F471515
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 638 | 487 | 377 | 391 |
Family's Representative Sequence
| Representative Sequence | 3300025261|Ga0209233_1000360|Ga0209233_100036028 |
| Length | 436 |
| Sequence | MIIDASINFDHRDGRVLPRRWEGIVVELFGRSYSRREIEERTGALAQFAGVRLTTLGDGLERGIRMLEFRTGSGLRFTVLIDRAMDIADCEYKGLAIGWNSPAGFRHPSLHEYEGEGGLAWARSFSGLLVTCGLDHILFMNDVPAENYVYSPKRSVSHSLHGRVGTIPARLTGYGERWEGDRCFLWAEGVVQQAAVFGEDLHLVRRIEAEVGSSEIRLTDRVVNHGFYKTPHMLCYHINVGHPVLDAGSRYLAPIEDVVWAAHASESERPAWLDNDVVWADGTHDSYHRQHVGYRTLSGPHLGFHEQVWQHELAADENDEVPVALVNDRLGLGFEVTTRKSQFPCQYEWQNLQAGQYALGIEPSTNHVLGNLAARERGEMIWLLHGEERRYDTVFRVLDGSCAIEIAEERIRGIANQPPEDFPVPSNNHRRIEGRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 5 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 6 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 7 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 8 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 9 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 10 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 11 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 12 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 13 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 14 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 15 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 16 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 17 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 18 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 19 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 20 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 21 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 22 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 23 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 24 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 25 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 26 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 27 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 28 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 29 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 30 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 31 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 32 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 33 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 34 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 35 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 36 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 37 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 38 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 39 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 40 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 41 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 42 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 43 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 44 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 45 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 46 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 47 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 48 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 49 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 50 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 51 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 52 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 53 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 54 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 55 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 56 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 57 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 58 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 59 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 60 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 61 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 62 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 63 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 64 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 65 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 66 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 67 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 68 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 69 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 70 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 71 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 72 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 73 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 74 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 75 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 76 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 77 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 78 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 79 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 80 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 81 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 82 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 83 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 84 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 85 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 86 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 87 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 88 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 89 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 90 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 91 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 92 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 93 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 94 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 95 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 96 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 97 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 98 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 99 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 100 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 101 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 102 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 103 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 104 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 105 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 106 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 107 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 108 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 109 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 110 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 111 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 112 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 113 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 114 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 115 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 116 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 117 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 118 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 119 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 120 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 121 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 122 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 123 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 124 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 125 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 126 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 127 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 128 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 129 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 130 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 131 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 132 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 133 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 134 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 135 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 136 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 137 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 138 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 139 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 140 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 141 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 142 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 143 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 144 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 145 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 146 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 147 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 148 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 149 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 150 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 151 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 152 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 153 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 154 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 155 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 156 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 157 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 158 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 159 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 160 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 161 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 162 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 163 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 164 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 165 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 166 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 167 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 168 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 169 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 170 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 171 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 172 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 173 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 174 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 175 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 176 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 177 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 178 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 179 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 180 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 181 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 182 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 183 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 184 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 185 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 186 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 187 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 188 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 189 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 190 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 191 