3300005436 Bacteria 1184
105 Ga0070713_101114213 3300005436 Bacteria 763
106 Ga0070713_102257193 3300005436 Unclassified 527
107 Ga0070710_10423839 3300005437 Bacteria 897
108 Ga0070701_10000186 3300005438 Bacteria 19323
109 Ga0070701_10131056 3300005438 Unclassified 1424
110 Ga0070711_100083681 3300005439 Bacteria 2281
111 Ga0070711_100294599 3300005439 Unclassified 1288
112 Ga0070705_100007913 3300005440 Bacteria 5252
113 Ga0070705_100024768 3300005440 Unclassified 3244
114 Ga0070705_100221858 3300005440 Bacteria 1309
115 Ga0070705_100377768 3300005440 Bacteria 1042
116 Ga0070705_100574762 3300005440 Bacteria 868
117 Ga0070700_100000693 3300005441 Bacteria 16629
118 Ga0070700_100002398 3300005441 Bacteria 9553
119 Ga0070694_100005880 3300005444 Bacteria 7440
120 Ga0070694_100028918 3300005444 Bacteria 3612
121 Ga0070694_100281144 3300005444 Unclassified 1269
122 Ga0070708_100149451 3300005445 Bacteria 2172
123 Ga0070708_100666528 3300005445 Unclassified 980
124 Ga0070663_100460643 3300005455 Bacteria 1050
125 Ga0070663_100599526 3300005455 Unclassified 926
126 Ga0070678_100007437 3300005456 Bacteria 6499
127 Ga0070662_100000059 3300005457 Bacteria 59672
128 Ga0070662_100040789 3300005457 Bacteria 3307
129 Ga0070662_100759010 3300005457 Bacteria 823
130 Ga0070662_101307351 3300005457 Unclassified 624
131 Ga0070681_10094495 3300005458 Unclassified 2938
132 Ga0070681_10132851 3300005458 Bacteria 2421
133 Ga0070681_10146195 3300005458 Bacteria 2293
134 Ga0070681_10231050 3300005458 Bacteria 1764
135 Ga0070681_10423902 3300005458 Unclassified 1243
136 Ga0070681_11023906 3300005458 Bacteria 746
137 Ga0068867_100000588 3300005459 Bacteria 24065
138 Ga0070685_10000094 3300005466 Bacteria 55308
139 Ga0070685_10017142 3300005466 Bacteria 3873
140 Ga0070685_11046313 3300005466 Unclassified 614
141 Ga0070706_100260763 3300005467 Unclassified 1618
142 Ga0070706_100316884 3300005467 Bacteria 1455
143 Ga0070707_100739193 3300005468 Unclassified 947
144 Ga0070699_100019917 3300005518 Bacteria 5782
145 Ga0070699_100027789 3300005518 Bacteria 4878
146 Ga0070699_100655987 3300005518 Bacteria 958
147 Ga0070679_100020498 3300005530 Bacteria 6447
148 Ga0070679_100095966 3300005530 Bacteria 2953
149 Ga0070679_100135177 3300005530 Bacteria 2447
150 Ga0070684_100002952 3300005535 Bacteria 12658
151 Ga0070684_100052961 3300005535 Bacteria 3530
152 Ga0070684_100059659 3300005535 Bacteria 3336
153 Ga0070684_100109315 3300005535 Bacteria 2478
154 Ga0070684_100946582 3300005535 Bacteria 808
155 Ga0070697_100024758 3300005536 Bacteria 4780
156 Ga0070697_102062303 3300005536 Unclassified 510
157 Ga0068853_100062679 3300005539 Bacteria 3218
158 Ga0068853_100248699 3300005539 Bacteria 1631
159 Ga0070672_100008345 3300005543 Bacteria 7081
160 Ga0070672_100159976 3300005543 Bacteria 1868
161 Ga0070686_100000046 3300005544 Bacteria 101202
162 Ga0070686_100046348 3300005544 Unclassified 2743
163 Ga0070695_100007518 3300005545 Bacteria 6455
164 Ga0070695_100009317 3300005545 Bacteria 5838
165 Ga0070695_100379913 3300005545 Bacteria 1066
166 Ga0070695_100841435 3300005545 Bacteria 738
167 Ga0070696_100000917 3300005546 Bacteria 19177
168 Ga0070696_100035707 3300005546 Bacteria 3424
169 Ga0070696_100036878 3300005546 Bacteria 3373
170 Ga0070696_100038231 3300005546 Bacteria 3312
171 Ga0070693_100299292 3300005547 Bacteria 1084
172 Ga0070693_101366725 3300005547 Unclassified 549
173 Ga0070665_100021825 3300005548 Bacteria 6438
174 Ga0070665_100100606 3300005548 Unclassified 2895
175 Ga0070704_100020279 3300005549 Bacteria 4284
176 Ga0070704_100060025 3300005549 Bacteria 2716
177 Ga0070704_100073152 3300005549 Unclassified 2496
178 Ga0070704_100106480 3300005549 Bacteria 2125
179 Ga0068855_100020624 3300005563 Bacteria 7902
180 Ga0068855_100043350 3300005563 Bacteria 5330
181 Ga0068855_100645251 3300005563 Bacteria 1137
182 Ga0068855_100967075 3300005563 Unclassified 896
183 Ga0068855_101057242 3300005563 Bacteria 850
184 Ga0070664_100005553 3300005564 Bacteria 10130
185 Ga0070664_100050169 3300005564 Bacteria 3531
186 Ga0070664_100305922 3300005564 Bacteria 1437
187 Ga0070664_100993632 3300005564 Unclassified 789
188 Ga0070664_101245087 3300005564 Bacteria 702
189 Ga0068857_100086583 3300005577 Unclassified 2802
190 Ga0068857_100269178 3300005577 Bacteria 1565
191 Ga0068857_100295958 3300005577 Bacteria 1491
192 Ga0068854_100125303 3300005578 Bacteria 1955
193 Ga0068854_101716327 3300005578 Unclassified 574
194 Ga0068856_100198336 3300005614 Bacteria 2022
195 Ga0068856_100825617 3300005614 Unclassified 946
196 Ga0070702_100005612 3300005615 Bacteria 5867
197 Ga0070702_100017056 3300005615 Bacteria 3739
198 Ga0070702_101155338 3300005615 Unclassified 622
199 Ga0068852_100253256 3300005616 Bacteria 1688
200 Ga0068852_100414525 3300005616 Bacteria 1327
201 Ga0068852_100933739 3300005616 Bacteria 885
202 Ga0068859_100000268 3300005617 Bacteria 52155
203 Ga0068859_100471957 3300005617 Unclassified 1350
204 Ga0068864_100449212 3300005618 Bacteria 1232
205 Ga0068864_102671982 3300005618 Bacteria 505
206 Ga0068866_10079806 3300005718 Unclassified 1754
207 Ga0068866_10109766 3300005718 Unclassified 1537
208 Ga0068861_100034006 3300005719 Bacteria 3766
209 Ga0068861_100197335 3300005719 Bacteria 1687
210 Ga0068851_10053867 3300005834 Bacteria 2049