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 192 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 193 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 194 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 195 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 196 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 197 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 198 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 199 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 200 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 201 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 202 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 203 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 204 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 205 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 206 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 207 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 208 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 209 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 210 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 211 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 212 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 213 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 214 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 215 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 216 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 217 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 218 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 219 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 220 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 221 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 222 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 223 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 224 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 225 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 226 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 227 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 228 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 229 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 230 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 231 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 232 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 233 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 234 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 235 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 236 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 237 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 238 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 239 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 240 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 241 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 242 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 243 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 244 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 245 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 246 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 247 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 248 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 249 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 250 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 251 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 252 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 253 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 254 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 255 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 256 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 257 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 258 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 259 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 260 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 261 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 262 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 263 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 264 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 265 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 266 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 267 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 268 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 269 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 270 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 271 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 272 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 273 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 274 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 275 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 276 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 277 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 278 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 279 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 280 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 281 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 282 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 283 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 284 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 285 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 286 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 287 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 288 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 289 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 290 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 291 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 292 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 293 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 294 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 297 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 298 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 299 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 300 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 301 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 302 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 303 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 304 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 305 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 306 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 307 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 308 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 309 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 310 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 311 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 312 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 313 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 314 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 315 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 316 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 317 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 318 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 319 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 320 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 321 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 322 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 341 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 343 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 344 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 348 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 349 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 350 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 351 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 352 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 353 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 354 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 355 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 356 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 357 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 358 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 359 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 360 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 361 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 362 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 363 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 364 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 365 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 366 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 367 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 368 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 369 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 370 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 371 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 372 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 373 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 374 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 375 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 376 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 377 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 378 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 379 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 380 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 409 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 410 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 411 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 412 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 413 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 414 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 415 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 416 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 417 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 418 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 419 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 420 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 448 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 449 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 450 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 451 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 454 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 455 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 456 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 457 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 458 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 459 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 460 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 461 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 462 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 463 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 464 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 465 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 466 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 467 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 468 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 469 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 470 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 472 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 473 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 474 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 475 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 476 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 477 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 478 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 479 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 480 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 481 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 482 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 483 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 484 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 485 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 486 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 487 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 59.09 |
| Metatranscriptomes | 0 |
| Isolates | 40.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.2 |
| Nodule | 32.76 |
| Rhizoplane | 0.94 |
| Rhizosphere | 37.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10021190 | 3300001979 | Bacteria | 2257 |
| 2 | JGI24740J21852_10029387 | 3300001979 | Bacteria | 1805 |
| 3 | JGI25152J39213_1000133 | 3300002773 | Bacteria | 50447 |
| 4 | JGI25150J39212_1000097 | 3300002774 | Bacteria | 50447 |
| 5 | JGI25159J45721_1000158 | 3300002987 | Bacteria | 31947 |
| 6 | JGI25151J46595_10000334 | 3300003187 | Bacteria | 50447 |
| 7 | JGI25151J46595_10002569 | 3300003187 | Bacteria | 10754 |
| 8 | JGI25165J46597_1000015 | 3300003214 | Bacteria | 380891 |
| 9 | JGI25153J46596_10000583 | 3300003215 | Bacteria | 22446 |
| 10 | JGI25153J46596_10028517 | 3300003215 | Bacteria | 1933 |
| 11 | rootH1_10131482 | 3300003316 | Bacteria | 2308 |
| 12 | rootL2_10079358 | 3300003322 | Bacteria | 2704 |
| 13 | rootL2_10283227 | 3300003322 | Bacteria | 1897 |
| 14 | JGI25160J50197_1000026 | 3300003354 | Bacteria | 184693 |
| 15 | JGI25161J50226_1000014 | 3300003374 | Bacteria | 191109 |
| 16 | Ga0055542_1000088 | 3300003762 | Bacteria | 123491 |
| 17 | Ga0055529_1000034 | 3300003763 | Bacteria | 244657 |
| 18 | Ga0055536_1000224 | 3300003781 | Bacteria | 45927 |
| 19 | Ga0055536_1000722 | 3300003781 | Bacteria | 22138 |
| 20 | Ga0055530_10001038 | 3300003791 | Bacteria | 22140 |
| 21 | Ga0055530_10009730 | 3300003791 | Bacteria | 3647 |
| 22 | Ga0055530_10017859 | 3300003791 | Bacteria | 2207 |
| 23 | Ga0055531_10000610 | 3300003794 | Bacteria | 30977 |
| 24 | Ga0055531_10001285 | 3300003794 | Bacteria | 18916 |
| 25 | Ga0055531_10001590 | 3300003794 | Bacteria | 16552 |
| 26 | Ga0055543_1000079 | 3300004625 | Bacteria | 84916 |
| 27 | Ga0065165_1000073 | 3300005262 | Bacteria | 164910 |
| 28 | Ga0070658_10002931 | 3300005327 | Bacteria | 14146 |
| 29 | Ga0070658_10187265 | 3300005327 | Bacteria | 1744 |
| 30 | Ga0070676_10029649 | 3300005328 | Bacteria | 3113 |
| 31 | Ga0070660_100034900 | 3300005339 | Bacteria | 3803 |
| 32 | Ga0070668_100009387 | 3300005347 | Bacteria | 7257 |
| 33 | Ga0070673_100039497 | 3300005364 | Bacteria | 3612 |
| 34 | Ga0070659_100031467 | 3300005366 | Bacteria | 4110 |
| 35 | Ga0070667_100076354 | 3300005367 | Bacteria | 2861 |
| 36 | Ga0068867_100182065 | 3300005459 | Bacteria | 1671 |
| 37 | Ga0070679_100177105 | 3300005530 | Bacteria | 2105 |
| 38 | Ga0068853_100001116 | 3300005539 | Bacteria | 18998 |
| 39 | Ga0068853_100019005 | 3300005539 | Bacteria | 5693 |
| 40 | Ga0068853_100054689 | 3300005539 | Bacteria | 3441 |
| 41 | Ga0068853_100120794 | 3300005539 | Bacteria | 2337 |
| 42 | Ga0070686_100129796 | 3300005544 | Bacteria | 1741 |
| 43 | Ga0070696_100152024 | 3300005546 | Bacteria | 1700 |
| 44 | Ga0070665_100005166 | 3300005548 | Bacteria | 13509 |
| 45 | Ga0070665_100050304 | 3300005548 | Bacteria | 4181 |
| 46 | Ga0070665_100252599 | 3300005548 | Bacteria | 1764 |
| 47 | Ga0070665_100263813 | 3300005548 | Bacteria | 1724 |
| 48 | Ga0068855_100177547 | 3300005563 | Bacteria | 2409 |
| 49 | Ga0068857_100055786 | 3300005577 | Bacteria | 3506 |
| 50 | Ga0068856_100056091 | 3300005614 | Bacteria | 3888 |
| 51 | Ga0068852_100012893 | 3300005616 | Bacteria | 6372 |
| 52 | Ga0068863_100003967 | 3300005841 | Bacteria | 14616 |
| 53 | Ga0068860_100000536 | 3300005843 | Bacteria | 46390 |
| 54 | Ga0081540_1044057 | 3300005983 | Bacteria | 2281 |
| 55 | Ga0081539_10014851 | 3300005985 | Bacteria | 5719 |
| 56 | Ga0075365_10009599 | 3300006038 | Bacteria | 5578 |
| 57 | Ga0075365_10045943 | 3300006038 | Bacteria | 2867 |
| 58 | Ga0075365_10050738 | 3300006038 | Bacteria | 2738 |
| 59 | Ga0075365_10068347 | 3300006038 | Bacteria | 2387 |
| 60 | Ga0075364_10015730 | 3300006051 | Bacteria | 4696 |
| 61 | Ga0075362_10000827 | 3300006177 | Bacteria | 9277 |
| 62 | Ga0075362_10083742 | 3300006177 | Bacteria | 1473 |
| 63 | Ga0075367_10029837 | 3300006178 | Bacteria | 3123 |
| 64 | Ga0075369_10014686 | 3300006186 | Bacteria | 3133 |
| 65 | Ga0075370_10078247 | 3300006353 | Bacteria | 1898 |
| 66 | Ga0075370_10125501 | 3300006353 | Bacteria | 1496 |
| 67 | Ga0075370_10136056 | 3300006353 | Bacteria | 1435 |
| 68 | Ga0075431_100120013 | 3300006847 | Bacteria | 2713 |
| 69 | Ga0075433_10243613 | 3300006852 | Bacteria | 1596 |
| 70 | Ga0079104_1003039 | 3300006946 | Bacteria | 8217 |
| 71 | Ga0105240_10030016 | 3300009093 | Bacteria | 7073 |
| 72 | Ga0105240_10298350 | 3300009093 | Bacteria | 1844 |
| 73 | Ga0105240_10505318 | 3300009093 | Bacteria | 1343 |
| 74 | Ga0111539_10003929 | 3300009094 | Bacteria | 19536 |
| 75 | Ga0114129_10436623 | 3300009147 | Bacteria | 1719 |
| 76 | Ga0105243_10199012 | 3300009148 | Bacteria | 1756 |
| 77 | Ga0105237_10018220 | 3300009545 | Bacteria | 7265 |
| 78 | Ga0105237_10090603 | 3300009545 | Bacteria | 3047 |
| 79 | Ga0105237_10102563 | 3300009545 | Bacteria | 2853 |
| 80 | Ga0105237_10134938 | 3300009545 | Bacteria | 2463 |
| 81 | Ga0105238_10057544 | 3300009551 | Bacteria | 3898 |
| 82 | Ga0105238_10060557 | 3300009551 | Unclassified | 3790 |
| 83 | Ga0105238_10106048 | 3300009551 | Bacteria | 2792 |
| 84 | Ga0105249_10024598 | 3300009553 | Bacteria | 5413 |
| 85 | Ga0105249_10505640 | 3300009553 | Bacteria | 1254 |
| 86 | Ga0105239_10032071 | 3300010375 | Bacteria | 5773 |
| 87 | Ga0105239_10066557 | 3300010375 | Bacteria | 3958 |
| 88 | Ga0105239_10168146 | 3300010375 | Bacteria | 2452 |
| 89 | Ga0105239_10169798 | 3300010375 | Bacteria | 2439 |
| 90 | Ga0105239_10262379 | 3300010375 | Bacteria | 1942 |
| 91 | Ga0105239_10268061 | 3300010375 | Bacteria | 1920 |
| 92 | Ga0157373_10016893 | 3300013100 | Bacteria | 5321 |
| 93 | Ga0157370_10310244 | 3300013104 | Bacteria | 1456 |
| 94 | Ga0157370_10342278 | 3300013104 | Bacteria | 1378 |
| 95 | Ga0157369_10069256 | 3300013105 | Bacteria | 3791 |
| 96 | Ga0182008_10022730 | 3300014497 | Bacteria | 3210 |
| 97 | Ga0183365_10003 | 3300015684 | Bacteria | 414944 |
| 98 | Ga0213875_10037067 | 3300021388 | Bacteria | 2298 |
| 99 | Ga0228711_1005574 | 3300022739 | Bacteria | 19128 |
| 100 | Ga0228710_1006649 | 3300022740 | Bacteria | 17425 |
| 101 | Ga0207425_1000186 | 3300025245 | Bacteria | 50590 |
| 102 | Ga0209148_1000093 | 3300025254 | Bacteria | 245339 |
| 103 | Ga0209148_1000233 | 3300025254 | Bacteria | 90861 |
| 104 | Ga0209129_1000165 | 3300025258 | Bacteria | 98917 |
| 105 | Ga0209233_1000010 | 3300025261 | Bacteria | 1194329 |
| 106 | Ga0209233_1000360 | 3300025261 | Bacteria | 41483 |
| 107 | Ga0209455_1000045 | 3300025272 | Bacteria | 383329 |
| 108 | Ga0209455_1000062 | 3300025272 | Bacteria | 335169 |
| 109 | Ga0209130_1000219 | 3300025284 | Bacteria | 74906 |
| 110 | Ga0209130_1023663 | 3300025284 | Bacteria | 1351 |
| 111 | Ga0209676_1000087 | 3300025292 | Bacteria | 263734 |
| 112 | Ga0209676_1000136 | 3300025292 | Bacteria | 181860 |
| 113 | Ga0209025_1000079 | 3300025294 | Bacteria | 270973 |
| 114 | Ga0209025_1000362 | 3300025294 | Bacteria | 96826 |
| 115 | Ga0209758_1000571 | 3300025297 | Bacteria | 57774 |
| 116 | Ga0209758_1000685 | 3300025297 | Bacteria | 50499 |
| 117 | Ga0209758_1031423 | 3300025297 | Bacteria | 2178 |
| 118 | Ga0209050_1000083 | 3300025298 | Bacteria | 263734 |
| 119 | Ga0209050_1000238 | 3300025298 | Bacteria | 119729 |
| 120 | Ga0209050_1002036 | 3300025298 | Bacteria | 18705 |
| 121 | Ga0209050_1026621 | 3300025298 | Bacteria | 1929 |
| 122 | Ga0207426_1000075 | 3300025302 | Bacteria | 321337 |
| 123 | Ga0209051_1001350 | 3300025303 | Bacteria | 21289 |
| 124 | Ga0209257_1000142 | 3300025304 | Bacteria | 200756 |
| 125 | Ga0209257_1002211 | 3300025304 | Bacteria | 20060 |
| 126 | Ga0209257_1002452 | 3300025304 | Bacteria | 18413 |
| 127 | Ga0209257_1004870 | 3300025304 | Bacteria | 9916 |
| 128 | Ga0207647_10009585 | 3300025904 | Bacteria | 6874 |
| 129 | Ga0207645_10010175 | 3300025907 | Bacteria | 6465 |
| 130 | Ga0207695_10015090 | 3300025913 | Bacteria | 9113 |
| 131 | Ga0207695_10021793 | 3300025913 | Bacteria | 7299 |
| 132 | Ga0207695_10102617 | 3300025913 | Bacteria | 2853 |
| 133 | Ga0207695_10171049 | 3300025913 | Bacteria | 2098 |
| 134 | Ga0207695_10223822 | 3300025913 | Bacteria | 1788 |
| 135 | Ga0207695_10329681 | 3300025913 | Bacteria | 1415 |
| 136 | Ga0207671_10138726 | 3300025914 | Bacteria | 1872 |
| 137 | Ga0207671_10164099 | 3300025914 | Bacteria | 1721 |
| 138 | Ga0207657_10014102 | 3300025919 | Bacteria | 7820 |
| 139 | Ga0207657_10021558 | 3300025919 | Bacteria | 6059 |
| 140 | Ga0207657_10064189 | 3300025919 | Bacteria | 3135 |
| 141 | Ga0207657_10093082 | 3300025919 | Bacteria | 2511 |
| 142 | Ga0207694_10040103 | 3300025924 | Bacteria | 3604 |
| 143 | Ga0207694_10283204 | 3300025924 | Bacteria | 1362 |
| 144 | Ga0207690_10096719 | 3300025932 | Bacteria | 2100 |
| 145 | Ga0207690_10135660 | 3300025932 | Bacteria | 1806 |
| 146 | Ga0207706_10106672 | 3300025933 | Bacteria | 2465 |
| 147 | Ga0207669_10037798 | 3300025937 | Bacteria | 2774 |
| 148 | Ga0207669_10038725 | 3300025937 | Bacteria | 2748 |
| 149 | Ga0207667_10002994 | 3300025949 | Bacteria | 20985 |
| 150 | Ga0207667_10410682 | 3300025949 | Bacteria | 1378 |
| 151 | Ga0207651_10050045 | 3300025960 | Bacteria | 2835 |
| 152 | Ga0207712_10024320 | 3300025961 | Bacteria | 4009 |
| 153 | Ga0207658_10043261 | 3300025986 | Bacteria | 3273 |
| 154 | Ga0207639_10000275 | 3300026041 | Bacteria | 36969 |
| 155 | Ga0207639_10060218 | 3300026041 | Bacteria | 2929 |
| 156 | Ga0207639_10092331 | 3300026041 | Bacteria | 2426 |
| 157 | Ga0207639_10123185 | 3300026041 | Bacteria | 2134 |
| 158 | Ga0207702_10268897 | 3300026078 | Bacteria | 1607 |
| 159 | Ga0207641_10000785 | 3300026088 | Bacteria | 33910 |
| 160 | Ga0207648_10148350 | 3300026089 | Bacteria | 2069 |
| 161 | Ga0207674_10019756 | 3300026116 | Bacteria | 7291 |
| 162 | Ga0207674_10056185 | 3300026116 | Bacteria | 3998 |
| 163 | Ga0209281_1001012 | 3300027111 | Bacteria | 21997 |
| 164 | Ga0209281_1001545 | 3300027111 | Bacteria | 12743 |
| 165 | Ga0209371_1010501 | 3300027312 | Bacteria | 2840 |
| 166 | Ga0209282_1000296 | 3300027666 | Bacteria | 24574 |
| 167 | Ga0207428_10000133 | 3300027907 | Bacteria | 100902 |
| 168 | Ga0268266_10002386 | 3300028379 | Bacteria | 20296 |
| 169 | Ga0268266_10199804 | 3300028379 | Bacteria | 1829 |
| 170 | Ga0268266_10308253 | 3300028379 | Bacteria | 1479 |