211 Ga0068870_10298274 3300005840 Unclassified 1016
212 Ga0068858_100099740 3300005842 Unclassified 2708
213 Ga0068858_100627393 3300005842 Bacteria 1044
214 Ga0068860_100339757 3300005843 Bacteria 1476
215 Ga0068862_100018796 3300005844 Bacteria 5759
216 Ga0081455_10001030 3300005937 Bacteria 35155
217 Ga0070717_10491242 3300006028 Unclassified 1109
218 Ga0075432_10000012 3300006058 Bacteria 34480
219 Ga0070716_100011775 3300006173 Bacteria 4411
220 Ga0070716_100318415 3300006173 Unclassified 1089
221 Ga0070712_100262093 3300006175 Bacteria 1385
222 Ga0070712_101394535 3300006175 Unclassified 611
223 Ga0075427_10054600 3300006194 Unclassified 692
224 Ga0097621_100002795 3300006237 Bacteria 11951
225 Ga0097621_100009709 3300006237 Bacteria 7000
226 Ga0068871_100038656 3300006358 Bacteria 3813
227 Ga0068871_100048587 3300006358 Unclassified 3426
228 Ga0068871_102340718 3300006358 Bacteria 509
229 Ga0075428_100079031 3300006844 Unclassified 3590
230 Ga0075430_100022687 3300006846 Bacteria 5340
231 Ga0075431_100014312 3300006847 Bacteria 8024
232 Ga0075431_101668635 3300006847 Unclassified 594
233 Ga0075433_10005983 3300006852 Bacteria 9582
234 Ga0075433_10023205 3300006852 Bacteria 5219
235 Ga0075434_100031609 3300006871 Bacteria 5219
236 Ga0075434_100169753 3300006871 Bacteria 2201
237 Ga0075434_100261752 3300006871 Bacteria 1749
238 Ga0075434_101914319 3300006871 Unclassified 599
239 Ga0075434_102237435 3300006871 Unclassified 550
240 Ga0075429_100014403 3300006880 Bacteria 6853
241 Ga0068865_100006114 3300006881 Bacteria 7341
242 Ga0075436_100027627 3300006914 Bacteria 3905
243 Ga0075436_100129161 3300006914 Bacteria 1771
244 Ga0075436_100138627 3300006914 Bacteria 1709
245 Ga0075436_100576683 3300006914 Bacteria 827
246 Ga0097620_100000268 3300006931 Bacteria 52155
247 Ga0097620_100471959 3300006931 Unclassified 1350
248 Ga0075435_100018596 3300007076 Bacteria 5290
249 Ga0075435_100033649 3300007076 Bacteria 4054
250 Ga0075435_100133798 3300007076 Bacteria 2076
251 Ga0105240_10016183 3300009093 Bacteria 10109
252 Ga0105240_10089061 3300009093 Unclassified 3775
253 Ga0105240_10385036 3300009093 Bacteria 1583
254 Ga0111539_10068112 3300009094 Bacteria 4202
255 Ga0105245_10006102 3300009098 Bacteria 10595
256 Ga0105245_10031089 3300009098 Bacteria 4723
257 Ga0105245_10059149 3300009098 Bacteria 3450
258 Ga0105245_10737147 3300009098 Bacteria 1020
259 Ga0114129_10112329 3300009147 Unclassified 3758
260 Ga0114129_10720964 3300009147 Bacteria 1280
261 Ga0105243_10002601 3300009148 Bacteria 15051
262 Ga0105243_10970713 3300009148 Bacteria 850
263 Ga0105241_10003827 3300009174 Bacteria 11156
264 Ga0105241_10061810 3300009174 Unclassified 2886
265 Ga0105241_10487960 3300009174 Bacteria 1096
266 Ga0105242_10000834 3300009176 Bacteria 23976
267 Ga0105242_10014909 3300009176 Bacteria 6024
268 Ga0105242_10545310 3300009176 Bacteria 1111
269 Ga0105242_10647803 3300009176 Bacteria 1027
270 Ga0105248_10002942 3300009177 Bacteria 18900
271 Ga0105248_10017325 3300009177 Bacteria 7940
272 Ga0105248_10154762 3300009177 Bacteria 2587
273 Ga0105248_10176492 3300009177 Unclassified 2407
274 Ga0105237_10056285 3300009545 Bacteria 3937
275 Ga0105237_10855372 3300009545 Bacteria 916
276 Ga0105238_10006104 3300009551 Bacteria 11950
277 Ga0105238_10020927 3300009551 Bacteria 6664
278 Ga0105238_10037160 3300009551 Bacteria 4952
279 Ga0105249_10018526 3300009553 Bacteria 6198
280 Ga0099796_10000043 3300010159 Bacteria 25487
281 Ga0105239_10052861 3300010375 Unclassified 4455
282 Ga0105239_10073356 3300010375 Bacteria 3763
283 Ga0105239_10760606 3300010375 Bacteria 1109
284 Ga0105246_10001787 3300011119 Bacteria 12861
285 Ga0157373_10027247 3300013100 Bacteria 4122
286 Ga0157373_10274745 3300013100 Bacteria 1193
287 Ga0157371_10026011 3300013102 Bacteria 4258
288 Ga0157370_10024219 3300013104 Bacteria 6015
289 Ga0157369_10007564 3300013105 Bacteria 12501
290 Ga0157369_10052783 3300013105 Bacteria 4396
291 Ga0157374_10060711 3300013296 Bacteria 3539
292 Ga0157374_10064613 3300013296 Unclassified 3435
293 Ga0157378_10027310 3300013297 Bacteria 5037
294 Ga0157378_10487159 3300013297 Bacteria 1230
295 Ga0163162_10042113 3300013306 Bacteria 4569
296 Ga0157372_10014005 3300013307 Bacteria 8567
297 Ga0157372_10152193 3300013307 Bacteria 2671
298 Ga0157372_10648946 3300013307 Bacteria 1229
299 Ga0157372_11938686 3300013307 Unclassified 677
300 Ga0157375_10020913 3300013308 Bacteria 5989
301 Ga0157375_10203053 3300013308 Unclassified 2138
302 Ga0163163_10374442 3300014325 Bacteria 1481
303 Ga0157380_10007252 3300014326 Bacteria 7864
304 Ga0157380_10049597 3300014326 Bacteria 3312
305 Ga0182008_10224138 3300014497 Bacteria 963
306 Ga0157377_10000545 3300014745 Bacteria 15900
307 Ga0157379_10004634 3300014968 Bacteria 11797
308 Ga0157379_10778416 3300014968 Bacteria 902
309 Ga0157379_11400134 3300014968 Unclassified 678
310 Ga0157376_10000178 3300014969 Bacteria 43694
311 Ga0157376_11384374 3300014969 Bacteria 735
312 Ga0182005_1267822 3300015265 Unclassified 533
313 Ga0206356_10489059 3300020070 Unclassified 733
314 Ga0213872_10002174 3300021361 Bacteria 11742
315 Ga0213872_10007518 3300021361 Bacteria 5353
316 Ga0213872_10034775 3300021361 Bacteria 2305
317 Ga0213872_10066257 3300021361 Bacteria 1630
318 Ga0213872_10101917 3300021361 Bacteria 1279
319 Ga0213872_10114380 3300021361 Unclassified 1196