| 171 | Ga0268265_10029014 | 3300028380 | Bacteria | 3967 |
| 172 | Ga0268264_10000521 | 3300028381 | Bacteria | 48744 |
| 173 | Ga0307515_10001908 | 3300028794 | Bacteria | 46296 |
| 174 | Ga0307515_10211048 | 3300028794 | Bacteria | 1786 |
| 175 | Ga0268256_1012697 | 3300030500 | Bacteria | 2590 |
| 176 | Ga0307513_10128843 | 3300031456 | Bacteria | 2480 |
| 177 | Ga0307509_10000038 | 3300031507 | Bacteria | 188458 |
| 178 | Ga0307508_10000005 | 3300031616 | Bacteria | 286511 |
| 179 | Ga0307406_10066733 | 3300031901 | Bacteria | 2343 |
| 180 | Ga0307412_10000118 | 3300031911 | Bacteria | 60701 |
| 181 | Ga0307412_10025426 | 3300031911 | Bacteria | 3668 |
| 182 | Ga0315914_1001884 | 3300031967 | Bacteria | 31965 |
| 183 | Ga0307414_10157101 | 3300032004 | Bacteria | 1802 |
| 184 | Ga0307510_10000008 | 3300033180 | Bacteria | 433990 |
| 185 | Ga0307510_10090583 | 3300033180 | Bacteria | 2904 |
| 186 | Ga0315913_1000879 | 3300033430 | Bacteria | 30055 |
| 187 | Ga0315915_1000436 | 3300033464 | Bacteria | 42125 |
| 188 | Ga0373936_0000983 | 3300035113 | Bacteria | 10166 |
| 189 | Ga0373931_0033614 | 3300035691 | Bacteria | 2659 |
| 190 | Ga0395900_0367844 | 3300037418 | Bacteria | 1408 |
| 191 | Ga0395898_0334961 | 3300037466 | Bacteria | 1443 |
| 192 | Ga0395905_0001090 | 3300037471 | Bacteria | 34130 |
| 193 | Ga0395905_0004612 | 3300037471 | Bacteria | 14261 |
| 194 | Ga0436364_0091943 | 3300037853 | Unclassified | 3521 |
| 195 | Ga0436364_0168878 | 3300037853 | Bacteria | 3152 |
| 196 | Ga0436364_0773657 | 3300037853 | Bacteria | 23513 |
| 197 | Ga0395901_0086481 | 3300038443 | Bacteria | 3278 |
| 198 | Ga0436365_0099515 | 3300039437 | Bacteria | 4266 |
| 199 | Ga0436365_0178914 | 3300039437 | Bacteria | 2569 |
| 200 | Ga0436365_1579648 | 3300039437 | Bacteria | 4724 |
| 201 | Ga0436360_0635651 | 3300039438 | Bacteria | 1626 |
| 202 | Ga0436360_1340661 | 3300039438 | Bacteria | 5975 |
| 203 | Ga0436361_0055035 | 3300039447 | Bacteria | 1511 |
| 204 | Ga0436361_0395993 | 3300039447 | Unclassified | 2174 |
| 205 | Ga0436363_1040280 | 3300039450 | Bacteria | 5278 |
| 206 | Ga0436363_1282319 | 3300039450 | Bacteria | 13443 |
| 207 | Ga0436362_0831552 | 3300039453 | Bacteria | 2344 |
| 208 | Ga0439439_0006481 | 3300041406 | Bacteria | 2708 |
| 209 | Ga0439465_0015086 | 3300041413 | Bacteria | 2411 |
| 210 | Ga0439445_0013580 | 3300042004 | Bacteria | 1972 |
| 211 | Ga0439449_0038179 | 3300042007 | Bacteria | 1786 |
| 212 | Ga0439449_0074899 | 3300042007 | Bacteria | 1247 |
| 213 | Ga0439462_0011741 | 3300042015 | Bacteria | 2234 |
| 214 | Ga0439440_0031792 | 3300042993 | Bacteria | 1250 |
| 215 | Ga0466966_0036760 | 3300044684 | Bacteria | 3161 |
| 216 | Ga0466959_0018824 | 3300045049 | Bacteria | 5073 |
| 217 | Ga0451576_0016714 | 3300045051 | Bacteria | 8092 |
| 218 | Ga0495627_001789 | 3300046453 | Bacteria | 11489 |
| 219 | Ga0495638_0003619 | 3300046460 | Bacteria | 12076 |
| 220 | Ga0495638_0014437 | 3300046460 | Bacteria | 5337 |
| 221 | Ga0495638_0023603 | 3300046460 | Bacteria | 4020 |
| 222 | Ga0495650_0000091 | 3300046471 | Bacteria | 228697 |
| 223 | Ga0495650_0000877 | 3300046471 | Bacteria | 35686 |
| 224 | Ga0495585_0084659 | 3300046492 | Bacteria | 1715 |
| 225 | Ga0495596_0000084 | 3300046500 | Bacteria | 65040 |
| 226 | Ga0495596_0001192 | 3300046500 | Bacteria | 15197 |
| 227 | Ga0495607_0029049 | 3300046501 | Bacteria | 3406 |
| 228 | Ga0495583_0000364 | 3300046506 | Bacteria | 70975 |
| 229 | Ga0495583_0069486 | 3300046506 | Bacteria | 1551 |
| 230 | Ga0495610_0000019 | 3300046512 | Bacteria | 351524 |
| 231 | Ga0495610_0003229 | 3300046512 | Bacteria | 12890 |
| 232 | Ga0495610_0015471 | 3300046512 | Bacteria | 4431 |
| 233 | Ga0495610_0020194 | 3300046512 | Bacteria | 3705 |
| 234 | Ga0495616_0000674 | 3300046513 | Bacteria | 25275 |
| 235 | Ga0495620_0036378 | 3300046515 | Bacteria | 2203 |
| 236 | Ga0495632_0000001 | 3300046519 | Bacteria | 873295 |
| 237 | Ga0495632_0000844 | 3300046519 | Bacteria | 27026 |
| 238 | Ga0495632_0001919 | 3300046519 | Bacteria | 16618 |
| 239 | Ga0495632_0028806 | 3300046519 | Bacteria | 2897 |
| 240 | Ga0495637_0000183 | 3300046520 | Bacteria | 48717 |
| 241 | Ga0495637_0033281 | 3300046520 | Bacteria | 2265 |
| 242 | Ga0495643_0000006 | 3300046522 | Bacteria | 419524 |
| 243 | Ga0495643_0008714 | 3300046522 | Bacteria | 6398 |
| 244 | Ga0495643_0014491 | 3300046522 | Bacteria | 4689 |
| 245 | Ga0495648_0000075 | 3300046524 | Bacteria | 129579 |
| 246 | Ga0495648_0074928 | 3300046524 | Bacteria | 1948 |
| 247 | Ga0495663_0000001 | 3300046525 | Bacteria | 595264 |
| 248 | Ga0495633_0000360 | 3300046558 | Bacteria | 49094 |
| 249 | Ga0495633_0000520 | 3300046558 | Bacteria | 38484 |
| 250 | Ga0495633_0001343 | 3300046558 | Bacteria | 19279 |
| 251 | Ga0495668_0000014 | 3300046616 | Bacteria | 442055 |
| 252 | Ga0495668_0053107 | 3300046616 | Bacteria | 2241 |
| 253 | Ga0495625_0049224 | 3300046660 | Bacteria | 3031 |
| 254 | Ga0495625_0116341 | 3300046660 | Bacteria | 1824 |
| 255 | Ga0495670_0000048 | 3300046691 | Bacteria | 64848 |
| 256 | Ga0495671_0000008 | 3300046692 | Bacteria | 419524 |
| 257 | Ga0495671_0064458 | 3300046692 | Bacteria | 1804 |
| 258 | Ga0495671_0083752 | 3300046692 | Bacteria | 1563 |
| 259 | Ga0495649_0055429 | 3300046694 | Bacteria | 2142 |
| 260 | Ga0495600_0002601 | 3300046809 | Bacteria | 10403 |
| 261 | Ga0495660_0002388 | 3300046810 | Bacteria | 11984 |
| 262 | Ga0495673_0000139 | 3300047469 | Bacteria | 130652 |
| 263 | Ga0495673_0005213 | 3300047469 | Bacteria | 7904 |
| 264 | Ga0495681_0000061 | 3300047470 | Bacteria | 99933 |
| 265 | Ga0495681_0002763 | 3300047470 | Bacteria | 12418 |
| 266 | Ga0495681_0056167 | 3300047470 | Bacteria | 1833 |
| 267 | Ga0495686_0030357 | 3300047472 | Bacteria | 3511 |
| 268 | Ga0495615_0000200 | 3300048090 | Bacteria | 14054 |
| 269 | Ga0495626_0002915 | 3300048091 | Bacteria | 11397 |
| 270 | Ga0496101_0017056 | 3300048904 | Bacteria | 4917 |
| 271 | Ga0496107_0106353 | 3300048910 | Bacteria | 2061 |
| 272 | Ga0496111_0198657 | 3300048914 | Bacteria | 1491 |
| 273 | Ga0496112_0013656 | 3300048915 | Bacteria | 7504 |
| 274 | Ga0496119_0026237 | 3300048922 | Bacteria | 4044 |
| 275 | Ga0496119_0076016 | 3300048922 | Bacteria | 1949 |
| 276 | Ga0496119_0125847 | 3300048922 | Bacteria | 1402 |
| 277 | Ga0496120_0002324 | 3300048923 | Bacteria | 19584 |
| 278 | Ga0496120_0040566 | 3300048923 | Bacteria | 2734 |
| 279 | Ga0496121_0000094 | 3300048924 | Bacteria | 212726 |
| 280 | Ga0496121_0012904 | 3300048924 | Bacteria | 9034 |
| 281 | Ga0496122_0000115 | 3300048925 | Bacteria | 183402 |
| 282 | Ga0496122_0004130 | 3300048925 | Bacteria | 18363 |
| 283 | Ga0496122_0057726 | 3300048925 | Bacteria | 2879 |
| 284 | Ga0496122_0132659 | 3300048925 | Unclassified | 1578 |
| 285 | Ga0496123_0000129 | 3300048926 | Bacteria | 153816 |
| 286 | Ga0496123_0002858 | 3300048926 | Bacteria | 20366 |
| 287 | Ga0496123_0056970 | 3300048926 | Bacteria | 2548 |
| 288 | Ga0496123_0079771 | 3300048926 | Bacteria | 1998 |
| 289 | Ga0496124_0012214 | 3300048927 | Bacteria | 8496 |
| 290 | Ga0496124_0021606 | 3300048927 | Bacteria | 5927 |
| 291 | Ga0496125_0002647 | 3300048928 | Bacteria | 22880 |
| 292 | Ga0496125_0007911 | 3300048928 | Bacteria | 11225 |
| 293 | Ga0496125_0015143 | 3300048928 | Bacteria | 7473 |
| 294 | Ga0496126_0010902 | 3300048929 | Bacteria | 9470 |
| 295 | Ga0496126_0026380 | 3300048929 | Bacteria | 5572 |
| 296 | Ga0496126_0094488 | 3300048929 | Bacteria | 2624 |
| 297 | Ga0496126_0110266 | 3300048929 | Bacteria | 2397 |
| 298 | Ga0501031_0002443 | 3300049568 | Bacteria | 11833 |
| 299 | Ga0501031_0038003 | 3300049568 | Bacteria | 3142 |
| 300 | Ga0501032_0035380 | 3300049569 | Bacteria | 3414 |
| 301 | Ga0501033_0017682 | 3300049570 | Bacteria | 5384 |
| 302 | Ga0501033_0076581 | 3300049570 | Bacteria | 2455 |
| 303 | Ga0501034_0004086 | 3300049571 | Bacteria | 16376 |
| 304 | Ga0501034_0029840 | 3300049571 | Bacteria | 5542 |
| 305 | Ga0501034_0124419 | 3300049571 | Bacteria | 2564 |
| 306 | Ga0501034_0156354 | 3300049571 | Bacteria | 2253 |
| 307 | Ga0501036_0015674 | 3300049572 | Bacteria | 6330 |
| 308 | Ga0501037_0012823 | 3300049573 | Bacteria | 6176 |
| 309 | Ga0501037_0042342 | 3300049573 | Bacteria | 3346 |
| 310 | Ga0501038_0037600 | 3300049574 | Bacteria | 4243 |
| 311 | Ga0501039_0004012 | 3300049575 | Bacteria | 11065 |
| 312 | Ga0501039_0026233 | 3300049575 | Bacteria | 4479 |
| 313 | Ga0501039_0091864 | 3300049575 | Bacteria | 2366 |
| 314 | Ga0501040_0127345 | 3300049576 | Unclassified | 1789 |
| 315 | Ga0501043_0061273 | 3300049579 | Bacteria | 2954 |
| 316 | Ga0501046_0001581 | 3300049580 | Bacteria | 21776 |
| 317 | Ga0501047_0085817 | 3300049581 | Bacteria | 3024 |
| 318 | Ga0501047_0250989 | 3300049581 | Bacteria | 1618 |
| 319 | Ga0501048_0026574 | 3300049582 | Bacteria | 4214 |
| 320 | Ga0501048_0075095 | 3300049582 | Bacteria | 2385 |
| 321 | Ga0501068_0100457 | 3300049584 | Bacteria | 1793 |
| 322 | Ga0501070_0161319 | 3300049586 | Bacteria | 1848 |
| 323 | Ga0501071_0096645 | 3300049587 | Bacteria | 2174 |
| 324 | Ga0501072_0006671 | 3300049588 | Bacteria | 8782 |
| 325 | Ga0501072_0055606 | 3300049588 | Bacteria | 3119 |
| 326 | Ga0501073_0001496 | 3300049589 | Bacteria | 17294 |
| 327 | Ga0501074_0150502 | 3300049590 | Unclassified | 1664 |
| 328 | Ga0501075_0042878 | 3300049591 | Bacteria | 3393 |
| 329 | Ga0501075_0065485 | 3300049591 | Bacteria | 2742 |
| 330 | Ga0501076_0063246 | 3300049592 | Bacteria | 2948 |
| 331 | Ga0501080_0153565 | 3300049742 | Bacteria | 2127 |
| 332 | Ga0501081_0027552 | 3300049743 | Unclassified | 3832 |
| 333 | Ga0501083_0024864 | 3300049744 | Bacteria | 4148 |
| 334 | Ga0501035_0145759 | 3300049822 | Bacteria | 2056 |
| 335 | Ga0501044_0021574 | 3300049823 | Bacteria | 6867 |
| 336 | Ga0501045_0006764 | 3300049824 | Bacteria | 7940 |
| 337 | Ga0501045_0011646 | 3300049824 | Bacteria | 6176 |
| 338 | nmdc:mga03683_86347_c1 | 3300050489 | Bacteria | 1362 |
| 339 | nmdc:mga00v17_22373_c1 | 3300050491 | Bacteria | 3647 |
| 340 | nmdc:mga0yw44_68203_c1 | 3300050492 | Bacteria | 2200 |
| 341 | nmdc:mga0yw44_72338_c1 | 3300050492 | Bacteria | 2143 |
| 342 | nmdc:mga0yw44_88411_c1 | 3300050492 | Bacteria | 1954 |
| 343 | nmdc:mga07m45_92526_c1 | 3300050496 | Bacteria | 1733 |
| 344 | nmdc:mga08y16_211_c1 | 3300050511 | Bacteria | 52298 |
| 345 | nmdc:mga0a205_323075_c1 | 3300050515 | Bacteria | 1414 |
| 346 | nmdc:mga0sz30_1726_c1 | 3300050516 | Bacteria | 6568 |
| 347 | nmdc:mga0sz30_38958_c1 | 3300050516 | Bacteria | 1993 |
| 348 | Ga0500610_0035513 | 3300053079 | Bacteria | 2557 |
| 349 | Ga0500635_0000919 | 3300053080 | Bacteria | 7129 |
| 350 | Ga0500643_003610 | 3300053087 | Bacteria | 7348 |
| 351 | Ga0500644_0000005 | 3300053088 | Bacteria | 164966 |
| 352 | Ga0500644_0001691 | 3300053088 | Bacteria | 5752 |
| 353 | Ga0500595_000582 | 3300053119 | Bacteria | 21779 |
| 354 | Ga0500595_005969 | 3300053119 | Bacteria | 5242 |
| 355 | Ga0500608_000049 | 3300053122 | Bacteria | 54754 |
| 356 | Ga0500608_000141 | 3300053122 | Bacteria | 29668 |
| 357 | Ga0500608_008028 | 3300053122 | Bacteria | 4409 |
| 358 | Ga0500608_131992 | 3300053122 | Bacteria | 1119 |
| 359 | Ga0500658_0004568 | 3300053134 | Bacteria | 5162 |
| 360 | Ga0500658_0017990 | 3300053134 | Bacteria | 2645 |
| 361 | Ga0500559_0001602 | 3300053136 | Bacteria | 12594 |
| 362 | Ga0500559_0024650 | 3300053136 | Bacteria | 2560 |