320 Ga0213872_10221935 3300021361 Bacteria 804
321 Ga0213872_10273882 3300021361 Bacteria 706
322 Ga0213872_10417193 3300021361 Bacteria 542
323 Ga0213871_10050271 3300021441 Bacteria 1140
324 Ga0213871_10302956 3300021441 Unclassified 516
325 Ga0207656_10163162 3300025321 Bacteria 1061
326 Ga0207653_10082265 3300025885 Bacteria 1117
327 Ga0207682_10179702 3300025893 Bacteria 966
328 Ga0207642_10063933 3300025899 Unclassified 1723
329 Ga0207642_10192370 3300025899 Unclassified 1120
330 Ga0207688_10002146 3300025901 Bacteria 10609
331 Ga0207680_10039913 3300025903 Unclassified 2727
332 Ga0207647_10114744 3300025904 Bacteria 1591
333 Ga0207699_10123276 3300025906 Unclassified 1679
334 Ga0207645_10000009 3300025907 Bacteria 142449
335 Ga0207645_10599281 3300025907 Unclassified 748
336 Ga0207643_10010334 3300025908 Bacteria 5025
337 Ga0207684_10448191 3300025910 Bacteria 1108
338 Ga0207654_10024500 3300025911 Bacteria 3246
339 Ga0207654_10051850 3300025911 Bacteria 2363
340 Ga0207654_10074323 3300025911 Unclassified 2028
341 Ga0207707_10066441 3300025912 Unclassified 3141
342 Ga0207707_10127174 3300025912 Bacteria 2228
343 Ga0207707_10648491 3300025912 Bacteria 890
344 Ga0207707_11431167 3300025912 Unclassified 550
345 Ga0207695_10013524 3300025913 Bacteria 9726
346 Ga0207695_10154075 3300025913 Unclassified 2234
347 Ga0207695_10932850 3300025913 Bacteria 748
348 Ga0207693_10022544 3300025915 Bacteria 5003
349 Ga0207693_10307887 3300025915 Bacteria 1240
350 Ga0207663_10036613 3300025916 Bacteria 2953
351 Ga0207663_10193157 3300025916 Unclassified 1463
352 Ga0207663_10280719 3300025916 Bacteria 1237
353 Ga0207660_10002893 3300025917 Bacteria 11221
354 Ga0207660_10309890 3300025917 Bacteria 1258
355 Ga0207660_10314181 3300025917 Bacteria 1250
356 Ga0207662_10000618 3300025918 Bacteria 15923
357 Ga0207662_10018316 3300025918 Bacteria 3971
358 Ga0207662_10152298 3300025918 Bacteria 1471
359 Ga0207657_10001604 3300025919 Bacteria 24328
360 Ga0207657_10012182 3300025919 Bacteria 8498
361 Ga0207657_11315206 3300025919 Bacteria 546
362 Ga0207649_10012112 3300025920 Bacteria 4773
363 Ga0207649_10149932 3300025920 Bacteria 1605
364 Ga0207649_10209977 3300025920 Bacteria 1380
365 Ga0207649_10492187 3300025920 Bacteria 931
366 Ga0207652_10033557 3300025921 Bacteria 4322
367 Ga0207652_10402045 3300025921 Bacteria 1236
368 Ga0207652_10422484 3300025921 Bacteria 1202
369 Ga0207652_10958180 3300025921 Bacteria 754
370 Ga0207646_10444286 3300025922 Bacteria 1170
371 Ga0207646_11068316 3300025922 Unclassified 711
372 Ga0207681_10051921 3300025923 Unclassified 2778
373 Ga0207681_11736561 3300025923 Unclassified 521
374 Ga0207694_10017482 3300025924 Bacteria 5419
375 Ga0207694_10250504 3300025924 Bacteria 1449
376 Ga0207694_10747832 3300025924 Bacteria 825
377 Ga0207650_10014984 3300025925 Bacteria 5392
378 Ga0207659_10004061 3300025926 Bacteria 8833
379 Ga0207659_10198989 3300025926 Bacteria 1599
380 Ga0207659_10303680 3300025926 Bacteria 1312
381 Ga0207687_10018476 3300025927 Bacteria 4603
382 Ga0207687_11160672 3300025927 Bacteria 664
383 Ga0207700_10026363 3300025928 Bacteria 4050
384 Ga0207700_10121078 3300025928 Bacteria 2122
385 Ga0207700_10586415 3300025928 Bacteria 991
386 Ga0207664_10010829 3300025929 Bacteria 6456
387 Ga0207664_10214206 3300025929 Bacteria 1668
388 Ga0207644_10118383 3300025931 Unclassified 2013
389 Ga0207644_10197018 3300025931 Bacteria 1587
390 Ga0207644_10733059 3300025931 Unclassified 825
391 Ga0207690_10001782 3300025932 Bacteria 13229
392 Ga0207690_10075392 3300025932 Bacteria 2339
393 Ga0207690_10140797 3300025932 Bacteria 1777
394 Ga0207690_10560372 3300025932 Bacteria 930
395 Ga0207706_10000134 3300025933 Bacteria 80573
396 Ga0207706_10617539 3300025933 Bacteria 930
397 Ga0207686_10006696 3300025934 Bacteria 6209
398 Ga0207686_10168399 3300025934 Unclassified 1543
399 Ga0207686_11183527 3300025934 Bacteria 625
400 Ga0207709_10013612 3300025935 Bacteria 4488
401 Ga0207670_10000042 3300025936 Bacteria 98927
402 Ga0207670_10032612 3300025936 Bacteria 3351
403 Ga0207670_10048808 3300025936 Unclassified 2827
404 Ga0207670_10285532 3300025936 Bacteria 1288
405 Ga0207669_10004535 3300025937 Bacteria 6127
406 Ga0207704_10002290 3300025938 Bacteria 8607
407 Ga0207704_10061399 3300025938 Bacteria 2331
408 Ga0207704_10139575 3300025938 Bacteria 1693
409 Ga0207665_10008655 3300025939 Bacteria 6699
410 Ga0207691_10000066 3300025940 Bacteria 84662
411 Ga0207691_10149662 3300025940 Bacteria 2053
412 Ga0207711_10007640 3300025941 Bacteria 9042
413 Ga0207711_10009885 3300025941 Bacteria 7933
414 Ga0207689_10006708 3300025942 Bacteria 10156
415 Ga0207689_10576995 3300025942 Bacteria 945
416 Ga0207689_11136995 3300025942 Unclassified 658
417 Ga0207661_10086402 3300025944 Bacteria 2603
418 Ga0207661_10158378 3300025944 Unclassified 1963
419 Ga0207661_10377832 3300025944 Bacteria 1282
420 Ga0207679_10000771 3300025945 Bacteria 20959
421 Ga0207679_10064066 3300025945 Unclassified 2746
422 Ga0207679_11210137 3300025945 Bacteria 693
423 Ga0207679_11414854 3300025945 Unclassified 638
424 Ga0207667_10010777 3300025949 Bacteria 10663
425 Ga0207667_10728333 3300025949 Bacteria 992
426 Ga0207651_10003923 3300025960 Bacteria 7382
427 Ga0207651_10279715 3300025960 Bacteria 1378
428 Ga0207651_10839447 3300025960 Bacteria 816
429 Ga0207651_11460001 3300025960 Bacteria 616
430 Ga0207651_11751068 3300025960 Bacteria 559
431 Ga0207712_10110621 3300025961 Unclassified 2060
432 Ga0207668_10040247 3300025972 Unclassified 3152
433 Ga0207640_11135589 3300025981 Unclassified 692
434 Ga0207640_11137138 3300025981 Bacteria 692
435 Ga0207658_10003514 3300025986 Bacteria 11061
436 Ga0207658_10573597 3300025986 Bacteria 1011
437 Ga0207677_10004218 3300026023 Bacteria 7694
438 Ga0207677_10687238 3300026023 Bacteria 907
439 Ga0207703_10080616 3300026035 Unclassified 2711
440 Ga0207639_10117641 3300026041 Bacteria 2178
441 Ga0207639_10126648 3300026041 Bacteria 2107
442 Ga0207639_10332577 3300026041 Bacteria 1352
443 Ga0207678_10028054 3300026067 Bacteria 4916
444 Ga0207678_10320008 3300026067 Bacteria 1335
445 Ga0207708_10000084 3300026075 Bacteria 73337
446 Ga0207708_10000336 3300026075 Bacteria 36973
447 Ga0207702_10022671 3300026078 Bacteria 5206
448 Ga0207702_10188506 3300026078 Bacteria 1904
449 Ga0207702_11065505 3300026078 Bacteria 802
450 Ga0207702_12397158 3300026078 Unclassified 515
451 Ga0207641_11650095 3300026088 Unclassified 643
452 Ga0207648_10000049 3300026089 Bacteria 108876
453 Ga0207648_10030199 3300026089 Bacteria 4802
454 Ga0207676_10412097 3300026095 Bacteria 1265
455 Ga0207674_10014015 3300026116 Bacteria 8860
456 Ga0207675_100210564 3300026118 Bacteria 1869
457 Ga0207675_100419164 3300026118 Bacteria 1322
458 Ga0207675_100855443 3300026118 Bacteria 924
459 Ga0207683_10000023 3300026121 Bacteria 114463
460 Ga0207683_11055134 3300026121 Unclassified 754
461 Ga0207698_10020098 3300026142 Bacteria 4590
462 Ga0207698_10151001 3300026142 Bacteria 2016
463 Ga0207698_10593427 3300026142 Bacteria 1091
464 Ga0209973_1000088 3300027252 Bacteria 5116
465 Ga0209969_1000233 3300027360 Bacteria 7474
466 Ga0209967_1000068 3300027364 Bacteria 13872
467 Ga0209981_1000063 3300027378 Bacteria 11574
468 Ga0209996_1000107 3300027395 Bacteria 10784
469 Ga0209984_1000209 3300027424 Bacteria 6734
470 Ga0209984_1041287 3300027424 Bacteria 665
471 Ga0210000_1000014 3300027462 Bacteria 31267
472 Ga0209995_1000076 3300027471 Bacteria 15333
473 Ga0209995_1041783 3300027471 Unclassified 774
474 Ga0209179_1000020 3300027512 Bacteria 45663
475 Ga0209968_1000036 3300027526 Bacteria 24144
476 Ga0209999_1001543 3300027543 Bacteria 3961
477 Ga0209999_1046823 3300027543 Unclassified 814
478 Ga0209982_1003317 3300027552 Unclassified 2284
479 Ga0209970_1000140 3300027614 Bacteria 10988
480 Ga0210002_1000004 3300027617 Bacteria 38105
481 Ga0209983_1000028 3300027665 Bacteria 19716
482 Ga0209971_1000305 3300027682 Bacteria 13653
483 Ga0209966_1000028 3300027695 Bacteria 65208
484 Ga0209998_10000030 3300027717 Bacteria 60299
485 Ga0209974_10001002 3300027876 Bacteria 9957
486 Ga0207428_10005241 3300027907 Bacteria 12112
487 Ga0207428_10165615 3300027907 Bacteria 1676
488 Ga0268266_10088421 3300028379 Bacteria 2711
489 Ga0268266_10141039 3300028379 Unclassified 2163
490 Ga0268265_10027712 3300028380 Unclassified 4047
491 Ga0268264_10261112 3300028381 Bacteria 1613
492 Ga0268264_10720630 3300028381 Unclassified 992
493 Ga0265337_1001920 3300028556 Bacteria 9880
494 Ga0265334_10005761 3300028573 Bacteria 5399
495 Ga0265338_10187929 3300028800 Bacteria 1568
496 Ga0265316_10442065 3300031344 Bacteria 933
497 Ga0307408_100845054 3300031548 Bacteria 834
498 Ga0265314_10221144 3300031711 Bacteria 1105
499 Ga0307516_10121899 3300031730 Bacteria 2396
500 Ga0307405_10327819 3300031731 Bacteria 1172
501 Ga0307406_10539134 3300031901 Bacteria 953
502 Ga0307416_100175287 3300032002 Bacteria 2002
503 Ga0307416_100327373 3300032002 Bacteria 1538
504 Ga0373930_0215720 3300034816 Unclassified 504
505 Ga0373948_0057297 3300034817 Unclassified 849
506 Ga0373938_0130521 3300034957 Bacteria 655
507 Ga0373938_0213068 3300034957 Unclassified 540
508 Ga0373940_0148668 3300035088 Unclassified 745
509 Ga0373949_0296159 3300035090 Unclassified 512
510 Ga0373923_0119029 3300035111 Bacteria 1179
511 Ga0373939_0046143 3300035114 Bacteria 1333
512 Ga0373956_0032507 3300035119 Bacteria 2289
513 Ga0373956_0516799 3300035119 Bacteria 570
514 Ga0373943_0021509 3300035170 Bacteria 2980
515 Ga0373946_0054513 3300035171 Bacteria 1683
516 Ga0373946_0126274 3300035171 Bacteria 1173
517 Ga0373955_0112395 3300035172 Bacteria 1576
518 Ga0373955_0683857 3300035172 Bacteria 629
519 Ga0373942_0040627 3300035207 Unclassified 1269
520 Ga0373961_0156908 3300035241 Bacteria 779
521 Ga0373961_0232285 3300035241 Unclassified 661
522 Ga0373924_0163370 3300035410 Bacteria 977
523 Ga0373924_0225127 3300035410 Bacteria 829
524 Ga0373931_0168604 3300035691 Bacteria 1288
525 Ga0373931_0448341 3300035691 Unclassified 825
526 Ga0373931_0601990 3300035691 Unclassified 718
527 Ga0373935_0081134 3300035692 Bacteria 2108
528 Ga0373935_1205797 3300035692 Unclassified 564
529 Ga0373927_0053153 3300035695 Bacteria 2620
530 Ga0373927_0423567 3300035695 Bacteria 879
531 Ga0373927_0470186 3300035695 Bacteria 831
532 Ga0373933_0036577 3300035724 Bacteria 2875
533 Ga0373933_0130336 3300035724 Bacteria 1581
534 Ga0373933_0384547 3300035724 Bacteria 914
535 Ga0373933_0592158 3300035724 Bacteria 728
536 Ga0373947_0014684 3300035725 Bacteria 4493
537 Ga0373937_0004534 3300036401 Bacteria 11799
538 Ga0373937_0037041 3300036401 Bacteria 4445