| 363 | Ga0500564_000013 | 3300053138 | Bacteria | 54100 |
| 364 | Ga0500568_0000361 | 3300053139 | Bacteria | 35246 |
| 365 | Ga0500568_0019618 | 3300053139 | Bacteria | 2935 |
| 366 | Ga0500577_0001083 | 3300053142 | Bacteria | 7006 |
| 367 | Ga0500577_0011243 | 3300053142 | Bacteria | 2664 |
| 368 | Ga0500616_0008205 | 3300053153 | Bacteria | 6517 |
| 369 | Ga0500622_0000159 | 3300053156 | Bacteria | 71047 |
| 370 | Ga0500622_0001692 | 3300053156 | Bacteria | 17162 |
| 371 | Ga0500622_0004230 | 3300053156 | Bacteria | 9143 |
| 372 | Ga0500622_0010351 | 3300053156 | Bacteria | 5123 |
| 373 | Ga0500627_0086678 | 3300053158 | Bacteria | 1399 |
| 374 | Ga0500636_0001131 | 3300053177 | Bacteria | 14293 |
| 375 | Ga0500609_003179 | 3300053731 | Bacteria | 2321 |
| 376 | Ga0501084_0223568 | 3300054114 | Bacteria | 1589 |
| 377 | Ga0501082_0106962 | 3300060353 | Bacteria | 2420 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2906427513 | 2906429331 | 323 |
| 2 | 3300042993 | Ga0439440_0031792 | Ga0439440_0031792_220_1233 | 325 |
| 3 | 3300053122 | Ga0500608_131992 | Ga0500608_131992_34_1032 | 327 |
| 4 | iso_pu_bacteria | 2874109183 | 2874114069 | 335 |
| 5 | 3300037466 | Ga0395898_0334961 | Ga0395898_0334961_27_1151 | 342 |
| 6 | iso_pu_bacteria | 2876369609 | 2876374267 | 343 |
| 7 | 3300048914 | Ga0496111_0198657 | Ga0496111_0198657_415_1470 | 346 |
| 8 | iso_pu_bacteria | 2977957713 | 2977961560 | 353 |
| 9 | 3300039437 | Ga0436365_0178914 | Ga0436365_0178914_1386_2498 | 358 |
| 10 | 3300046460 | Ga0495638_0023603 | Ga0495638_0023603_395_1486 | 358 |
| 11 | 3300049822 | Ga0501035_0145759 | Ga0501035_0145759_951_2042 | 358 |
| 12 | 3300048926 | Ga0496123_0079771 | Ga0496123_0079771_29_1123 | 359 |
| 13 | 3300038443 | Ga0395901_0086481 | Ga0395901_0086481_437_1618 | 361 |
| 14 | 3300005544 | Ga0070686_100129796 | Ga0070686_1001297961 | 363 |
| 15 | 3300039450 | Ga0436363_1282319 | Ga0436363_1282319_576_1697 | 364 |
| 16 | 3300037853 | Ga0436364_0091943 | Ga0436364_0091943_1487_2611 | 365 |
| 17 | 3300039450 | Ga0436363_1040280 | Ga0436363_1040280_921_2045 | 365 |
| 18 | iso_pu_bacteria | 2643221595 | 2643986891 | 365 |
| 19 | iso_pu_bacteria | 2643221627 | 2644156266 | 365 |
| 20 | 3300047472 | Ga0495686_0030357 | Ga0495686_0030357_548_1729 | 366 |
| 21 | 3300049575 | Ga0501039_0091864 | Ga0501039_0091864_707_1888 | 366 |
| 22 | 3300049576 | Ga0501040_0127345 | Ga0501040_0127345_291_1472 | 366 |
| 23 | 3300049587 | Ga0501071_0096645 | Ga0501071_0096645_591_1772 | 366 |
| 24 | 3300049588 | Ga0501072_0055606 | Ga0501072_0055606_1910_3091 | 366 |
| 25 | 3300049590 | Ga0501074_0150502 | Ga0501074_0150502_308_1489 | 366 |
| 26 | 3300049591 | Ga0501075_0065485 | Ga0501075_0065485_280_1461 | 366 |
| 27 | 3300049592 | Ga0501076_0063246 | Ga0501076_0063246_498_1679 | 366 |
| 28 | 3300060353 | Ga0501082_0106962 | Ga0501082_0106962_827_2008 | 366 |
| 29 | 3300005539 | Ga0068853_100001116 | Ga0068853_1000011169 | 368 |
| 30 | 3300026041 | Ga0207639_10000275 | Ga0207639_1000027526 | 368 |
| 31 | 3300054114 | Ga0501084_0223568 | Ga0501084_0223568_116_1306 | 368 |
| 32 | 3300010375 | Ga0105239_10168146 | Ga0105239_101681462 | 369 |
| 33 | iso_pu_bacteria | 2965032056 | 2965038013 | 372 |
| 34 | 3300048928 | Ga0496125_0002647 | Ga0496125_0002647_4961_6109 | 373 |
| 35 | 3300006847 | Ga0075431_100120013 | Ga0075431_1001200133 | 374 |
| 36 | 3300037853 | Ga0436364_0773657 | Ga0436364_0773657_21853_23001 | 377 |
| 37 | iso_pu_bacteria | 2738541277 | 2738721103 | 377 |
| 38 | iso_pu_bacteria | 2738543019 | 2739280302 | 377 |
| 39 | iso_pu_bacteria | 2904541872 | 2904547639 | 377 |
| 40 | iso_pu_bacteria | 2929160207 | 2929167120 | 377 |
| 41 | 3300049581 | Ga0501047_0250989 | Ga0501047_0250989_54_1244 | 378 |
| 42 | 3300001979 | JGI24740J21852_10029387 | JGI24740J21852_100293872 | 379 |
| 43 | 3300005563 | Ga0068855_100177547 | Ga0068855_1001775472 | 379 |
| 44 | 3300005577 | Ga0068857_100055786 | Ga0068857_1000557862 | 379 |
| 45 | 3300006178 | Ga0075367_10029837 | Ga0075367_100298373 | 379 |
| 46 | 3300006353 | Ga0075370_10136056 | Ga0075370_101360561 | 379 |
| 47 | 3300010375 | Ga0105239_10066557 | Ga0105239_100665572 | 379 |
| 48 | 3300046460 | Ga0495638_0003619 | Ga0495638_0003619_8911_10065 | 379 |
| 49 | 3300046519 | Ga0495632_0001919 | Ga0495632_0001919_6129_7283 | 379 |
| 50 | 3300046558 | Ga0495633_0001343 | Ga0495633_0001343_560_1714 | 379 |
| 51 | 3300046616 | Ga0495668_0053107 | Ga0495668_0053107_1069_2223 | 379 |
| 52 | 3300047469 | Ga0495673_0005213 | Ga0495673_0005213_2461_3615 | 379 |
| 53 | 3300053142 | Ga0500577_0001083 | Ga0500577_0001083_3636_4790 | 379 |
| 54 | 3300025297 | Ga0209758_1031423 | Ga0209758_10314232 | 380 |
| 55 | 3300025904 | Ga0207647_10009585 | Ga0207647_100095856 | 380 |
| 56 | 3300025933 | Ga0207706_10106672 | Ga0207706_101066723 | 380 |
| 57 | 3300026041 | Ga0207639_10123185 | Ga0207639_101231852 | 380 |
| 58 | 3300026078 | Ga0207702_10268897 | Ga0207702_102688971 | 380 |
| 59 | 3300026116 | Ga0207674_10056185 | Ga0207674_100561854 | 380 |
| 60 | 3300003187 | JGI25151J46595_10002569 | JGI25151J46595_100025696 | 381 |
| 61 | 3300025294 | Ga0209025_1000079 | Ga0209025_1000079138 | 381 |
| 62 | 3300032004 | Ga0307414_10157101 | Ga0307414_101571012 | 381 |
| 63 | 3300048904 | Ga0496101_0017056 | Ga0496101_0017056_2306_3478 | 381 |
| 64 | iso_pu_bacteria | 2937113482 | 2937117742 | 381 |
| 65 | iso_pu_bacteria | 2957415311 | 2957419013 | 381 |
| 66 | iso_pu_bacteria | 2977523885 | 2977524756 | 381 |
| 67 | 3300003794 | Ga0055531_10000610 | Ga0055531_1000061025 | 382 |
| 68 | 3300009545 | Ga0105237_10102563 | Ga0105237_101025632 | 382 |
| 69 | 3300031616 | Ga0307508_10000005 | Ga0307508_10000005132 | 382 |
| 70 | iso_pu_bacteria | 2503198000 | 2503201440 | 382 |
| 71 | iso_pu_bacteria | 2512875024 | 2512959428 | 382 |
| 72 | iso_pu_bacteria | 2513237164 | 2514033515 | 382 |
| 73 | iso_pu_bacteria | 2878730984 | 2878732259 | 382 |
| 74 | 3300021388 | Ga0213875_10037067 | Ga0213875_100370671 | 383 |
| 75 | 3300025304 | Ga0209257_1002211 | Ga0209257_100221112 | 383 |
| 76 | 3300049568 | Ga0501031_0038003 | Ga0501031_0038003_1515_2696 | 383 |
| 77 | 3300049575 | Ga0501039_0026233 | Ga0501039_0026233_2652_3833 | 383 |
| 78 | 3300049582 | Ga0501048_0075095 | Ga0501048_0075095_34_1215 | 383 |
| 79 | 3300049588 | Ga0501072_0006671 | Ga0501072_0006671_7353_8534 | 383 |
| 80 | 3300049591 | Ga0501075_0042878 | Ga0501075_0042878_606_1787 | 383 |
| 81 | 3300049743 | Ga0501081_0027552 | Ga0501081_0027552_1896_3077 | 383 |
| 82 | 3300049824 | Ga0501045_0006764 | Ga0501045_0006764_2825_4006 | 383 |
| 83 | iso_pu_bacteria | 2510917021 | 2511125929 | 383 |
| 84 | iso_pu_bacteria | 2512875026 | 2512975369 | 383 |
| 85 | iso_pu_bacteria | 2513237089 | 2513605681 | 383 |
| 86 | iso_pu_bacteria | 2513237160 | 2514008625 | 383 |
| 87 | iso_pu_bacteria | 2517487022 | 2517566976 | 383 |
| 88 | iso_pu_bacteria | 2524023250 | 2524613584 | 383 |
| 89 | iso_pu_bacteria | 2582581280 | 2585153547 | 383 |
| 90 | iso_pu_bacteria | 2582581293 | 2585197351 | 383 |
| 91 | iso_pu_bacteria | 2599185292 | 2599904305 | 383 |
| 92 | iso_pu_bacteria | 2643221552 | 2643780225 | 383 |
| 93 | iso_pu_bacteria | 2643221569 | 2643859461 | 383 |
| 94 | iso_pu_bacteria | 2643221584 | 2643928580 | 383 |
| 95 | iso_pu_bacteria | 2643221594 | 2643982955 | 383 |
| 96 | iso_pu_bacteria | 2643221607 | 2644048077 | 383 |
| 97 | iso_pu_bacteria | 2643221621 | 2644123661 | 383 |
| 98 | iso_pu_bacteria | 2643221629 | 2644167918 | 383 |
| 99 | iso_pu_bacteria | 2643221636 | 2644200333 | 383 |
| 100 | iso_pu_bacteria | 2643221662 | 2644348614 | 383 |
| 101 | iso_pu_bacteria | 2643221686 | 2644480872 | 383 |
| 102 | iso_pu_bacteria | 2643221689 | 2644502037 | 383 |
| 103 | iso_pu_bacteria | 2738541293 | 2738805634 | 383 |
| 104 | iso_pu_bacteria | 2802428858 | 2802721171 | 383 |
| 105 | iso_pu_bacteria | 2802428859 | 2802728385 | 383 |
| 106 | iso_pu_bacteria | 2802428860 | 2802733853 | 383 |
| 107 | iso_pu_bacteria | 2802428861 | 2802740509 | 383 |
| 108 | iso_pu_bacteria | 2802428862 | 2802746792 | 383 |
| 109 | iso_pu_bacteria | 2802428863 | 2802753649 | 383 |
| 110 | iso_pu_bacteria | 2808606395 | 2809033542 | 383 |
| 111 | iso_pu_bacteria | 2848297114 | 2848299267 | 383 |
| 112 | iso_pu_bacteria | 2857504554 | 2857506554 | 383 |
| 113 | iso_pu_bacteria | 2857576091 | 2857579473 | 383 |
| 114 | iso_pu_bacteria | 2871466892 | 2871468554 | 383 |
| 115 | iso_pu_bacteria | 2883291878 | 2883293747 | 383 |
| 116 | iso_pu_bacteria | 2883354860 | 2883357716 | 383 |
| 117 | iso_pu_bacteria | 2915980308 | 2915983422 | 383 |
| 118 | iso_pu_bacteria | 2916061851 | 2916066740 | 383 |
| 119 | iso_pu_bacteria | 2921250672 | 2921254811 | 383 |
| 120 | iso_pu_bacteria | 2937029754 | 2937032181 | 383 |
| 121 | iso_pu_bacteria | 2937036028 | 2937039531 | 383 |
| 122 | iso_pu_bacteria | 2937078374 | 2937081876 | 383 |
| 123 | iso_pu_bacteria | 2937084907 | 2937088359 | 383 |
| 124 | iso_pu_bacteria | 2939669807 | 2939671049 | 383 |
| 125 | iso_pu_bacteria | 2941479691 | 2941484511 | 383 |
| 126 | iso_pu_bacteria | 2946787523 | 2946791320 | 383 |
| 127 | iso_pu_bacteria | 2957375807 | 2957380365 | 383 |
| 128 | iso_pu_bacteria | 2957437181 | 2957443742 | 383 |
| 129 | iso_pu_bacteria | 2960591022 | 2960592990 | 383 |
| 130 | iso_pu_bacteria | 2960631154 | 2960633565 | 383 |
| 131 | iso_pu_bacteria | 2960680706 | 2960683914 | 383 |
| 132 | iso_pu_bacteria | 2960693952 | 2960698490 | 383 |
| 133 | iso_pu_bacteria | 2967686174 | 2967691105 | 383 |
| 134 | iso_pu_bacteria | 2967728569 | 2967731901 | 383 |
| 135 | iso_pu_bacteria | 2970026789 | 2970033155 | 383 |
| 136 | iso_pu_bacteria | 2970122695 | 2970127971 | 383 |
| 137 | iso_pu_bacteria | 2970143518 | 2970147922 | 383 |
| 138 | iso_pu_bacteria | 2977530762 | 2977536542 | 383 |
| 139 | iso_pu_bacteria | 2977544691 | 2977550965 | 383 |
| 140 | iso_pu_bacteria | 2989771324 | 2989772969 | 383 |
| 141 | iso_pu_bacteria | 8003999396 | 8004005551 | 383 |
| 142 | iso_pu_bacteria | 8054302542 | 8054302990 | 383 |
| 143 | 3300046616 | Ga0495668_0000014 | Ga0495668_0000014_142855_144024 | 384 |
| 144 | 3300053119 | Ga0500595_000582 | Ga0500595_000582_15630_16799 | 384 |
| 145 | 3300053122 | Ga0500608_000049 | Ga0500608_000049_29561_30730 | 384 |
| 146 | 3300053136 | Ga0500559_0001602 | Ga0500559_0001602_4101_5270 | 384 |
| 147 | 3300053156 | Ga0500622_0004230 | Ga0500622_0004230_2002_3171 | 384 |
| 148 | iso_pu_bacteria | 2508501123 | 2509113038 | 384 |
| 149 | iso_pu_bacteria | 2508501127 | 2509143976 | 384 |
| 150 | iso_pu_bacteria | 2509276018 | 2509367922 | 384 |
| 151 | iso_pu_bacteria | 2509276022 | 2509396212 | 384 |
| 152 | iso_pu_bacteria | 2510065057 | 2510304792 | 384 |
| 153 | iso_pu_bacteria | 2510065059 | 2510315604 | 384 |
| 154 | iso_pu_bacteria | 2513237090 | 2513611379 | 384 |
| 155 | iso_pu_bacteria | 2513237091 | 2513616010 | 384 |
| 156 | iso_pu_bacteria | 2513237351 | 2514588019 | 384 |
| 157 | iso_pu_bacteria | 2515154107 | 2515610121 | 384 |
| 158 | iso_pu_bacteria | 2516653046 | 2516898074 | 384 |
| 159 | iso_pu_bacteria | 2551306091 | 2551725806 | 384 |
| 160 | iso_pu_bacteria | 2597489875 | 2597813313 | 384 |
| 161 | iso_pu_bacteria | 2599185301 | 2599936836 | 384 |
| 162 | iso_pu_bacteria | 2687453392 | 2688598349 | 384 |
| 163 | iso_pu_bacteria | 2693429783 | 2694630990 | 384 |
| 164 | iso_pu_bacteria | 2693429784 | 2694636512 | 384 |
| 165 | iso_pu_bacteria | 2751185800 | 2753357084 | 384 |
| 166 | iso_pu_bacteria | 2756170246 | 2756672506 | 384 |
| 167 | iso_pu_bacteria | 2758568016 | 2758639370 | 384 |
| 168 | iso_pu_bacteria | 2818991435 | 2819536673 | 384 |
| 169 | iso_pu_bacteria | 2818991454 | 2819645834 | 384 |
| 170 | iso_pu_bacteria | 2837651117 | 2837654040 | 384 |
| 171 | iso_pu_bacteria | 2841734538 | 2841739106 | 384 |
| 172 | iso_pu_bacteria | 2844002411 | 2844007532 | 384 |
| 173 | iso_pu_bacteria | 2844009547 | 2844013602 | 384 |
| 174 | iso_pu_bacteria | 2852387548 | 2852395195 | 384 |
| 175 | iso_pu_bacteria | 2856320880 | 2856327578 | 384 |
| 176 | iso_pu_bacteria | 2856328259 | 2856334467 | 384 |
| 177 | iso_pu_bacteria | 2856334872 | 2856338925 | 384 |
| 178 | iso_pu_bacteria | 2856342000 | 2856343931 | 384 |
| 179 | iso_pu_bacteria | 2857367948 | 2857370893 | 384 |
| 180 | iso_pu_bacteria | 2869169390 | 2869169872 | 384 |
| 181 | iso_pu_bacteria | 2869234852 | 2869236884 | 384 |
| 182 | iso_pu_bacteria | 2869242130 | 2869248450 | 384 |
| 183 | iso_pu_bacteria | 2869249662 | 2869255578 | 384 |
| 184 | iso_pu_bacteria | 2869256925 | 2869257876 | 384 |
| 185 | iso_pu_bacteria | 2869264136 | 2869268032 | 384 |
| 186 | iso_pu_bacteria | 2869271264 | 2869276905 | 384 |
| 187 | iso_pu_bacteria | 2869278585 | 2869280467 | 384 |
| 188 | iso_pu_bacteria | 2871435913 | 2871436414 | 384 |
| 189 | iso_pu_bacteria | 2871451962 | 2871452570 | 384 |
| 190 | iso_pu_bacteria | 2871474448 | 2871475912 | 384 |
| 191 | iso_pu_bacteria | 2871481445 | 2871485560 | 384 |
| 192 | iso_pu_bacteria | 2874116593 | 2874119566 | 384 |
| 193 | iso_pu_bacteria | 2874123672 | 2874130518 | 384 |
| 194 | iso_pu_bacteria | 2874131515 | 2874135255 | 384 |
| 195 | iso_pu_bacteria | 2874139085 | 2874144121 | 384 |
| 196 | iso_pu_bacteria | 2874162495 | 2874163626 | 384 |
| 197 | iso_pu_bacteria | 2874168670 | 2874169759 | 384 |
| 198 | iso_pu_bacteria | 2876377896 | 2876378460 | 384 |
| 199 | iso_pu_bacteria | 2876386047 | 2876391862 | 384 |
| 200 | iso_pu_bacteria | 2876399893 | 2876403631 | 384 |
| 201 | iso_pu_bacteria | 2876420981 | 2876425544 | 384 |
| 202 | iso_pu_bacteria | 2878738818 | 2878745116 | 384 |
| 203 | iso_pu_bacteria | 2878774303 | 2878776298 | 384 |
| 204 | iso_pu_bacteria | 2878781027 | 2878782095 | 384 |
| 205 | iso_pu_bacteria | 2878788777 | 2878795710 | 384 |
| 206 | iso_pu_bacteria | 2881147464 | 2881151238 | 384 |
| 207 | iso_pu_bacteria | 2885312484 | 2885318067 | 384 |
| 208 | iso_pu_bacteria | 2888337043 | 2888339330 | 384 |
| 209 | iso_pu_bacteria | 2888343758 | 2888346714 | 384 |
| 210 | iso_pu_bacteria | 2889790730 | 2889792421 | 384 |
| 211 | iso_pu_bacteria | 2894817345 | 2894818262 | 384 |
| 212 | iso_pu_bacteria | 2903513507 | 2903515866 | 384 |
| 213 | iso_pu_bacteria | 2906363423 | 2906363648 | 384 |
| 214 | iso_pu_bacteria | 2906370794 | 2906372428 | 384 |
| 215 | iso_pu_bacteria | 2906378014 | 2906383774 | 384 |
| 216 | iso_pu_bacteria | 2906386501 | 2906390544 | 384 |
| 217 | iso_pu_bacteria | 2906393657 | 2906397042 | 384 |
| 218 | iso_pu_bacteria | 2906401398 | 2906403056 | 384 |
| 219 | iso_pu_bacteria | 2906408224 | 2906413778 | 384 |
| 220 | iso_pu_bacteria | 2909042592 | 2909046135 | 384 |
| 221 | iso_pu_bacteria | 2915650412 | 2915654432 | 384 |
| 222 | iso_pu_bacteria | 2916021584 | 2916025631 | 384 |
| 223 | iso_pu_bacteria | 2916041962 | 2916043203 | 384 |
| 224 | iso_pu_bacteria | 2916048683 | 2916049386 | 384 |
| 225 | iso_pu_bacteria | 2916076590 | 2916076607 | 384 |
| 226 | iso_pu_bacteria | 2921257292 | 2921259667 | 384 |
| 227 | iso_pu_bacteria | 2922151315 | 2922157818 | 384 |
| 228 | iso_pu_bacteria | 2922172374 | 2922175331 | 384 |
| 229 | iso_pu_bacteria | 2922178524 | 2922185501 | 384 |
| 230 | iso_pu_bacteria | 2924710171 | 2924715510 | 384 |
| 231 | iso_pu_bacteria | 2924733363 | 2924735839 | 384 |
| 232 | iso_pu_bacteria | 2924748358 | 2924749379 | 384 |
| 233 | iso_pu_bacteria | 2924754689 | 2924762585 | 384 |
| 234 | iso_pu_bacteria | 2924762789 | 2924768284 | 384 |
| 235 | iso_pu_bacteria | 2924776078 | 2924783253 | 384 |
| 236 | iso_pu_bacteria | 2936996657 | 2936999495 | 384 |
| 237 | iso_pu_bacteria | 2937009748 | 2937012315 | 384 |
| 238 | iso_pu_bacteria | 2937023124 | 2937026253 | 384 |
| 239 | iso_pu_bacteria | 2937836603 | 2937843150 | 384 |
| 240 | iso_pu_bacteria | 2937848649 | 2937853458 | 384 |
| 241 | iso_pu_bacteria | 2937861824 | 2937861832 | 384 |
| 242 | iso_pu_bacteria | 2937868953 | 2937872855 | 384 |
| 243 | iso_pu_bacteria | 2937877337 | 2937882220 | 384 |
| 244 | iso_pu_bacteria | 2937972304 | 2937978681 | 384 |
| 245 | iso_pu_bacteria | 2937980651 | 2937987371 | 384 |
| 246 | iso_pu_bacteria | 2938014810 | 2938016116 | 384 |
| 247 | iso_pu_bacteria | 2957382221 | 2957384050 | 384 |
| 248 | iso_pu_bacteria | 2957395598 | 2957399670 | 384 |
| 249 | iso_pu_bacteria | 2957402308 | 2957405391 | 384 |
| 250 | iso_pu_bacteria | 2957408893 | 2957412748 | 384 |
| 251 | iso_pu_bacteria | 2957450854 | 2957454141 | 384 |
| 252 | iso_pu_bacteria | 2958034702 | 2958036338 | 384 |
| 253 | iso_pu_bacteria | 2958041894 | 2958045701 | 384 |
| 254 | iso_pu_bacteria | 2958071322 | 2958072031 | 384 |
| 255 | iso_pu_bacteria | 2958084443 | 2958089342 | 384 |
| 256 | iso_pu_bacteria | 2958122699 | 2958123730 | 384 |
| 257 | iso_pu_bacteria | 2958137437 | 2958139208 | 384 |
| 258 | iso_pu_bacteria | 2958144490 | 2958149471 | 384 |
| 259 | iso_pu_bacteria | 2958158011 | 2958165011 | 384 |
| 260 | iso_pu_bacteria | 2960610863 | 2960611539 | 384 |
| 261 | iso_pu_bacteria | 2960687367 | 2960691278 | 384 |
| 262 | iso_pu_bacteria | 2961136820 | 2961142840 | 384 |
| 263 | iso_pu_bacteria | 2961183825 | 2961185158 | 384 |
| 264 | iso_pu_bacteria | 2964615318 | 2964617694 | 384 |
| 265 | iso_pu_bacteria | 2964636051 | 2964638702 | 384 |
| 266 | iso_pu_bacteria | 2964698721 | 2964701116 | 384 |
| 267 | iso_pu_bacteria | 2965025482 | 2965031852 | 384 |
| 268 | iso_pu_bacteria | 2965047637 | 2965053889 | 384 |
| 269 | iso_pu_bacteria | 2965089291 | 2965095036 | 384 |
| 270 | iso_pu_bacteria | 2965102966 | 2965107295 | 384 |
| 271 | iso_pu_bacteria | 2965110997 | 2965118920 | 384 |
| 272 | iso_pu_bacteria | 2967755722 | 2967756845 | 384 |
| 273 | iso_pu_bacteria | 2968016561 | 2968018548 | 384 |
| 274 | iso_pu_bacteria | 2970102677 | 2970106305 | 384 |
| 275 | iso_pu_bacteria | 2970177841 | 2970183549 | 384 |
| 276 | iso_pu_bacteria | 2970469710 | 2970471279 | 384 |
| 277 | iso_pu_bacteria | 2970489779 | 2970492979 | 384 |
| 278 | iso_pu_bacteria | 2970510686 | 2970516363 | 384 |
| 279 | iso_pu_bacteria | 2970524798 | 2970528498 | 384 |
| 280 | iso_pu_bacteria | 2970532167 | 2970532198 | 384 |
| 281 | iso_pu_bacteria | 2970540015 | 2970546823 | 384 |
| 282 | iso_pu_bacteria | 2970547951 | 2970548908 | 384 |
| 283 | iso_pu_bacteria | 2970593180 | 2970595064 | 384 |
| 284 | iso_pu_bacteria | 2970619444 | 2970620287 | 384 |
| 285 | iso_pu_bacteria | 2970627176 | 2970627785 | 384 |
| 286 | iso_pu_bacteria | 2977516862 | 2977517509 | 384 |
| 287 | iso_pu_bacteria | 2977565890 | 2977567782 | 384 |
| 288 | iso_pu_bacteria | 2977851361 | 2977851900 | 384 |
| 289 | iso_pu_bacteria | 2977864932 | 2977867165 | 384 |
| 290 | iso_pu_bacteria | 2977872689 | 2977879784 | 384 |
| 291 | iso_pu_bacteria | 2977898635 | 2977903625 | 384 |
| 292 | iso_pu_bacteria | 2977907340 | 2977914242 | 384 |
| 293 | iso_pu_bacteria | 2977915119 | 2977920270 | 384 |
| 294 | iso_pu_bacteria | 2977922695 | 2977924125 | 384 |
| 295 | iso_pu_bacteria | 2977935797 | 2977936113 | 384 |
| 296 | iso_pu_bacteria | 2977950692 | 2977955451 | 384 |
| 297 | iso_pu_bacteria | 2979764755 | 2979766726 | 384 |
| 298 | iso_pu_bacteria | 2979793036 | 2979799806 | 384 |
| 299 | iso_pu_bacteria | 2987645492 | 2987650704 | 384 |
| 300 | iso_pu_bacteria | 2987666974 | 2987671297 | 384 |
| 301 | iso_pu_bacteria | 2987673487 | 2987675855 | 384 |
| 302 | iso_pu_bacteria | 2996310559 | 2996315015 | 384 |
| 303 | iso_pu_bacteria | 2996348954 | 2996350070 | 384 |
| 304 | iso_pu_bacteria | 2996386984 | 2996391378 | 384 |
| 305 | iso_pu_bacteria | 3000135777 | 3000140765 | 384 |
| 306 | iso_pu_bacteria | 3004167301 | 3004168798 | 384 |
| 307 | iso_pu_bacteria | 3004195979 | 3004202250 | 384 |
| 308 | iso_pu_bacteria | 3004211236 | 3004215860 | 384 |
| 309 | iso_pu_bacteria | 3004218560 | 3004220233 | 384 |
| 310 | iso_pu_bacteria | 3004232784 | 3004233831 | 384 |
| 311 | iso_pu_bacteria | 3004239961 | 3004242859 | 384 |
| 312 | iso_pu_bacteria | 3004248173 | 3004255401 | 384 |
| 313 | iso_pu_bacteria | 3004268573 | 3004274839 | 384 |
| 314 | iso_pu_bacteria | 3004275668 | 3004276769 | 384 |
| 315 | iso_pu_bacteria | 3004289098 | 3004295663 | 384 |
| 316 | iso_pu_bacteria | 3004334049 | 3004334461 | 384 |
| 317 | iso_pu_bacteria | 648276728 | 648736256 | 384 |
| 318 | iso_pu_bacteria | 649633066 | 649872879 | 384 |
| 319 | iso_pu_bacteria | 8003992118 | 8003998616 | 384 |
| 320 | iso_pu_bacteria | 8004300914 | 8004303864 | 384 |
| 321 | iso_pu_bacteria | 8004312739 | 8004319587 | 384 |
| 322 | iso_pu_bacteria | 8004361976 | 8004367310 | 384 |
| 323 | iso_pu_bacteria | 8004395343 | 8004402331 | 384 |
| 324 | iso_pu_bacteria | 8004633249 | 8004637807 | 384 |
| 325 | iso_pu_bacteria | 8004640170 | 8004640916 | 384 |
| 326 | iso_pu_bacteria | 8004695233 | 8004701311 | 384 |
| 327 | iso_pu_bacteria | 8004727605 | 8004732808 | 384 |
| 328 | iso_pu_bacteria | 8024486573 | 8024487315 | 384 |
| 329 | iso_pu_bacteria | 8055617313 | 8055620687 | 384 |
| 330 | iso_pu_bacteria | 8057575449 | 8057576468 | 384 |
| 331 | 3300009545 | Ga0105237_10090603 | Ga0105237_100906032 | 385 |
| 332 | 3300025914 | Ga0207671_10164099 | Ga0207671_101640992 | 385 |
| 333 | 3300037853 | Ga0436364_0168878 | Ga0436364_0168878_955_2145 | 385 |
| 334 | 3300039437 | Ga0436365_0099515 | Ga0436365_0099515_1211_2401 | 385 |
| 335 | 3300042007 | Ga0439449_0074899 | Ga0439449_0074899_55_1227 | 385 |
| 336 | 3300003316 | rootH1_10131482 | rootH1_101314822 | 386 |
| 337 | 3300003322 | rootL2_10079358 | rootL2_100793582 | 386 |
| 338 | 3300005539 | Ga0068853_100120794 | Ga0068853_1001207942 | 386 |
| 339 | 3300006051 | Ga0075364_10015730 | Ga0075364_100157303 | 386 |
| 340 | 3300009093 | Ga0105240_10505318 | Ga0105240_105053182 | 386 |
| 341 | 3300010375 | Ga0105239_10169798 | Ga0105239_101697982 | 386 |
| 342 | 3300013104 | Ga0157370_10310244 | Ga0157370_103102441 | 386 |
| 343 | 3300014497 | Ga0182008_10022730 | Ga0182008_100227302 | 386 |
| 344 | 3300015684 | Ga0183365_10003 | Ga0183365_10003151 | 386 |
| 345 | 3300025913 | Ga0207695_10329681 | Ga0207695_103296812 | 386 |
| 346 | 3300026041 | Ga0207639_10092331 | Ga0207639_100923312 | 386 |
| 347 | 3300044684 | Ga0466966_0036760 | Ga0466966_0036760_1542_2819 | 386 |
| 348 | 3300045049 | Ga0466959_0018824 | Ga0466959_0018824_74_1351 | 386 |
| 349 | 3300048915 | Ga0496112_0013656 | Ga0496112_0013656_2740_3915 | 386 |
| 350 | 3300048922 | Ga0496119_0125847 | Ga0496119_0125847_159_1334 | 386 |
| 351 | 3300048923 | Ga0496120_0040566 | Ga0496120_0040566_18_1193 | 386 |
| 352 | 3300048929 | Ga0496126_0010902 | Ga0496126_0010902_1046_2233 | 386 |
| 353 | 3300048929 | Ga0496126_0110266 | Ga0496126_0110266_494_1681 | 386 |
| 354 | 3300049571 | Ga0501034_0124419 | Ga0501034_0124419_399_1574 | 386 |