539 Ga0373937_0315849 3300036401 Bacteria 1478
540 Ga0373937_0482503 3300036401 Bacteria 1177
541 Ga0373925_0012346 3300037068 Bacteria 6185
542 Ga0373925_0051879 3300037068 Bacteria 3063
543 Ga0373925_0779665 3300037068 Bacteria 788
544 Ga0436360_0386988 3300039438 Bacteria 1168
545 Ga0436360_1126290 3300039438 Bacteria 3156
546 Ga0436361_0076840 3300039447 Bacteria 3571
547 Ga0436361_0126174 3300039447 Bacteria 3414
548 Ga0436361_0142262 3300039447 Bacteria 1036
549 Ga0436361_0172980 3300039447 Bacteria 1547
550 Ga0436361_0200442 3300039447 Bacteria 669
551 Ga0436361_0247078 3300039447 Bacteria 1623
552 Ga0436361_0260598 3300039447 Bacteria 784
553 Ga0436361_0375279 3300039447 Bacteria 1327
554 Ga0436361_0438170 3300039447 Bacteria 571
555 Ga0436361_0456495 3300039447 Bacteria 2340
556 Ga0436361_0525411 3300039447 Bacteria 1944
557 Ga0436361_0778576 3300039447 Bacteria 3338
558 Ga0436361_0946955 3300039447 Bacteria 3021
559 Ga0436361_1004128 3300039447 Bacteria 5413
560 Ga0436361_1041964 3300039447 Bacteria 4665
561 Ga0436361_1097180 3300039447 Bacteria 691
562 Ga0436361_1193359 3300039447 Bacteria 768
563 Ga0450914_053332 3300042118 Unclassified 536
564 Ga0439460_0078475 3300042461 Unclassified 1033
565 Ga0439460_0228500 3300042461 Unclassified 639
566 Ga0451577_0393994 3300042876 Bacteria 1257
567 Ga0451577_1907246 3300042876 Unclassified 520
568 Ga0453683_0000391 3300044673 Bacteria 52370
569 Ga0466966_0050993 3300044684 Bacteria 2631
570 Ga0453684_0152593 3300044712 Bacteria 2743
571 Ga0466957_0011079 3300044842 Bacteria 5190
572 Ga0466959_0758659 3300045049 Bacteria 649
573 Ga0451576_0004548 3300045051 Bacteria 17956
574 Ga0451576_0076791 3300045051 Unclassified 3476
575 Ga0451576_0078658 3300045051 Bacteria 3431
576 Ga0451576_0088286 3300045051 Bacteria 3225
577 Ga0451576_1043386 3300045051 Bacteria 856
578 Ga0466958_0000247 3300045836 Bacteria 20810
579 Ga0495630_0146465 3300046517 Bacteria 1796
580 Ga0495642_0360900 3300046528 Bacteria 639
581 Ga0495665_0516743 3300046531 Bacteria 601
582 Ga0495587_0139371 3300046536 Bacteria 1385
583 Ga0495645_0189474 3300046543 Bacteria 1403
584 Ga0495667_0473934 3300046559 Bacteria 785
585 Ga0495625_0177022 3300046660 Bacteria 1421
586 Ga0495635_0973033 3300046663 Bacteria 541
587 Ga0495623_0488116 3300046679 Bacteria 652
588 Ga0495669_0000115 3300046684 Bacteria 51909
589 Ga0495674_0920283 3300047319 Bacteria 674
590 Ga0495677_0072187 3300047445 Bacteria 1287
591 Ga0495684_0073111 3300047471 Bacteria 2605
592 Ga0496102_0102450 3300048905 Bacteria 2661
593 Ga0496106_0045103 3300048909 Bacteria 3311
594 Ga0496106_0583677 3300048909 Unclassified 896
595 Ga0496107_0217790 3300048910 Bacteria 1420
596 Ga0496112_0361098 3300048915 Bacteria 1394
597 Ga0501299_018721 3300049522 Bacteria 1247
598 Ga0501040_0912038 3300049576 Unclassified 637
599 Ga0501042_0771336 3300049578 Unclassified 700
600 Ga0501068_0559025 3300049584 Unclassified 744
601 Ga0501071_0556436 3300049587 Unclassified 881
602 Ga0501075_1313687 3300049591 Unclassified 548
603 Ga0501079_0295596 3300049741 Bacteria 1267
604 Ga0501079_1562676 3300049741 Unclassified 519
605 Ga0501080_1787456 3300049742 Bacteria 517
606 Ga0501083_0796860 3300049744 Unclassified 615
607 Ga0501044_1599053 3300049823 Bacteria 517
608 nmdc:mga05p37_277608_c1 3300050507 Unclassified 2000
609 nmdc:mga09592_293072_c1 3300050508 Bacteria 1411
610 nmdc:mga0qj67_16449_c1 3300050509 Bacteria 5611
611 nmdc:mga06r32_2000884_c1 3300050510 Unclassified 513
612 nmdc:mga06r32_38999_c1 3300050510 Bacteria 4505
613 nmdc:mga08y16_30446_c1 3300050511 Bacteria 5681
614 nmdc:mga08y16_392423_c1 3300050511 Bacteria 1422
615 nmdc:mga0n895_10601_c1 3300050512 Bacteria 8158
616 nmdc:mga0n895_241429_c1 3300050512 Bacteria 1833
617 nmdc:mga0n895_379957_c1 3300050512 Unclassified 1430
618 nmdc:mga0n895_91027_c1 3300050512 Bacteria 3052
619 nmdc:mga0n895_977160_c1 3300050512 Unclassified 829
620 nmdc:mga0rr50_111647_c1 3300050513 Bacteria 2164
621 nmdc:mga0rr50_4677_c1 3300050513 Bacteria 8069
622 nmdc:mga0rr50_632058_c1 3300050513 Bacteria 913
623 nmdc:mga0rr50_7108_c1 3300050513 Bacteria 6875
624 nmdc:mga08x19_159711_c1 3300050514 Bacteria 1530
625 nmdc:mga08x19_257732_c1 3300050514 Bacteria 1205
626 nmdc:mga08x19_459077_c1 3300050514 Unclassified 897
627 nmdc:mga08x19_500088_c1 3300050514 Bacteria 858
628 nmdc:mga0a205_138830_c1 3300050515 Unclassified 2331
629 nmdc:mga0a205_34495_c1 3300050515 Bacteria 4854
630 Ga0495612_0040279 3300053078 Bacteria 1903
631 Ga0495612_0101182 3300053078 Bacteria 1227
632 Ga0495595_0403260 3300053084 Bacteria 693
633 Ga0501084_0483000 3300054114 Unclassified 1047
634 Ga0590071_011424 3300059421 Bacteria 2078
635 Ga0590075_019380 3300059424 Bacteria 1688
636 Ga0590077_017449 3300059426 Bacteria 1510
637 Ga0501082_1485817 3300060353 Unclassified 592
638 Ga0466962_0123653 3300061719 Bacteria 1249
639 Ga0373923_0664807
640 RicEn_FSXC80906_b1
641 SwRhRL2b_contig_3472728
642 MBSR1b_contig_9222305
643 ARCol0yngRDRAFT_1013271
644 JGI24739J22299_10175751
645 JGI24737J22298_10011446
646 JGI24743J22301_10039448
647 JGI26129J50193_1002131
648 JGI26145J50221_1000096
649 JGI26144J50225_101113
650 JGI26139J50223_101073
651 JGI26140J50224_103923
652 JGI26133J50247_100422
653 JGI26136J50244_101218
654 JGI26132J50249_103257
655 JGI26143J51219_1009017
656 Ga0065704_10001227
657 Ga0065712_10038769
658 Ga0065712_10394654
659 Ga0065715_10026786
660 Ga0065715_10136139
661 Ga0065707_10001748
662 Ga0065707_10649361
663 Ga0070676_10004156
664 Ga0070683_100080862
665 Ga0070683_100235675
666 Ga0070690_100000262
667 Ga0070690_100000599
668 Ga0070690_100012894
669 Ga0070690_100321750
670 Ga0070690_101764013
671 Ga0070670_100004744
672 Ga0068869_100109336
673 Ga0068869_100551288
674 Ga0068869_100965029
675 Ga0070666_10061921
676 Ga0070680_100017536
677 Ga0070680_100031613
678 Ga0070680_100208949
679 Ga0070680_100353640
680 Ga0070680_100601218
681 Ga0070680_100890041
682 Ga0070682_100029882
683 Ga0070682_100043784
684 Ga0070682_101895356
685 Ga0068868_100010759
686 Ga0068868_100063529
687 Ga0070660_100012601
688 Ga0070660_100063791
689 Ga0070660_100637634
690 Ga0070660_100663018
691 Ga0070689_100000033
692 Ga0070689_100000804
693 Ga0070689_100133235
694 Ga0070691_10000240
695 Ga0070691_10284083
696 Ga0070691_10464319
697 Ga0070687_100001489
698 Ga0070687_100001696
699 Ga0070687_100043713
700 Ga0070687_100356995
701 Ga0070661_100002485
702 Ga0070661_100277176
703 Ga0070661_100871549
704 Ga0070692_10017069
705 Ga0070692_10337358
706 Ga0070692_10614512
707 Ga0070692_11059967
708 Ga0070668_100033020
709 Ga0070668_101054397
710 Ga0070669_100002951
711 Ga0070669_100800129
712 Ga0070675_100065055
713 Ga0070675_100099618
714 Ga0070675_100235271
715 Ga0070675_101303626
716 Ga0070671_100414733
717 Ga0070671_100856904
718 Ga0070674_100007395
719 Ga0070673_100001861
720 Ga0070673_100254186
721 Ga0070673_100618692
722 Ga0070673_100641085
723 Ga0070673_100848921
724 Ga0070688_100000037
725 Ga0070688_100003744
726 Ga0070688_100087620
727 Ga0070659_100001082
728 Ga0070659_100130241
729 Ga0070659_100224224
730 Ga0070659_100994542
731 Ga0070659_101968886
732 Ga0070667_100005324
733 Ga0070667_100957687
734 Ga0070667_101892737
735 Ga0070703_10082275
736 Ga0070709_10284239
737 Ga0070709_10649716
738 Ga0070709_10912539
739 Ga0070709_11130880
740 Ga0070714_100249414
741 Ga0070713_100019418
742 Ga0070713_100469669
743 Ga0070713_101114213
744 Ga0070713_102257193
745 Ga0070710_10423839
746 Ga0070701_10000186
747 Ga0070701_10131056
748 Ga0070711_100083681
749 Ga0070711_100294599
750 Ga0070705_100007913
751 Ga0070705_100024768
752 Ga0070705_100221858
753 Ga0070705_100377768
754 Ga0070705_100574762
755 Ga0070700_100000693
756 Ga0070700_100002398
757 Ga0070694_100005880
758 Ga0070694_100028918
759 Ga0070694_100281144
760 Ga0070708_100149451
761 Ga0070708_100666528
762 Ga0070663_100460643
763 Ga0070663_100599526
764 Ga0070678_100007437
765 Ga0070662_100000059
766 Ga0070662_100040789
767 Ga0070662_100759010
768 Ga0070662_101307351
769 Ga0070681_10094495
770 Ga0070681_10132851
771 Ga0070681_10146195
772 Ga0070681_10231050
773 Ga0070681_10423902
774 Ga0070681_11023906
775 Ga0068867_100000588
776 Ga0070685_10000094
777 Ga0070685_10017142
778 Ga0070685_11046313
779 Ga0070706_100260763
780 Ga0070706_100316884
781 Ga0070707_100739193
782 Ga0070699_100019917
783 Ga0070699_100027789
784 Ga0070699_100655987
785 Ga0070679_100020498
786 Ga0070679_100095966
787 Ga0070679_100135177
788 Ga0070684_100002952
789 Ga0070684_100052961
790 Ga0070684_100059659
791 Ga0070684_100109315
792 Ga0070684_100946582
793 Ga0070697_100024758
794 Ga0070697_102062303
795 Ga0068853_100062679
796 Ga0068853_100248699
797 Ga0070672_100008345
798 Ga0070672_100159976
799 Ga0070686_100000046
800 Ga0070686_100046348
801 Ga0070695_100007518
802 Ga0070695_100009317
803 Ga0070695_100379913
804 Ga0070695_100841435
805 Ga0070696_100000917
806 Ga0070696_100035707
807 Ga0070696_100036878
808 Ga0070696_100038231
809 Ga0070693_100299292
810 Ga0070693_101366725
811 Ga0070665_100021825
812 Ga0070665_100100606
813 Ga0070704_100020279
814 Ga0070704_100060025
815 Ga0070704_100073152
816 Ga0070704_100106480
817 Ga0068855_100020624
818 Ga0068855_100043350
819 Ga0068855_100645251
820 Ga0068855_100967075
821 Ga0068855_101057242
822 Ga0070664_100005553
823 Ga0070664_100050169
824 Ga0070664_100305922
825 Ga0070664_100993632
826 Ga0070664_101245087
827 Ga0068857_100086583
828 Ga0068857_100269178
829 Ga0068857_100295958
830 Ga0068854_100125303
831 Ga0068854_101716327
832 Ga0068856_100198336
833 Ga0068856_100825617
834 Ga0070702_100005612
835 Ga0070702_100017056
836 Ga0070702_101155338
837 Ga0068852_100253256
838 Ga0068852_100414525
839 Ga0068852_100933739
840 Ga0068859_100000268
841 Ga0068859_100471957
842 Ga0068864_100449212
843 Ga0068864_102671982
844 Ga0068866_10079806
845 Ga0068866_10109766
846 Ga0068861_100034006
847 Ga0068861_100197335
848 Ga0068851_10053867
849 Ga0068870_10298274
850 Ga0068858_100099740
851 Ga0068858_100627393
852 Ga0068860_100339757
853 Ga0068862_100018796
854 Ga0081455_10001030
855 Ga0070717_10491242
856 Ga0075432_10000012
857 Ga0070716_100011775
858 Ga0070716_100318415
859 Ga0070712_100262093
860 Ga0070712_101394535
861 Ga0075427_10054600
862 Ga0097621_100002795
863 Ga0097621_100009709
864 Ga0068871_100038656
865 Ga0068871_100048587
866 Ga0068871_102340718
867 Ga0075428_100079031
868 Ga0075430_100022687
869 Ga0075431_100014312
870 Ga0075431_101668635
871 Ga0075433_10005983
872 Ga0075433_10023205
873 Ga0075434_100031609
874 Ga0075434_100169753
875 Ga0075434_100261752
876 Ga0075434_101914319
877 Ga0075434_102237435
878 Ga0075429_100014403
879 Ga0068865_100006114
880 Ga0075436_100027627
881 Ga0075436_100129161
882 Ga0075436_100138627
883 Ga0075436_100576683
884 Ga0097620_100000268
885 Ga0097620_100471959
886 Ga0075435_100018596
887 Ga0075435_100033649
888 Ga0075435_100133798
889 Ga0105240_10016183
890 Ga0105240_10089061
891 Ga0105240_10385036
892 Ga0111539_10068112
893 Ga0105245_10006102
894 Ga0105245_10031089
895 Ga0105245_10059149
896 Ga0105245_10737147
897 Ga0114129_10112329
898 Ga0114129_10720964
899 Ga0105243_10002601
900 Ga0105243_10970713
901 Ga0105241_10003827
902 Ga0105241_10061810
903 Ga0105241_10487960
904 Ga0105242_10000834
905 Ga0105242_10014909
906 Ga0105242_10545310
907 Ga0105242_10647803
908 Ga0105248_10002942
909 Ga0105248_10017325
910 Ga0105248_10154762
911 Ga0105248_10176492
912 Ga0105237_10056285
913 Ga0105237_10855372
914 Ga0105238_10006104
915 Ga0105238_10020927
916 Ga0105238_10037160
917 Ga0105249_10018526
918 Ga0099796_10000043
919 Ga0105239_10052861
920 Ga0105239_10073356
921 Ga0105239_10760606
922 Ga0105246_10001787
923 Ga0157373_10027247
924 Ga0157373_10274745
925 Ga0157371_10026011
926 Ga0157370_10024219
927 Ga0157369_10007564
928 Ga0157369_10052783
929 Ga0157374_10060711
930 Ga0157374_10064613
931 Ga0157378_10027310
932 Ga0157378_10487159
933 Ga0163162_10042113
934 Ga0157372_10014005
935 Ga0157372_10152193
936 Ga0157372_10648946
937 Ga0157372_11938686
938 Ga0157375_10020913
939 Ga0157375_10203053
940 Ga0163163_10374442
941 Ga0157380_10007252
942 Ga0157380_10049597
943 Ga0182008_10224138
944 Ga0157377_10000545
945 Ga0157379_10004634
946 Ga0157379_10778416
947 Ga0157379_11400134
948 Ga0157376_10000178
949 Ga0157376_11384374
950 Ga0182005_1267822
951 Ga0206356_10489059
952 Ga0213872_10002174
953 Ga0213872_10007518
954 Ga0213872_10034775
955 Ga0213872_10066257
956 Ga0213872_10101917
957 Ga0213872_10114380
958 Ga0213872_10221935
959 Ga0213872_10273882
960 Ga0213872_10417193
961 Ga0213871_10050271
962 Ga0213871_10302956
963 Ga0207656_10163162
964 Ga0207653_10082265
965 Ga0207682_10179702
966 Ga0207642_10063933
967 Ga0207642_10192370
968 Ga0207688_10002146
969 Ga0207680_10039913
970 Ga0207647_10114744
971 Ga0207699_10123276
972 Ga0207645_10000009
973 Ga0207645_10599281
974 Ga0207643_10010334
975 Ga0207684_10448191
976 Ga0207654_10024500
977 Ga0207654_10051850
978 Ga0207654_10074323
979 Ga0207707_10066441
980 Ga0207707_10127174
981 Ga0207707_10648491
982 Ga0207707_11431167
983 Ga0207695_10013524
984 Ga0207695_10154075
985 Ga0207695_10932850
986 Ga0207693_10022544
987 Ga0207693_10307887
988 Ga0207663_10036613
989 Ga0207663_10193157
990 Ga0207663_10280719
991 Ga0207660_10002893
992 Ga0207660_10309890
993 Ga0207660_10314181
994 Ga0207662_10000618
995 Ga0207662_10018316
996 Ga0207662_10152298
997 Ga0207657_10001604
998 Ga0207657_10012182
999 Ga0207657_11315206
1000 Ga0207649_10012112
1001 Ga0207649_10149932
1002 Ga0207649_10209977
1003 Ga0207649_10492187
1004 Ga0207652_10033557
1005 Ga0207652_10402045
1006 Ga0207652_10422484
1007 Ga0207652_10958180
1008 Ga0207646_10444286
1009 Ga0207646_11068316
1010 Ga0207681_10051921
1011 Ga0207681_11736561
1012 Ga0207694_10017482
1013 Ga0207694_10250504
1014 Ga0207694_10747832
1015 Ga0207650_10014984
1016 Ga0207659_10004061
1017 Ga0207659_10198989
1018 Ga0207659_10303680
1019 Ga0207687_10018476
1020 Ga0207687_11160672
1021 Ga0207700_10026363
1022 Ga0207700_10121078
1023 Ga0207700_10586415
1024 Ga0207664_10010829
1025 Ga0207664_10214206
1026 Ga0207644_10118383
1027 Ga0207644_10197018
1028 Ga0207644_10733059
1029 Ga0207690_10001782
1030 Ga0207690_10075392
1031 Ga0207690_10140797
1032 Ga0207690_10560372
1033 Ga0207706_10000134
1034 Ga0207706_10617539
1035 Ga0207686_10006696
1036 Ga0207686_10168399
1037 Ga0207686_11183527
1038 Ga0207709_10013612
1039 Ga0207670_10000042
1040 Ga0207670_10032612
1041 Ga0207670_10048808
1042 Ga0207670_10285532
1043 Ga0207669_10004535
1044 Ga0207704_10002290
1045 Ga0207704_10061399
1046 Ga0207704_10139575
1047 Ga0207665_10008655
1048 Ga0207691_10000066
1049 Ga0207691_10149662
1050 Ga0207711_10007640
1051 Ga0207711_10009885
1052 Ga0207689_10006708
1053 Ga0207689_10576995
1054 Ga0207689_11136995
1055 Ga0207661_10086402
1056 Ga0207661_10158378
1057 Ga0207661_10377832
1058 Ga0207679_10000771
1059 Ga0207679_10064066
1060 Ga0207679_11210137
1061 Ga0207679_11414854
1062 Ga0207667_10010777
1063 Ga0207667_10728333
1064 Ga0207651_10003923
1065 Ga0207651_10279715
1066 Ga0207651_10839447
1067 Ga0207651_11460001
1068 Ga0207651_11751068
1069 Ga0207712_10110621
1070 Ga0207668_10040247
1071 Ga0207640_11135589
1072 Ga0207640_11137138
1073 Ga0207658_10003514
1074 Ga0207658_10573597
1075 Ga0207677_10004218
1076 Ga0207677_10687238
1077 Ga0207703_10080616
1078 Ga0207639_10117641
1079 Ga0207639_10126648
1080 Ga0207639_10332577
1081 Ga0207678_10028054
1082 Ga0207678_10320008
1083 Ga0207708_10000084
1084 Ga0207708_10000336
1085 Ga0207702_10022671
1086 Ga0207702_10188506
1087 Ga0207702_11065505
1088 Ga0207702_12397158
1089 Ga0207641_11650095
1090 Ga0207648_10000049
1091 Ga0207648_10030199
1092 Ga0207676_10412097
1093 Ga0207674_10014015
1094 Ga0207675_100210564
1095 Ga0207675_100419164
1096 Ga0207675_100855443
1097 Ga0207683_10000023
1098 Ga0207683_11055134
1099 Ga0207698_10020098
1100 Ga0207698_10151001
1101 Ga0207698_10593427
1102 Ga0209973_1000088
1103 Ga0209969_1000233
1104 Ga0209967_1000068
1105 Ga0209981_1000063
1106 Ga0209996_1000107
1107 Ga0209984_1000209
1108 Ga0209984_1041287
1109 Ga0210000_1000014
1110 Ga0209995_1000076
1111 Ga0209995_1041783
1112 Ga0209179_1000020
1113 Ga0209968_1000036
1114 Ga0209999_1001543
1115 Ga0209999_1046823
1116 Ga0209982_1003317
1117 Ga0209970_1000140
1118 Ga0210002_1000004
1119 Ga0209983_1000028
1120 Ga0209971_1000305
1121 Ga0209966_1000028
1122 Ga0209998_10000030
1123 Ga0209974_10001002
1124 Ga0207428_10005241
1125 Ga0207428_10165615
1126 Ga0268266_10088421
1127 Ga0268266_10141039
1128 Ga0268265_10027712
1129 Ga0268264_10261112
1130 Ga0268264_10720630
1131 Ga0265337_1001920
1132 Ga0265334_10005761
1133 Ga0265338_10187929
1134 Ga0265316_10442065
1135 Ga0307408_100845054
1136 Ga0265314_10221144
1137 Ga0307516_10121899
1138 Ga0307405_10327819
1139 Ga0307406_10539134
1140 Ga0307416_100175287
1141 Ga0307416_100327373
1142 Ga0373930_0215720
1143 Ga0373948_0057297
1144 Ga0373938_0130521
1145 Ga0373938_0213068
1146 Ga0373940_0148668
1147 Ga0373949_0296159
1148 Ga0373923_0119029
1149 Ga0373939_0046143
1150 Ga0373956_0032507
1151 Ga0373956_0516799
1152 Ga0373943_0021509
1153 Ga0373946_0054513
1154 Ga0373946_0126274
1155 Ga0373955_0112395
1156 Ga0373955_0683857
1157 Ga0373942_0040627
1158 Ga0373961_0156908
1159 Ga0373961_0232285
1160 Ga0373924_0163370
1161 Ga0373924_0225127
1162 Ga0373931_0168604
1163 Ga0373931_0448341
1164 Ga0373931_0601990
1165 Ga0373935_0081134
1166 Ga0373935_1205797
1167 Ga0373927_0053153
1168 Ga0373927_0423567
1169 Ga0373927_0470186
1170 Ga0373933_0036577
1171 Ga0373933_0130336
1172 Ga0373933_0384547
1173 Ga0373933_0592158
1174 Ga0373947_0014684
1175 Ga0373937_0004534
1176 Ga0373937_0037041
1177 Ga0373937_0315849
1178 Ga0373937_0482503
1179 Ga0373925_0012346
1180 Ga0373925_0051879
1181 Ga0373925_0779665
1182 Ga0436360_0386988
1183 Ga0436360_1126290
1184 Ga0436361_0076840
1185 Ga0436361_0126174
1186 Ga0436361_0142262
1187 Ga0436361_0172980
1188 Ga0436361_0200442
1189 Ga0436361_0247078
1190 Ga0436361_0260598
1191 Ga0436361_0375279
1192 Ga0436361_0438170
1193 Ga0436361_0456495
1194 Ga0436361_0525411
1195 Ga0436361_0778576
1196 Ga0436361_0946955
1197 Ga0436361_1004128
1198 Ga0436361_1041964
1199 Ga0436361_1097180
1200 Ga0436361_1193359
1201 Ga0450914_053332
1202 Ga0439460_0078475
1203 Ga0439460_0228500
1204 Ga0451577_0393994
1205 Ga0451577_1907246
1206 Ga0453683_0000391
1207 Ga0466966_0050993
1208 Ga0453684_0152593
1209 Ga0466957_0011079
1210 Ga0466959_0758659
1211 Ga0451576_0004548
1212 Ga0451576_0076791
1213 Ga0451576_0078658
1214 Ga0451576_0088286
1215 Ga0451576_1043386
1216 Ga0466958_0000247
1217 Ga0495630_0146465
1218 Ga0495642_0360900
1219 Ga0495665_0516743
1220 Ga0495587_0139371
1221 Ga0495645_0189474
1222 Ga0495667_0473934
1223 Ga0495625_0177022
1224 Ga0495635_0973033
1225 Ga0495623_0488116
1226 Ga0495669_0000115
1227 Ga0495674_0920283
1228 Ga0495677_0072187
1229 Ga0495684_0073111
1230 Ga0496102_0102450
1231 Ga0496106_0045103
1232 Ga0496106_0583677
1233 Ga0496107_0217790
1234 Ga0496112_0361098
1235 Ga0501299_018721
1236 Ga0501040_0912038
1237 Ga0501042_0771336
1238 Ga0501068_0559025
1239 Ga0501071_0556436
1240 Ga0501075_1313687
1241 Ga0501079_0295596
1242 Ga0501079_1562676
1243 Ga0501080_1787456
1244 Ga0501083_0796860
1245 Ga0501044_1599053
1246 nmdc:mga05p37_277608_c1
1247 nmdc:mga09592_293072_c1
1248 nmdc:mga0qj67_16449_c1
1249 nmdc:mga06r32_2000884_c1
1250 nmdc:mga06r32_38999_c1
1251 nmdc:mga08y16_30446_c1
1252 nmdc:mga08y16_392423_c1
1253 nmdc:mga0n895_10601_c1
1254 nmdc:mga0n895_241429_c1
1255 nmdc:mga0n895_379957_c1
1256 nmdc:mga0n895_91027_c1
1257 nmdc:mga0n895_977160_c1
1258 nmdc:mga0rr50_111647_c1
1259 nmdc:mga0rr50_4677_c1
1260 nmdc:mga0rr50_632058_c1
1261 nmdc:mga0rr50_7108_c1
1262 nmdc:mga08x19_159711_c1
1263 nmdc:mga08x19_257732_c1
1264 nmdc:mga08x19_459077_c1
1265 nmdc:mga08x19_500088_c1
1266 nmdc:mga0a205_138830_c1
1267 nmdc:mga0a205_34495_c1
1268 Ga0495612_0040279
1269 Ga0495612_0101182
1270 Ga0495595_0403260
1271 Ga0501084_0483000
1272 Ga0590071_011424
1273 Ga0590075_019380
1274 Ga0590077_017449
1275 Ga0501082_1485817
1276 Ga0466962_0123653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

24

107

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.9504 2 83
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.9381 2 86
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.9172 2 86
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.8975 2 83
1v8c-assembly3.cif.gz_B crystal structure of moad related protein from thermus thermophilus hb8 0.8373 1 81
ID Description Score Start End Superfamily
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9381 2 86 3.10.20.30
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9172 2 86 3.10.20.30
af_Q8NDA2_2354_2446_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8862 54 64 2.60.40.10
af_A0A0B4KGP4_291_416_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8421 55 66 2.60.40.10
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8373 1 81 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A7V4PRG0-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9988 1 53
AF-A0A6B3IN31-F1-model_v4 MoaD/ThiS family protein 0.989 2 83
AF-A0A849RPZ2-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9839 1 53
AF-A0A6V8PC81-F1-model_v4 Sulfur-carrier protein 0.982 1 53
AF-A0A3N5KSZ2-F1-model_v4 MoaD/ThiS family protein 0.9816 1 86

Map