| 355 | 3300050491 | nmdc:mga00v17_22373_c1 | nmdc:mga00v17_22373_c1_1765_2967 | 386 |
| 356 | 3300053080 | Ga0500635_0000919 | Ga0500635_0000919_1045_2220 | 386 |
| 357 | 3300053122 | Ga0500608_000141 | Ga0500608_000141_14466_15641 | 386 |
| 358 | 3300002773 | JGI25152J39213_1000133 | JGI25152J39213_100013320 | 387 |
| 359 | 3300002774 | JGI25150J39212_1000097 | JGI25150J39212_100009720 | 387 |
| 360 | 3300003187 | JGI25151J46595_10000334 | JGI25151J46595_1000033420 | 387 |
| 361 | 3300003215 | JGI25153J46596_10000583 | JGI25153J46596_100005838 | 387 |
| 362 | 3300003215 | JGI25153J46596_10028517 | JGI25153J46596_100285171 | 387 |
| 363 | 3300003322 | rootL2_10283227 | rootL2_102832271 | 387 |
| 364 | 3300003781 | Ga0055536_1000224 | Ga0055536_100022431 | 387 |
| 365 | 3300003781 | Ga0055536_1000722 | Ga0055536_100072222 | 387 |
| 366 | 3300003791 | Ga0055530_10001038 | Ga0055530_100010385 | 387 |
| 367 | 3300003791 | Ga0055530_10009730 | Ga0055530_100097303 | 387 |
| 368 | 3300003791 | Ga0055530_10017859 | Ga0055530_100178592 | 387 |
| 369 | 3300003794 | Ga0055531_10001285 | Ga0055531_1000128513 | 387 |
| 370 | 3300003794 | Ga0055531_10001590 | Ga0055531_100015903 | 387 |
| 371 | 3300005546 | Ga0070696_100152024 | Ga0070696_1001520241 | 387 |
| 372 | 3300005983 | Ga0081540_1044057 | Ga0081540_10440572 | 387 |
| 373 | 3300005985 | Ga0081539_10014851 | Ga0081539_100148512 | 387 |
| 374 | 3300006353 | Ga0075370_10125501 | Ga0075370_101255012 | 387 |
| 375 | 3300006852 | Ga0075433_10243613 | Ga0075433_102436132 | 387 |
| 376 | 3300009093 | Ga0105240_10298350 | Ga0105240_102983502 | 387 |
| 377 | 3300009094 | Ga0111539_10003929 | Ga0111539_1000392913 | 387 |
| 378 | 3300009147 | Ga0114129_10436623 | Ga0114129_104366232 | 387 |
| 379 | 3300009545 | Ga0105237_10134938 | Ga0105237_101349382 | 387 |
| 380 | 3300009551 | Ga0105238_10106048 | Ga0105238_101060482 | 387 |
| 381 | 3300022739 | Ga0228711_1005574 | Ga0228711_100557415 | 387 |
| 382 | 3300022740 | Ga0228710_1006649 | Ga0228710_100664915 | 387 |
| 383 | 3300025245 | Ga0207425_1000186 | Ga0207425_100018620 | 387 |
| 384 | 3300025258 | Ga0209129_1000165 | Ga0209129_100016533 | 387 |
| 385 | 3300025284 | Ga0209130_1023663 | Ga0209130_10236631 | 387 |
| 386 | 3300025292 | Ga0209676_1000087 | Ga0209676_100008770 | 387 |
| 387 | 3300025292 | Ga0209676_1000136 | Ga0209676_100013690 | 387 |
| 388 | 3300025294 | Ga0209025_1000362 | Ga0209025_100036265 | 387 |
| 389 | 3300025297 | Ga0209758_1000571 | Ga0209758_100057131 | 387 |
| 390 | 3300025297 | Ga0209758_1000685 | Ga0209758_100068520 | 387 |
| 391 | 3300025298 | Ga0209050_1000083 | Ga0209050_100008370 | 387 |
| 392 | 3300025298 | Ga0209050_1000238 | Ga0209050_100023859 | 387 |
| 393 | 3300025298 | Ga0209050_1002036 | Ga0209050_100203613 | 387 |
| 394 | 3300025298 | Ga0209050_1026621 | Ga0209050_10266212 | 387 |
| 395 | 3300025303 | Ga0209051_1001350 | Ga0209051_100135012 | 387 |
| 396 | 3300025304 | Ga0209257_1000142 | Ga0209257_100014290 | 387 |
| 397 | 3300025304 | Ga0209257_1002452 | Ga0209257_10024526 | 387 |
| 398 | 3300025913 | Ga0207695_10015090 | Ga0207695_100150902 | 387 |
| 399 | 3300025913 | Ga0207695_10102617 | Ga0207695_101026172 | 387 |
| 400 | 3300025914 | Ga0207671_10138726 | Ga0207671_101387262 | 387 |
| 401 | 3300025919 | Ga0207657_10093082 | Ga0207657_100930823 | 387 |
| 402 | 3300027111 | Ga0209281_1001012 | Ga0209281_100101220 | 387 |
| 403 | 3300027312 | Ga0209371_1010501 | Ga0209371_10105011 | 387 |
| 404 | 3300027666 | Ga0209282_1000296 | Ga0209282_100029610 | 387 |
| 405 | 3300027907 | Ga0207428_10000133 | Ga0207428_1000013391 | 387 |
| 406 | 3300028794 | Ga0307515_10001908 | Ga0307515_1000190815 | 387 |
| 407 | 3300028794 | Ga0307515_10211048 | Ga0307515_102110482 | 387 |
| 408 | 3300030500 | Ga0268256_1012697 | Ga0268256_10126971 | 387 |
| 409 | 3300031507 | Ga0307509_10000038 | Ga0307509_1000003841 | 387 |
| 410 | 3300031901 | Ga0307406_10066733 | Ga0307406_100667332 | 387 |
| 411 | 3300031911 | Ga0307412_10000118 | Ga0307412_1000011811 | 387 |
| 412 | 3300031911 | Ga0307412_10025426 | Ga0307412_100254262 | 387 |
| 413 | 3300031967 | Ga0315914_1001884 | Ga0315914_10018842 | 387 |
| 414 | 3300033430 | Ga0315913_1000879 | Ga0315913_100087927 | 387 |
| 415 | 3300033464 | Ga0315915_1000436 | Ga0315915_100043613 | 387 |
| 416 | 3300037471 | Ga0395905_0004612 | Ga0395905_0004612_8898_10076 | 387 |
| 417 | 3300039437 | Ga0436365_1579648 | Ga0436365_1579648_383_1582 | 387 |
| 418 | 3300039438 | Ga0436360_1340661 | Ga0436360_1340661_952_2133 | 387 |
| 419 | 3300039447 | Ga0436361_0055035 | Ga0436361_0055035_189_1370 | 387 |
| 420 | 3300039447 | Ga0436361_0395993 | Ga0436361_0395993_191_1393 | 387 |
| 421 | 3300041406 | Ga0439439_0006481 | Ga0439439_0006481_285_1478 | 387 |
| 422 | 3300041413 | Ga0439465_0015086 | Ga0439465_0015086_489_1682 | 387 |
| 423 | 3300042004 | Ga0439445_0013580 | Ga0439445_0013580_290_1483 | 387 |
| 424 | 3300042015 | Ga0439462_0011741 | Ga0439462_0011741_201_1394 | 387 |
| 425 | 3300045051 | Ga0451576_0016714 | Ga0451576_0016714_6030_7217 | 387 |
| 426 | 3300046453 | Ga0495627_001789 | Ga0495627_001789_9638_10828 | 387 |
| 427 | 3300046471 | Ga0495650_0000877 | Ga0495650_0000877_13142_14332 | 387 |
| 428 | 3300046492 | Ga0495585_0084659 | Ga0495585_0084659_417_1595 | 387 |
| 429 | 3300046500 | Ga0495596_0000084 | Ga0495596_0000084_31354_32532 | 387 |
| 430 | 3300046500 | Ga0495596_0001192 | Ga0495596_0001192_7231_8409 | 387 |
| 431 | 3300046501 | Ga0495607_0029049 | Ga0495607_0029049_49_1227 | 387 |
| 432 | 3300046506 | Ga0495583_0069486 | Ga0495583_0069486_44_1222 | 387 |
| 433 | 3300046512 | Ga0495610_0000019 | Ga0495610_0000019_248381_249559 | 387 |
| 434 | 3300046512 | Ga0495610_0003229 | Ga0495610_0003229_7884_9062 | 387 |
| 435 | 3300046512 | Ga0495610_0020194 | Ga0495610_0020194_698_1876 | 387 |
| 436 | 3300046513 | Ga0495616_0000674 | Ga0495616_0000674_8823_10001 | 387 |
| 437 | 3300046515 | Ga0495620_0036378 | Ga0495620_0036378_451_1629 | 387 |
| 438 | 3300046519 | Ga0495632_0000001 | Ga0495632_0000001_461002_462180 | 387 |
| 439 | 3300046519 | Ga0495632_0000844 | Ga0495632_0000844_12352_13542 | 387 |
| 440 | 3300046519 | Ga0495632_0028806 | Ga0495632_0028806_1668_2861 | 387 |
| 441 | 3300046520 | Ga0495637_0000183 | Ga0495637_0000183_28236_29414 | 387 |
| 442 | 3300046522 | Ga0495643_0000006 | Ga0495643_0000006_151415_152593 | 387 |
| 443 | 3300046522 | Ga0495643_0008714 | Ga0495643_0008714_4822_6000 | 387 |
| 444 | 3300046524 | Ga0495648_0000075 | Ga0495648_0000075_41855_43033 | 387 |
| 445 | 3300046524 | Ga0495648_0074928 | Ga0495648_0074928_119_1297 | 387 |
| 446 | 3300046525 | Ga0495663_0000001 | Ga0495663_0000001_411116_412294 | 387 |
| 447 | 3300046558 | Ga0495633_0000360 | Ga0495633_0000360_39903_41081 | 387 |
| 448 | 3300046558 | Ga0495633_0000520 | Ga0495633_0000520_3901_5079 | 387 |
| 449 | 3300046660 | Ga0495625_0116341 | Ga0495625_0116341_270_1448 | 387 |
| 450 | 3300046692 | Ga0495671_0000008 | Ga0495671_0000008_151415_152593 | 387 |
| 451 | 3300046692 | Ga0495671_0064458 | Ga0495671_0064458_79_1257 | 387 |
| 452 | 3300046692 | Ga0495671_0083752 | Ga0495671_0083752_25_1203 | 387 |
| 453 | 3300046810 | Ga0495660_0002388 | Ga0495660_0002388_4633_5811 | 387 |
| 454 | 3300047469 | Ga0495673_0000139 | Ga0495673_0000139_59458_60636 | 387 |
| 455 | 3300047470 | Ga0495681_0000061 | Ga0495681_0000061_70422_71612 | 387 |
| 456 | 3300047470 | Ga0495681_0002763 | Ga0495681_0002763_1997_3175 | 387 |
| 457 | 3300047470 | Ga0495681_0056167 | Ga0495681_0056167_70_1251 | 387 |
| 458 | 3300048090 | Ga0495615_0000200 | Ga0495615_0000200_4991_6169 | 387 |
| 459 | 3300048091 | Ga0495626_0002915 | Ga0495626_0002915_3141_4319 | 387 |
| 460 | 3300048910 | Ga0496107_0106353 | Ga0496107_0106353_28_1206 | 387 |
| 461 | 3300048924 | Ga0496121_0000094 | Ga0496121_0000094_137315_138493 | 387 |
| 462 | 3300048925 | Ga0496122_0000115 | Ga0496122_0000115_80886_82064 | 387 |
| 463 | 3300048925 | Ga0496122_0004130 | Ga0496122_0004130_7945_9123 | 387 |
| 464 | 3300048925 | Ga0496122_0132659 | Ga0496122_0132659_228_1436 | 387 |
| 465 | 3300048926 | Ga0496123_0000129 | Ga0496123_0000129_44583_45761 | 387 |
| 466 | 3300048926 | Ga0496123_0002858 | Ga0496123_0002858_7933_9111 | 387 |
| 467 | 3300048926 | Ga0496123_0056970 | Ga0496123_0056970_809_2017 | 387 |
| 468 | 3300048927 | Ga0496124_0012214 | Ga0496124_0012214_2867_4045 | 387 |
| 469 | 3300048927 | Ga0496124_0021606 | Ga0496124_0021606_4509_5717 | 387 |
| 470 | 3300048928 | Ga0496125_0015143 | Ga0496125_0015143_3030_4208 | 387 |
| 471 | 3300048929 | Ga0496126_0094488 | Ga0496126_0094488_740_1918 | 387 |
| 472 | 3300049568 | Ga0501031_0002443 | Ga0501031_0002443_884_2062 | 387 |
| 473 | 3300049569 | Ga0501032_0035380 | Ga0501032_0035380_1185_2363 | 387 |
| 474 | 3300049570 | Ga0501033_0017682 | Ga0501033_0017682_3027_4205 | 387 |
| 475 | 3300049570 | Ga0501033_0076581 | Ga0501033_0076581_196_1374 | 387 |
| 476 | 3300049571 | Ga0501034_0004086 | Ga0501034_0004086_565_1743 | 387 |
| 477 | 3300049571 | Ga0501034_0029840 | Ga0501034_0029840_1789_2967 | 387 |
| 478 | 3300049571 | Ga0501034_0156354 | Ga0501034_0156354_196_1374 | 387 |
| 479 | 3300049572 | Ga0501036_0015674 | Ga0501036_0015674_565_1743 | 387 |
| 480 | 3300049573 | Ga0501037_0012823 | Ga0501037_0012823_514_1692 | 387 |
| 481 | 3300049573 | Ga0501037_0042342 | Ga0501037_0042342_984_2162 | 387 |
| 482 | 3300049574 | Ga0501038_0037600 | Ga0501038_0037600_1886_3064 | 387 |
| 483 | 3300049575 | Ga0501039_0004012 | Ga0501039_0004012_92_1270 | 387 |
| 484 | 3300049579 | Ga0501043_0061273 | Ga0501043_0061273_495_1673 | 387 |
| 485 | 3300049580 | Ga0501046_0001581 | Ga0501046_0001581_7643_8821 | 387 |
| 486 | 3300049581 | Ga0501047_0085817 | Ga0501047_0085817_1282_2460 | 387 |
| 487 | 3300049582 | Ga0501048_0026574 | Ga0501048_0026574_1911_3089 | 387 |
| 488 | 3300049584 | Ga0501068_0100457 | Ga0501068_0100457_465_1643 | 387 |
| 489 | 3300049586 | Ga0501070_0161319 | Ga0501070_0161319_316_1494 | 387 |
| 490 | 3300049742 | Ga0501080_0153565 | Ga0501080_0153565_89_1267 | 387 |
| 491 | 3300049744 | Ga0501083_0024864 | Ga0501083_0024864_1555_2763 | 387 |
| 492 | 3300049823 | Ga0501044_0021574 | Ga0501044_0021574_1185_2363 | 387 |
| 493 | 3300049824 | Ga0501045_0011646 | Ga0501045_0011646_1637_2815 | 387 |
| 494 | 3300050496 | nmdc:mga07m45_92526_c1 | nmdc:mga07m45_92526_c1_540_1721 | 387 |
| 495 | 3300050511 | nmdc:mga08y16_211_c1 | nmdc:mga08y16_211_c1_50941_52119 | 387 |
| 496 | 3300050515 | nmdc:mga0a205_323075_c1 | nmdc:mga0a205_323075_c1_130_1308 | 387 |
| 497 | 3300053087 | Ga0500643_003610 | Ga0500643_003610_3438_4637 | 387 |
| 498 | 3300053088 | Ga0500644_0000005 | Ga0500644_0000005_39209_40387 | 387 |
| 499 | 3300053088 | Ga0500644_0001691 | Ga0500644_0001691_1943_3154 | 387 |
| 500 | 3300053122 | Ga0500608_008028 | Ga0500608_008028_2953_4164 | 387 |
| 501 | 3300053134 | Ga0500658_0004568 | Ga0500658_0004568_718_1917 | 387 |
| 502 | 3300053138 | Ga0500564_000013 | Ga0500564_000013_38211_39389 | 387 |
| 503 | 3300053139 | Ga0500568_0019618 | Ga0500568_0019618_1234_2433 | 387 |
| 504 | 3300053153 | Ga0500616_0008205 | Ga0500616_0008205_5318_6496 | 387 |
| 505 | 3300053156 | Ga0500622_0000159 | Ga0500622_0000159_24321_25532 | 387 |
| 506 | 3300053158 | Ga0500627_0086678 | Ga0500627_0086678_34_1212 | 387 |
| 507 | 3300053731 | Ga0500609_003179 | Ga0500609_003179_585_1763 | 387 |
| 508 | 3300001979 | JGI24740J21852_10021190 | JGI24740J21852_100211902 | 388 |
| 509 | 3300002987 | JGI25159J45721_1000158 | JGI25159J45721_10001584 | 388 |
| 510 | 3300003214 | JGI25165J46597_1000015 | JGI25165J46597_1000015272 | 388 |
| 511 | 3300003354 | JGI25160J50197_1000026 | JGI25160J50197_100002658 | 388 |
| 512 | 3300003374 | JGI25161J50226_1000014 | JGI25161J50226_1000014132 | 388 |
| 513 | 3300003762 | Ga0055542_1000088 | Ga0055542_100008840 | 388 |
| 514 | 3300003763 | Ga0055529_1000034 | Ga0055529_100003440 | 388 |
| 515 | 3300004625 | Ga0055543_1000079 | Ga0055543_100007970 | 388 |
| 516 | 3300005262 | Ga0065165_1000073 | Ga0065165_1000073109 | 388 |
| 517 | 3300005327 | Ga0070658_10002931 | Ga0070658_100029314 | 388 |
| 518 | 3300005327 | Ga0070658_10187265 | Ga0070658_101872652 | 388 |
| 519 | 3300005328 | Ga0070676_10029649 | Ga0070676_100296493 | 388 |
| 520 | 3300005339 | Ga0070660_100034900 | Ga0070660_1000349003 | 388 |
| 521 | 3300005347 | Ga0070668_100009387 | Ga0070668_1000093872 | 388 |
| 522 | 3300005364 | Ga0070673_100039497 | Ga0070673_1000394974 | 388 |
| 523 | 3300005366 | Ga0070659_100031467 | Ga0070659_1000314674 | 388 |
| 524 | 3300005367 | Ga0070667_100076354 | Ga0070667_1000763542 | 388 |
| 525 | 3300005459 | Ga0068867_100182065 | Ga0068867_1001820652 | 388 |
| 526 | 3300005530 | Ga0070679_100177105 | Ga0070679_1001771052 | 388 |
| 527 | 3300005539 | Ga0068853_100019005 | Ga0068853_1000190052 | 388 |
| 528 | 3300005539 | Ga0068853_100054689 | Ga0068853_1000546894 | 388 |
| 529 | 3300005548 | Ga0070665_100005166 | Ga0070665_1000051669 | 388 |
| 530 | 3300005548 | Ga0070665_100050304 | Ga0070665_1000503041 | 388 |
| 531 | 3300005548 | Ga0070665_100252599 | Ga0070665_1002525992 | 388 |
| 532 | 3300005548 | Ga0070665_100263813 | Ga0070665_1002638132 | 388 |
| 533 | 3300005614 | Ga0068856_100056091 | Ga0068856_1000560914 | 388 |
| 534 | 3300005616 | Ga0068852_100012893 | Ga0068852_1000128933 | 388 |
| 535 | 3300005841 | Ga0068863_100003967 | Ga0068863_10000396711 | 388 |
| 536 | 3300005843 | Ga0068860_100000536 | Ga0068860_1000005366 | 388 |
| 537 | 3300006038 | Ga0075365_10009599 | Ga0075365_100095992 | 388 |
| 538 | 3300006038 | Ga0075365_10045943 | Ga0075365_100459433 | 388 |
| 539 | 3300006038 | Ga0075365_10050738 | Ga0075365_100507382 | 388 |
| 540 | 3300006038 | Ga0075365_10068347 | Ga0075365_100683472 | 388 |
| 541 | 3300006177 | Ga0075362_10000827 | Ga0075362_100008278 | 388 |
| 542 | 3300006177 | Ga0075362_10083742 | Ga0075362_100837421 | 388 |
| 543 | 3300006186 | Ga0075369_10014686 | Ga0075369_100146862 | 388 |
| 544 | 3300006353 | Ga0075370_10078247 | Ga0075370_100782472 | 388 |
| 545 | 3300006946 | Ga0079104_1003039 | Ga0079104_10030396 | 388 |
| 546 | 3300009093 | Ga0105240_10030016 | Ga0105240_100300162 | 388 |
| 547 | 3300009148 | Ga0105243_10199012 | Ga0105243_101990123 | 388 |
| 548 | 3300009545 | Ga0105237_10018220 | Ga0105237_100182204 | 388 |
| 549 | 3300009551 | Ga0105238_10057544 | Ga0105238_100575442 | 388 |
| 550 | 3300009551 | Ga0105238_10060557 | Ga0105238_100605573 | 388 |
| 551 | 3300009553 | Ga0105249_10024598 | Ga0105249_100245982 | 388 |
| 552 | 3300009553 | Ga0105249_10505640 | Ga0105249_105056401 | 388 |
| 553 | 3300010375 | Ga0105239_10032071 | Ga0105239_100320712 | 388 |
| 554 | 3300010375 | Ga0105239_10262379 | Ga0105239_102623792 | 388 |
| 555 | 3300010375 | Ga0105239_10268061 | Ga0105239_102680611 | 388 |
| 556 | 3300013100 | Ga0157373_10016893 | Ga0157373_100168934 | 388 |
| 557 | 3300013104 | Ga0157370_10342278 | Ga0157370_103422781 | 388 |
| 558 | 3300013105 | Ga0157369_10069256 | Ga0157369_100692562 | 388 |
| 559 | 3300025254 | Ga0209148_1000093 | Ga0209148_100009342 | 388 |
| 560 | 3300025254 | Ga0209148_1000233 | Ga0209148_100023391 | 388 |
| 561 | 3300025261 | Ga0209233_1000010 | Ga0209233_1000010369 | 388 |
| 562 | 3300025261 | Ga0209233_1000360 | Ga0209233_100036028 | 388 |
| 563 | 3300025272 | Ga0209455_1000045 | Ga0209455_1000045183 | 388 |
| 564 | 3300025272 | Ga0209455_1000062 | Ga0209455_1000062339 | 388 |
| 565 | 3300025284 | Ga0209130_1000219 | Ga0209130_100021966 | 388 |
| 566 | 3300025302 | Ga0207426_1000075 | Ga0207426_1000075148 | 388 |
| 567 | 3300025304 | Ga0209257_1004870 | Ga0209257_10048708 | 388 |
| 568 | 3300025907 | Ga0207645_10010175 | Ga0207645_100101752 | 388 |
| 569 | 3300025913 | Ga0207695_10021793 | Ga0207695_100217937 | 388 |
| 570 | 3300025913 | Ga0207695_10171049 | Ga0207695_101710492 | 388 |
| 571 | 3300025913 | Ga0207695_10223822 | Ga0207695_102238222 | 388 |
| 572 | 3300025919 | Ga0207657_10014102 | Ga0207657_100141027 | 388 |
| 573 | 3300025919 | Ga0207657_10021558 | Ga0207657_100215586 | 388 |
| 574 | 3300025919 | Ga0207657_10064189 | Ga0207657_100641893 | 388 |
| 575 | 3300025924 | Ga0207694_10040103 | Ga0207694_100401033 | 388 |
| 576 | 3300025924 | Ga0207694_10283204 | Ga0207694_102832041 | 388 |
| 577 | 3300025932 | Ga0207690_10096719 | Ga0207690_100967193 | 388 |
| 578 | 3300025932 | Ga0207690_10135660 | Ga0207690_101356602 | 388 |
| 579 | 3300025937 | Ga0207669_10037798 | Ga0207669_100377983 | 388 |
| 580 | 3300025937 | Ga0207669_10038725 | Ga0207669_100387252 | 388 |
| 581 | 3300025949 | Ga0207667_10002994 | Ga0207667_1000299413 | 388 |
| 582 | 3300025949 | Ga0207667_10410682 | Ga0207667_104106821 | 388 |
| 583 | 3300025960 | Ga0207651_10050045 | Ga0207651_100500454 | 388 |
| 584 | 3300025961 | Ga0207712_10024320 | Ga0207712_100243201 | 388 |
| 585 | 3300025986 | Ga0207658_10043261 | Ga0207658_100432612 | 388 |
| 586 | 3300026041 | Ga0207639_10060218 | Ga0207639_100602182 | 388 |
| 587 | 3300026088 | Ga0207641_10000785 | Ga0207641_1000078519 | 388 |
| 588 | 3300026089 | Ga0207648_10148350 | Ga0207648_101483502 | 388 |
| 589 | 3300026116 | Ga0207674_10019756 | Ga0207674_100197568 | 388 |
| 590 | 3300027111 | Ga0209281_1001545 | Ga0209281_10015459 | 388 |
| 591 | 3300028379 | Ga0268266_10002386 | Ga0268266_100023869 | 388 |
| 592 | 3300028379 | Ga0268266_10199804 | Ga0268266_101998042 | 388 |
| 593 | 3300028379 | Ga0268266_10308253 | Ga0268266_103082532 | 388 |
| 594 | 3300028380 | Ga0268265_10029014 | Ga0268265_100290142 | 388 |
| 595 | 3300028381 | Ga0268264_10000521 | Ga0268264_1000052137 | 388 |
| 596 | 3300031456 | Ga0307513_10128843 | Ga0307513_101288432 | 388 |
| 597 | 3300033180 | Ga0307510_10000008 | Ga0307510_10000008344 | 388 |
| 598 | 3300033180 | Ga0307510_10090583 | Ga0307510_100905833 | 388 |
| 599 | 3300035113 | Ga0373936_0000983 | Ga0373936_0000983_2364_3680 | 388 |
| 600 | 3300035691 | Ga0373931_0033614 | Ga0373931_0033614_777_1961 | 388 |
| 601 | 3300037418 | Ga0395900_0367844 | Ga0395900_0367844_211_1392 | 388 |
| 602 | 3300037471 | Ga0395905_0001090 | Ga0395905_0001090_26465_27646 | 388 |
| 603 | 3300039438 | Ga0436360_0635651 | Ga0436360_0635651_50_1234 | 388 |
| 604 | 3300039453 | Ga0436362_0831552 | Ga0436362_0831552_865_2064 | 388 |
| 605 | 3300042007 | Ga0439449_0038179 | Ga0439449_0038179_593_1774 | 388 |
| 606 | 3300046460 | Ga0495638_0014437 | Ga0495638_0014437_116_1297 | 388 |
| 607 | 3300046471 | Ga0495650_0000091 | Ga0495650_0000091_18186_19376 | 388 |
| 608 | 3300046506 | Ga0495583_0000364 | Ga0495583_0000364_54850_56040 | 388 |
| 609 | 3300046512 | Ga0495610_0015471 | Ga0495610_0015471_2986_4167 | 388 |
| 610 | 3300046520 | Ga0495637_0033281 | Ga0495637_0033281_1023_2204 | 388 |
| 611 | 3300046522 | Ga0495643_0014491 | Ga0495643_0014491_441_1625 | 388 |
| 612 | 3300046660 | Ga0495625_0049224 | Ga0495625_0049224_1421_2608 | 388 |
| 613 | 3300046691 | Ga0495670_0000048 | Ga0495670_0000048_23997_25187 | 388 |
| 614 | 3300046694 | Ga0495649_0055429 | Ga0495649_0055429_581_1786 | 388 |
| 615 | 3300046809 | Ga0495600_0002601 | Ga0495600_0002601_6253_7443 | 388 |
| 616 | 3300048922 | Ga0496119_0026237 | Ga0496119_0026237_557_1738 | 388 |
| 617 | 3300048922 | Ga0496119_0076016 | Ga0496119_0076016_466_1647 | 388 |
| 618 | 3300048923 | Ga0496120_0002324 | Ga0496120_0002324_7604_8785 | 388 |
| 619 | 3300048924 | Ga0496121_0012904 | Ga0496121_0012904_7408_8589 | 388 |
| 620 | 3300048925 | Ga0496122_0057726 | Ga0496122_0057726_847_2028 | 388 |
| 621 | 3300048928 | Ga0496125_0007911 | Ga0496125_0007911_3891_5072 | 388 |
| 622 | 3300048929 | Ga0496126_0026380 | Ga0496126_0026380_3659_4840 | 388 |
| 623 | 3300049589 | Ga0501073_0001496 | Ga0501073_0001496_7581_8774 | 388 |
| 624 | 3300050489 | nmdc:mga03683_86347_c1 | nmdc:mga03683_86347_c1_25_1218 | 388 |
| 625 | 3300050492 | nmdc:mga0yw44_68203_c1 | nmdc:mga0yw44_68203_c1_714_1895 | 388 |
| 626 | 3300050492 | nmdc:mga0yw44_72338_c1 | nmdc:mga0yw44_72338_c1_331_1512 | 388 |
| 627 | 3300050492 | nmdc:mga0yw44_88411_c1 | nmdc:mga0yw44_88411_c1_222_1403 | 388 |
| 628 | 3300050516 | nmdc:mga0sz30_1726_c1 | nmdc:mga0sz30_1726_c1_2136_3317 | 388 |
| 629 | 3300050516 | nmdc:mga0sz30_38958_c1 | nmdc:mga0sz30_38958_c1_68_1249 | 388 |
| 630 | 3300053079 | Ga0500610_0035513 | Ga0500610_0035513_456_1637 | 388 |
| 631 | 3300053119 | Ga0500595_005969 | Ga0500595_005969_2656_3846 | 388 |
| 632 | 3300053134 | Ga0500658_0017990 | Ga0500658_0017990_14_1195 | 388 |
| 633 | 3300053136 | Ga0500559_0024650 | Ga0500559_0024650_668_1849 | 388 |
| 634 | 3300053139 | Ga0500568_0000361 | Ga0500568_0000361_23242_24426 | 388 |
| 635 | 3300053142 | Ga0500577_0011243 | Ga0500577_0011243_766_1950 | 388 |
| 636 | 3300053156 | Ga0500622_0001692 | Ga0500622_0001692_3031_4215 | 388 |
| 637 | 3300053156 | Ga0500622_0010351 | Ga0500622_0010351_3273_4457 | 388 |
| 638 | 3300053177 | Ga0500636_0001131 | Ga0500636_0001131_5452_6642 | 388 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ty1-assembly1.cif.gz_C | crystal structure of a putative aldose 1-epimerase (kpn_04629) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.90 a resolution | 0.9042 | 27 | 365 |
| 3ty1-assembly1.cif.gz_C | crystal structure of a putative aldose 1-epimerase (kpn_04629) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.90 a resolution | 0.7754 | 27 | 365 |
| 3k25-assembly2.cif.gz_B | crystal structure of slr1438 protein from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr112 | 0.7244 | 49 | 355 |
| 3mwx-assembly2.cif.gz_B | crystal structure of a putative galactose mutarotase (bsu18360) from bacillus subtilis at 1.45 a resolution | 0.6797 | 27 | 354 |
| 2ciq-assembly1.cif.gz_A | structure-based functional annotation: yeast ymr099c codes for a d- hexose-6-phosphate mutarotase. | 0.6735 | 28 | 353 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ty1C00 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.8931 | 27 | 365 | 2.70.98.10 |
| 3ty1C00 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.7644 | 27 | 365 | 2.70.98.10 |
| 3k25A00 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.7338 | 49 | 355 | 2.70.98.10 |
| af_B8A1H0_29_315_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.7241 | 27 | 355 | 2.70.98.10 |
| af_A0A368UGQ6_22_308_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.6973 | 38 | 359 | 2.70.98.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A526YQY0-F1-model_v4 | DUF4432 family protein | 0.9948 | 1 | 344 |
GO:0030246
|
| AF-A0A0Q6P1L7-F1-model_v4 | DUF4432 domain-containing protein | 0.9914 | 1 | 387 |
GO:0030246
|
| AF-A0A436I7C5-F1-model_v4 | deleted | 0.9908 | 152 | 388 |
|
| AF-A0A526YQY0-F1-model_v4 | DUF4432 family protein | 0.989 | 1 | 344 |
GO:0030246
|
| AF-A0A435PFZ4-F1-model_v4 | deleted | 0.9889 | 112 | 388 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar