F471515

General Info

Members Datasets Scaffolds Average Seq Length
638 487 377 391

Family's Representative Sequence

Representative Sequence 3300025261|Ga0209233_1000360|Ga0209233_100036028
Length 436
Sequence MIIDASINFDHRDGRVLPRRWEGIVVELFGRSYSRREIEERTGALAQFAGVRLTTLGDGLERGIRMLEFRTGSGLRFTVLIDRAMDIADCEYKGLAIGWNSPAGFRHPSLHEYEGEGGLAWARSFSGLLVTCGLDHILFMNDVPAENYVYSPKRSVSHSLHGRVGTIPARLTGYGERWEGDRCFLWAEGVVQQAAVFGEDLHLVRRIEAEVGSSEIRLTDRVVNHGFYKTPHMLCYHINVGHPVLDAGSRYLAPIEDVVWAAHASESERPAWLDNDVVWADGTHDSYHRQHVGYRTLSGPHLGFHEQVWQHELAADENDEVPVALVNDRLGLGFEVTTRKSQFPCQYEWQNLQAGQYALGIEPSTNHVLGNLAARERGEMIWLLHGEERRYDTVFRVLDGSCAIEIAEERIRGIANQPPEDFPVPSNNHRRIEGRS

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
8 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
9 2512875024 Mesorhizobium loti R88b Isolate Nodule
10 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
11 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
12 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
13 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
14 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
15 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
16 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
17 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
18 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
19 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
20 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
21 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
22 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
23 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
24 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
25 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
26 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
27 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
28 2643221569 Achromobacter sp. Root565 Isolate Unclassified
29 2643221584 Caulobacter sp. Root656 Isolate Unclassified
30 2643221594 Achromobacter sp. Root170 Isolate Unclassified
31 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
32 2643221607 Rhizobium sp. Root73 Isolate Unclassified
33 2643221621 Achromobacter sp. Root83 Isolate Unclassified
34 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
35 2643221629 Devosia sp. Root105 Isolate Unclassified
36 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
37 2643221662 Devosia sp. Root413D1 Isolate Unclassified
38 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
39 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
40 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
41 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
42 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
43 2738541277 Variovorax sp. GV051 Isolate Unclassified
44 2738541293 Rhizobium sp. GV031 Isolate Unclassified
45 2738543019 Variovorax sp. GV040 Isolate Unclassified
46 2751185800 Brucella pituitosa AA2 Isolate Unclassified
47 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
48 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
49 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
50 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
51 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
52 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
53 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
54 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
55 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
56 2818991435 Caulobacter henricii 536 Isolate Unclassified
57 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
58 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
59 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
60 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
61 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
62 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
63 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
64 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
65 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
66 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
67 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
68 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
69 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
70 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
71 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
72 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
73 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
74 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
75 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
76 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
77 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
78 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
79 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
80 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
81 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
82 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
83 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
84 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
85 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
86 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
87 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
88 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
89 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
90 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
91 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
92 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
93 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
94 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
95 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
96 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
97 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
98 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
99 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
100 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
101 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
102 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
103 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
104 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
105 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
106 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
107 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
108 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
109 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
110 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
111 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
112 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
113 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
114 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
115 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
116 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
117 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
118 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
119 2909042592 Labrys sp. LIt4 Isolate Nodule
120 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
121 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
122 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
123 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
124 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
125 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
126 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
127 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
128 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
129 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
130 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
131 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
132 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
133 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
134 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
135 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
136 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
137 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
138 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
139 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
140 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
141 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
142 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
143 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
144 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
145 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
146 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
147 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
148 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
149 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
150 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
151 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
152 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
153 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
154 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
155 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
156 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
157 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
158 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
159 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
160 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
161 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
162 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
163 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
164 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
165 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
166 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
167 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
168 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
169 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
170 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
171 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
172 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
173 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
174 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
175 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
176 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
177 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
178 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
179 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
180 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
181 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
182 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
183 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
184 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
185 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
186 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
187 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
188 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
189 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
190 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
191 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
192 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
193 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
194 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
195 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
196 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
197 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
198 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
199 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
200 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
201 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
202 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
203 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
204 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
205 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
206 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
207 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
208 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
209 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
210 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
211 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
212 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
213 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
214 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
215 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
216 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
217 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
218 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
219 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
220 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
221 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
222 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
223 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
224 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
225 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
226 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
227 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
228 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
229 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
230 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
231 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
232 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
233 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
234 3004167301 Mesorhizobium loti 582 Isolate Unclassified
235 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
236 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
237 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
238 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
239 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
240 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
241 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
242 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
243 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
244 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
245 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
246 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
247 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
248 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
249 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
250 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
251 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
252 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
253 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
254 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
255 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
256 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
257 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
258 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
259 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
260 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
261 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
262 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
263 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
264 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
265 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
266 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
267 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
268 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
269 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
270 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
271 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
272 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
273 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
274 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
275 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
276 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
277 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
278 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
279 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
280 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
281 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
282 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
283 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
284 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
285 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
286 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
287 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
288 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
289 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
290 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
291 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
292 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
293 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
294 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
295 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
296 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
297 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
298 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
299 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
300 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
301 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
302 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
303 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
304 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
305 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
306 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
307 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
308 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
309 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
310 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
311 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
312 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
313 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
314 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
315 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
316 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
317 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
318 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
319 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
320 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
321 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
341 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
342 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
343 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
344 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
348 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
349 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
350 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
351 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
352 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
353 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
354 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
355 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
356 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
357 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
358 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
359 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
360 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
361 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
362 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
363 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
364 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
365 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
366 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
367 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
368 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
369 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
370 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
371 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
372 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
373 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
374 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
375 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
376 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
377 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
378 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
379 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
380 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
381 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
382 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
383 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
384 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
385 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
386 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
387 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
388 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
389 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
390 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
391 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
392 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
393 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
394 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
395 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
396 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
397 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
398 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
399 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
400 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
401 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
402 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
403 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
404 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
405 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
406 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
407 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
408 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
409 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
410 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
411 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
412 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
413 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
414 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
415 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
416 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
417 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
418 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
419 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
420 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
423 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
424 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
425 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
434 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
435 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
436 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
437 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
438 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
439 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
440 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
441 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
442 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
443 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
444 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
447 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
448 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
449 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
450 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
451 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
452 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
453 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
454 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
455 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
456 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
457 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
458 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
459 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
460 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
461 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
462 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
463 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
464 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
465 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
466 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
467 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
468 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
469 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
470 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
471 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
472 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
473 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
474 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
475 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
476 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
477 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
478 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
479 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
480 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
481 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
482 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
483 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
484 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
485 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
486 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
487 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 59.09
Metatranscriptomes 0
Isolates 40.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.2
Nodule 32.76
Rhizoplane 0.94
Rhizosphere 37.46
Stem 0
Stem Tuber 0
Unclassified 13.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10021190 3300001979 Bacteria 2257
2 JGI24740J21852_10029387 3300001979 Bacteria 1805
3 JGI25152J39213_1000133 3300002773 Bacteria 50447
4 JGI25150J39212_1000097 3300002774 Bacteria 50447
5 JGI25159J45721_1000158 3300002987 Bacteria 31947
6 JGI25151J46595_10000334 3300003187 Bacteria 50447
7 JGI25151J46595_10002569 3300003187 Bacteria 10754
8 JGI25165J46597_1000015 3300003214 Bacteria 380891
9 JGI25153J46596_10000583 3300003215 Bacteria 22446
10 JGI25153J46596_10028517 3300003215 Bacteria 1933
11 rootH1_10131482 3300003316 Bacteria 2308
12 rootL2_10079358 3300003322 Bacteria 2704
13 rootL2_10283227 3300003322 Bacteria 1897
14 JGI25160J50197_1000026 3300003354 Bacteria 184693
15 JGI25161J50226_1000014 3300003374 Bacteria 191109
16 Ga0055542_1000088 3300003762 Bacteria 123491
17 Ga0055529_1000034 3300003763 Bacteria 244657
18 Ga0055536_1000224 3300003781 Bacteria 45927
19 Ga0055536_1000722 3300003781 Bacteria 22138
20 Ga0055530_10001038 3300003791 Bacteria 22140
21 Ga0055530_10009730 3300003791 Bacteria 3647
22 Ga0055530_10017859 3300003791 Bacteria 2207
23 Ga0055531_10000610 3300003794 Bacteria 30977
24 Ga0055531_10001285 3300003794 Bacteria 18916
25 Ga0055531_10001590 3300003794 Bacteria 16552
26 Ga0055543_1000079 3300004625 Bacteria 84916
27 Ga0065165_1000073 3300005262 Bacteria 164910
28 Ga0070658_10002931 3300005327 Bacteria 14146
29 Ga0070658_10187265 3300005327 Bacteria 1744
30 Ga0070676_10029649 3300005328 Bacteria 3113
31 Ga0070660_100034900 3300005339 Bacteria 3803
32 Ga0070668_100009387 3300005347 Bacteria 7257
33 Ga0070673_100039497 3300005364 Bacteria 3612
34 Ga0070659_100031467 3300005366 Bacteria 4110
35 Ga0070667_100076354 3300005367 Bacteria 2861
36 Ga0068867_100182065 3300005459 Bacteria 1671
37 Ga0070679_100177105 3300005530 Bacteria 2105
38 Ga0068853_100001116 3300005539 Bacteria 18998
39 Ga0068853_100019005 3300005539 Bacteria 5693
40 Ga0068853_100054689 3300005539 Bacteria 3441
41 Ga0068853_100120794 3300005539 Bacteria 2337
42 Ga0070686_100129796 3300005544 Bacteria 1741
43 Ga0070696_100152024 3300005546 Bacteria 1700
44 Ga0070665_100005166 3300005548 Bacteria 13509
45 Ga0070665_100050304 3300005548 Bacteria 4181
46 Ga0070665_100252599 3300005548 Bacteria 1764
47 Ga0070665_100263813 3300005548 Bacteria 1724
48 Ga0068855_100177547 3300005563 Bacteria 2409
49 Ga0068857_100055786 3300005577 Bacteria 3506
50 Ga0068856_100056091 3300005614 Bacteria 3888
51 Ga0068852_100012893 3300005616 Bacteria 6372
52 Ga0068863_100003967 3300005841 Bacteria 14616
53 Ga0068860_100000536 3300005843 Bacteria 46390
54 Ga0081540_1044057 3300005983 Bacteria 2281
55 Ga0081539_10014851 3300005985 Bacteria 5719
56 Ga0075365_10009599 3300006038 Bacteria 5578
57 Ga0075365_10045943 3300006038 Bacteria 2867
58 Ga0075365_10050738 3300006038 Bacteria 2738
59 Ga0075365_10068347 3300006038 Bacteria 2387
60 Ga0075364_10015730 3300006051 Bacteria 4696
61 Ga0075362_10000827 3300006177 Bacteria 9277
62 Ga0075362_10083742 3300006177 Bacteria 1473
63 Ga0075367_10029837 3300006178 Bacteria 3123
64 Ga0075369_10014686 3300006186 Bacteria 3133
65 Ga0075370_10078247 3300006353 Bacteria 1898
66 Ga0075370_10125501 3300006353 Bacteria 1496
67 Ga0075370_10136056 3300006353 Bacteria 1435
68 Ga0075431_100120013 3300006847 Bacteria 2713
69 Ga0075433_10243613 3300006852 Bacteria 1596
70 Ga0079104_1003039 3300006946 Bacteria 8217
71 Ga0105240_10030016 3300009093 Bacteria 7073
72 Ga0105240_10298350 3300009093 Bacteria 1844
73 Ga0105240_10505318 3300009093 Bacteria 1343
74 Ga0111539_10003929 3300009094 Bacteria 19536
75 Ga0114129_10436623 3300009147 Bacteria 1719
76 Ga0105243_10199012 3300009148 Bacteria 1756
77 Ga0105237_10018220 3300009545 Bacteria 7265
78 Ga0105237_10090603 3300009545 Bacteria 3047
79 Ga0105237_10102563 3300009545 Bacteria 2853
80 Ga0105237_10134938 3300009545 Bacteria 2463
81 Ga0105238_10057544 3300009551 Bacteria 3898
82 Ga0105238_10060557 3300009551 Unclassified 3790
83 Ga0105238_10106048 3300009551 Bacteria 2792
84 Ga0105249_10024598 3300009553 Bacteria 5413
85 Ga0105249_10505640 3300009553 Bacteria 1254
86 Ga0105239_10032071 3300010375 Bacteria 5773
87 Ga0105239_10066557 3300010375 Bacteria 3958
88 Ga0105239_10168146 3300010375 Bacteria 2452
89 Ga0105239_10169798 3300010375 Bacteria 2439
90 Ga0105239_10262379 3300010375 Bacteria 1942
91 Ga0105239_10268061 3300010375 Bacteria 1920
92 Ga0157373_10016893 3300013100 Bacteria 5321
93 Ga0157370_10310244 3300013104 Bacteria 1456
94 Ga0157370_10342278 3300013104 Bacteria 1378
95 Ga0157369_10069256 3300013105 Bacteria 3791
96 Ga0182008_10022730 3300014497 Bacteria 3210
97 Ga0183365_10003 3300015684 Bacteria 414944
98 Ga0213875_10037067 3300021388 Bacteria 2298
99 Ga0228711_1005574 3300022739 Bacteria 19128
100 Ga0228710_1006649 3300022740 Bacteria 17425
101 Ga0207425_1000186 3300025245 Bacteria 50590
102 Ga0209148_1000093 3300025254 Bacteria 245339
103 Ga0209148_1000233 3300025254 Bacteria 90861
104 Ga0209129_1000165 3300025258 Bacteria 98917
105 Ga0209233_1000010 3300025261 Bacteria 1194329
106 Ga0209233_1000360 3300025261 Bacteria 41483
107 Ga0209455_1000045 3300025272 Bacteria 383329
108 Ga0209455_1000062 3300025272 Bacteria 335169
109 Ga0209130_1000219 3300025284 Bacteria 74906
110 Ga0209130_1023663 3300025284 Bacteria 1351
111 Ga0209676_1000087 3300025292 Bacteria 263734
112 Ga0209676_1000136 3300025292 Bacteria 181860
113 Ga0209025_1000079 3300025294 Bacteria 270973
114 Ga0209025_1000362 3300025294 Bacteria 96826
115 Ga0209758_1000571 3300025297 Bacteria 57774
116 Ga0209758_1000685 3300025297 Bacteria 50499
117 Ga0209758_1031423 3300025297 Bacteria 2178
118 Ga0209050_1000083 3300025298 Bacteria 263734
119 Ga0209050_1000238 3300025298 Bacteria 119729
120 Ga0209050_1002036 3300025298 Bacteria 18705
121 Ga0209050_1026621 3300025298 Bacteria 1929
122 Ga0207426_1000075 3300025302 Bacteria 321337
123 Ga0209051_1001350 3300025303 Bacteria 21289
124 Ga0209257_1000142 3300025304 Bacteria 200756
125 Ga0209257_1002211 3300025304 Bacteria 20060
126 Ga0209257_1002452 3300025304 Bacteria 18413
127 Ga0209257_1004870 3300025304 Bacteria 9916
128 Ga0207647_10009585 3300025904 Bacteria 6874
129 Ga0207645_10010175 3300025907 Bacteria 6465
130 Ga0207695_10015090 3300025913 Bacteria 9113
131 Ga0207695_10021793 3300025913 Bacteria 7299
132 Ga0207695_10102617 3300025913 Bacteria 2853
133 Ga0207695_10171049 3300025913 Bacteria 2098
134 Ga0207695_10223822 3300025913 Bacteria 1788
135 Ga0207695_10329681 3300025913 Bacteria 1415
136 Ga0207671_10138726 3300025914 Bacteria 1872
137 Ga0207671_10164099 3300025914 Bacteria 1721
138 Ga0207657_10014102 3300025919 Bacteria 7820
139 Ga0207657_10021558 3300025919 Bacteria 6059
140 Ga0207657_10064189 3300025919 Bacteria 3135
141 Ga0207657_10093082 3300025919 Bacteria 2511
142 Ga0207694_10040103 3300025924 Bacteria 3604
143 Ga0207694_10283204 3300025924 Bacteria 1362
144 Ga0207690_10096719 3300025932 Bacteria 2100
145 Ga0207690_10135660 3300025932 Bacteria 1806
146 Ga0207706_10106672 3300025933 Bacteria 2465
147 Ga0207669_10037798 3300025937 Bacteria 2774
148 Ga0207669_10038725 3300025937 Bacteria 2748
149 Ga0207667_10002994 3300025949 Bacteria 20985
150 Ga0207667_10410682 3300025949 Bacteria 1378
151 Ga0207651_10050045 3300025960 Bacteria 2835
152 Ga0207712_10024320 3300025961 Bacteria 4009
153 Ga0207658_10043261 3300025986 Bacteria 3273
154 Ga0207639_10000275 3300026041 Bacteria 36969
155 Ga0207639_10060218 3300026041 Bacteria 2929
156 Ga0207639_10092331 3300026041 Bacteria 2426
157 Ga0207639_10123185 3300026041 Bacteria 2134
158 Ga0207702_10268897 3300026078 Bacteria 1607
159 Ga0207641_10000785 3300026088 Bacteria 33910
160 Ga0207648_10148350 3300026089 Bacteria 2069
161 Ga0207674_10019756 3300026116 Bacteria 7291
162 Ga0207674_10056185 3300026116 Bacteria 3998
163 Ga0209281_1001012 3300027111 Bacteria 21997
164 Ga0209281_1001545 3300027111 Bacteria 12743
165 Ga0209371_1010501 3300027312 Bacteria 2840
166 Ga0209282_1000296 3300027666 Bacteria 24574
167 Ga0207428_10000133 3300027907 Bacteria 100902
168 Ga0268266_10002386 3300028379 Bacteria 20296
169 Ga0268266_10199804 3300028379 Bacteria 1829
170 Ga0268266_10308253 3300028379 Bacteria 1479
171 Ga0268265_10029014 3300028380 Bacteria 3967
172 Ga0268264_10000521 3300028381 Bacteria 48744
173 Ga0307515_10001908 3300028794 Bacteria 46296
174 Ga0307515_10211048 3300028794 Bacteria 1786
175 Ga0268256_1012697 3300030500 Bacteria 2590
176 Ga0307513_10128843 3300031456 Bacteria 2480
177 Ga0307509_10000038 3300031507 Bacteria 188458
178 Ga0307508_10000005 3300031616 Bacteria 286511
179 Ga0307406_10066733 3300031901 Bacteria 2343
180 Ga0307412_10000118 3300031911 Bacteria 60701
181 Ga0307412_10025426 3300031911 Bacteria 3668
182 Ga0315914_1001884 3300031967 Bacteria 31965
183 Ga0307414_10157101 3300032004 Bacteria 1802
184 Ga0307510_10000008 3300033180 Bacteria 433990
185 Ga0307510_10090583 3300033180 Bacteria 2904
186 Ga0315913_1000879 3300033430 Bacteria 30055
187 Ga0315915_1000436 3300033464 Bacteria 42125
188 Ga0373936_0000983 3300035113 Bacteria 10166
189 Ga0373931_0033614 3300035691 Bacteria 2659
190 Ga0395900_0367844 3300037418 Bacteria 1408
191 Ga0395898_0334961 3300037466 Bacteria 1443
192 Ga0395905_0001090 3300037471 Bacteria 34130
193 Ga0395905_0004612 3300037471 Bacteria 14261
194 Ga0436364_0091943 3300037853 Unclassified 3521
195 Ga0436364_0168878 3300037853 Bacteria 3152
196 Ga0436364_0773657 3300037853 Bacteria 23513
197 Ga0395901_0086481 3300038443 Bacteria 3278
198 Ga0436365_0099515 3300039437 Bacteria 4266
199 Ga0436365_0178914 3300039437 Bacteria 2569
200 Ga0436365_1579648 3300039437 Bacteria 4724
201 Ga0436360_0635651 3300039438 Bacteria 1626
202 Ga0436360_1340661 3300039438 Bacteria 5975
203 Ga0436361_0055035 3300039447 Bacteria 1511
204 Ga0436361_0395993 3300039447 Unclassified 2174
205 Ga0436363_1040280 3300039450 Bacteria 5278
206 Ga0436363_1282319 3300039450 Bacteria 13443
207 Ga0436362_0831552 3300039453 Bacteria 2344
208 Ga0439439_0006481 3300041406 Bacteria 2708
209 Ga0439465_0015086 3300041413 Bacteria 2411
210 Ga0439445_0013580 3300042004 Bacteria 1972
211 Ga0439449_0038179 3300042007 Bacteria 1786
212 Ga0439449_0074899 3300042007 Bacteria 1247
213 Ga0439462_0011741 3300042015 Bacteria 2234
214 Ga0439440_0031792 3300042993 Bacteria 1250
215 Ga0466966_0036760 3300044684 Bacteria 3161
216 Ga0466959_0018824 3300045049 Bacteria 5073
217 Ga0451576_0016714 3300045051 Bacteria 8092
218 Ga0495627_001789 3300046453 Bacteria 11489
219 Ga0495638_0003619 3300046460 Bacteria 12076
220 Ga0495638_0014437 3300046460 Bacteria 5337
221 Ga0495638_0023603 3300046460 Bacteria 4020
222 Ga0495650_0000091 3300046471 Bacteria 228697
223 Ga0495650_0000877 3300046471 Bacteria 35686
224 Ga0495585_0084659 3300046492 Bacteria 1715
225 Ga0495596_0000084 3300046500 Bacteria 65040
226 Ga0495596_0001192 3300046500 Bacteria 15197
227 Ga0495607_0029049 3300046501 Bacteria 3406
228 Ga0495583_0000364 3300046506 Bacteria 70975
229 Ga0495583_0069486 3300046506 Bacteria 1551
230 Ga0495610_0000019 3300046512 Bacteria 351524
231 Ga0495610_0003229 3300046512 Bacteria 12890
232 Ga0495610_0015471 3300046512 Bacteria 4431
233 Ga0495610_0020194 3300046512 Bacteria 3705
234 Ga0495616_0000674 3300046513 Bacteria 25275
235 Ga0495620_0036378 3300046515 Bacteria 2203
236 Ga0495632_0000001 3300046519 Bacteria 873295
237 Ga0495632_0000844 3300046519 Bacteria 27026
238 Ga0495632_0001919 3300046519 Bacteria 16618
239 Ga0495632_0028806 3300046519 Bacteria 2897
240 Ga0495637_0000183 3300046520 Bacteria 48717
241 Ga0495637_0033281 3300046520 Bacteria 2265
242 Ga0495643_0000006 3300046522 Bacteria 419524
243 Ga0495643_0008714 3300046522 Bacteria 6398
244 Ga0495643_0014491 3300046522 Bacteria 4689
245 Ga0495648_0000075 3300046524 Bacteria 129579
246 Ga0495648_0074928 3300046524 Bacteria 1948
247 Ga0495663_0000001 3300046525 Bacteria 595264
248 Ga0495633_0000360 3300046558 Bacteria 49094
249 Ga0495633_0000520 3300046558 Bacteria 38484
250 Ga0495633_0001343 3300046558 Bacteria 19279
251 Ga0495668_0000014 3300046616 Bacteria 442055
252 Ga0495668_0053107 3300046616 Bacteria 2241
253 Ga0495625_0049224 3300046660 Bacteria 3031
254 Ga0495625_0116341 3300046660 Bacteria 1824
255 Ga0495670_0000048 3300046691 Bacteria 64848
256 Ga0495671_0000008 3300046692 Bacteria 419524
257 Ga0495671_0064458 3300046692 Bacteria 1804
258 Ga0495671_0083752 3300046692 Bacteria 1563
259 Ga0495649_0055429 3300046694 Bacteria 2142
260 Ga0495600_0002601 3300046809 Bacteria 10403
261 Ga0495660_0002388 3300046810 Bacteria 11984
262 Ga0495673_0000139 3300047469 Bacteria 130652
263 Ga0495673_0005213 3300047469 Bacteria 7904
264 Ga0495681_0000061 3300047470 Bacteria 99933
265 Ga0495681_0002763 3300047470 Bacteria 12418
266 Ga0495681_0056167 3300047470 Bacteria 1833
267 Ga0495686_0030357 3300047472 Bacteria 3511
268 Ga0495615_0000200 3300048090 Bacteria 14054
269 Ga0495626_0002915 3300048091 Bacteria 11397
270 Ga0496101_0017056 3300048904 Bacteria 4917
271 Ga0496107_0106353 3300048910 Bacteria 2061
272 Ga0496111_0198657 3300048914 Bacteria 1491
273 Ga0496112_0013656 3300048915 Bacteria 7504
274 Ga0496119_0026237 3300048922 Bacteria 4044
275 Ga0496119_0076016 3300048922 Bacteria 1949
276 Ga0496119_0125847 3300048922 Bacteria 1402
277 Ga0496120_0002324 3300048923 Bacteria 19584
278 Ga0496120_0040566 3300048923 Bacteria 2734
279 Ga0496121_0000094 3300048924 Bacteria 212726
280 Ga0496121_0012904 3300048924 Bacteria 9034
281 Ga0496122_0000115 3300048925 Bacteria 183402
282 Ga0496122_0004130 3300048925 Bacteria 18363
283 Ga0496122_0057726 3300048925 Bacteria 2879
284 Ga0496122_0132659 3300048925 Unclassified 1578
285 Ga0496123_0000129 3300048926 Bacteria 153816
286 Ga0496123_0002858 3300048926 Bacteria 20366
287 Ga0496123_0056970 3300048926 Bacteria 2548
288 Ga0496123_0079771 3300048926 Bacteria 1998
289 Ga0496124_0012214 3300048927 Bacteria 8496
290 Ga0496124_0021606 3300048927 Bacteria 5927
291 Ga0496125_0002647 3300048928 Bacteria 22880
292 Ga0496125_0007911 3300048928 Bacteria 11225
293 Ga0496125_0015143 3300048928 Bacteria 7473
294 Ga0496126_0010902 3300048929 Bacteria 9470
295 Ga0496126_0026380 3300048929 Bacteria 5572
296 Ga0496126_0094488 3300048929 Bacteria 2624
297 Ga0496126_0110266 3300048929 Bacteria 2397
298 Ga0501031_0002443 3300049568 Bacteria 11833
299 Ga0501031_0038003 3300049568 Bacteria 3142
300 Ga0501032_0035380 3300049569 Bacteria 3414
301 Ga0501033_0017682 3300049570 Bacteria 5384
302 Ga0501033_0076581 3300049570 Bacteria 2455
303 Ga0501034_0004086 3300049571 Bacteria 16376
304 Ga0501034_0029840 3300049571 Bacteria 5542
305 Ga0501034_0124419 3300049571 Bacteria 2564
306 Ga0501034_0156354 3300049571 Bacteria 2253
307 Ga0501036_0015674 3300049572 Bacteria 6330
308 Ga0501037_0012823 3300049573 Bacteria 6176
309 Ga0501037_0042342 3300049573 Bacteria 3346
310 Ga0501038_0037600 3300049574 Bacteria 4243
311 Ga0501039_0004012 3300049575 Bacteria 11065
312 Ga0501039_0026233 3300049575 Bacteria 4479
313 Ga0501039_0091864 3300049575 Bacteria 2366
314 Ga0501040_0127345 3300049576 Unclassified 1789
315 Ga0501043_0061273 3300049579 Bacteria 2954
316 Ga0501046_0001581 3300049580 Bacteria 21776
317 Ga0501047_0085817 3300049581 Bacteria 3024
318 Ga0501047_0250989 3300049581 Bacteria 1618
319 Ga0501048_0026574 3300049582 Bacteria 4214
320 Ga0501048_0075095 3300049582 Bacteria 2385
321 Ga0501068_0100457 3300049584 Bacteria 1793
322 Ga0501070_0161319 3300049586 Bacteria 1848
323 Ga0501071_0096645 3300049587 Bacteria 2174
324 Ga0501072_0006671 3300049588 Bacteria 8782
325 Ga0501072_0055606 3300049588 Bacteria 3119
326 Ga0501073_0001496 3300049589 Bacteria 17294
327 Ga0501074_0150502 3300049590 Unclassified 1664
328 Ga0501075_0042878 3300049591 Bacteria 3393
329 Ga0501075_0065485 3300049591 Bacteria 2742
330 Ga0501076_0063246 3300049592 Bacteria 2948
331 Ga0501080_0153565 3300049742 Bacteria 2127
332 Ga0501081_0027552 3300049743 Unclassified 3832
333 Ga0501083_0024864 3300049744 Bacteria 4148
334 Ga0501035_0145759 3300049822 Bacteria 2056
335 Ga0501044_0021574 3300049823 Bacteria 6867
336 Ga0501045_0006764 3300049824 Bacteria 7940
337 Ga0501045_0011646 3300049824 Bacteria 6176
338 nmdc:mga03683_86347_c1 3300050489 Bacteria 1362
339 nmdc:mga00v17_22373_c1 3300050491 Bacteria 3647
340 nmdc:mga0yw44_68203_c1 3300050492 Bacteria 2200
341 nmdc:mga0yw44_72338_c1 3300050492 Bacteria 2143
342 nmdc:mga0yw44_88411_c1 3300050492 Bacteria 1954
343 nmdc:mga07m45_92526_c1 3300050496 Bacteria 1733
344 nmdc:mga08y16_211_c1 3300050511 Bacteria 52298
345 nmdc:mga0a205_323075_c1 3300050515 Bacteria 1414
346 nmdc:mga0sz30_1726_c1 3300050516 Bacteria 6568
347 nmdc:mga0sz30_38958_c1 3300050516 Bacteria 1993
348 Ga0500610_0035513 3300053079 Bacteria 2557
349 Ga0500635_0000919 3300053080 Bacteria 7129
350 Ga0500643_003610 3300053087 Bacteria 7348
351 Ga0500644_0000005 3300053088 Bacteria 164966
352 Ga0500644_0001691 3300053088 Bacteria 5752
353 Ga0500595_000582 3300053119 Bacteria 21779
354 Ga0500595_005969 3300053119 Bacteria 5242
355 Ga0500608_000049 3300053122 Bacteria 54754
356 Ga0500608_000141 3300053122 Bacteria 29668
357 Ga0500608_008028 3300053122 Bacteria 4409
358 Ga0500608_131992 3300053122 Bacteria 1119
359 Ga0500658_0004568 3300053134 Bacteria 5162
360 Ga0500658_0017990 3300053134 Bacteria 2645
361 Ga0500559_0001602 3300053136 Bacteria 12594
362 Ga0500559_0024650 3300053136 Bacteria 2560
363 Ga0500564_000013 3300053138 Bacteria 54100
364 Ga0500568_0000361 3300053139 Bacteria 35246
365 Ga0500568_0019618 3300053139 Bacteria 2935
366 Ga0500577_0001083 3300053142 Bacteria 7006
367 Ga0500577_0011243 3300053142 Bacteria 2664
368 Ga0500616_0008205 3300053153 Bacteria 6517
369 Ga0500622_0000159 3300053156 Bacteria 71047
370 Ga0500622_0001692 3300053156 Bacteria 17162
371 Ga0500622_0004230 3300053156 Bacteria 9143
372 Ga0500622_0010351 3300053156 Bacteria 5123
373 Ga0500627_0086678 3300053158 Bacteria 1399
374 Ga0500636_0001131 3300053177 Bacteria 14293
375 Ga0500609_003179 3300053731 Bacteria 2321
376 Ga0501084_0223568 3300054114 Bacteria 1589
377 Ga0501082_0106962 3300060353 Bacteria 2420

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2906427513 2906429331 323
2 3300042993 Ga0439440_0031792 Ga0439440_0031792_220_1233 325
3 3300053122 Ga0500608_131992 Ga0500608_131992_34_1032 327
4 iso_pu_bacteria 2874109183 2874114069 335
5 3300037466 Ga0395898_0334961 Ga0395898_0334961_27_1151 342
6 iso_pu_bacteria 2876369609 2876374267 343
7 3300048914 Ga0496111_0198657 Ga0496111_0198657_415_1470 346
8 iso_pu_bacteria 2977957713 2977961560 353
9 3300039437 Ga0436365_0178914 Ga0436365_0178914_1386_2498 358
10 3300046460 Ga0495638_0023603 Ga0495638_0023603_395_1486 358
11 3300049822 Ga0501035_0145759 Ga0501035_0145759_951_2042 358
12 3300048926 Ga0496123_0079771 Ga0496123_0079771_29_1123 359
13 3300038443 Ga0395901_0086481 Ga0395901_0086481_437_1618 361
14 3300005544 Ga0070686_100129796 Ga0070686_1001297961 363
15 3300039450 Ga0436363_1282319 Ga0436363_1282319_576_1697 364
16 3300037853 Ga0436364_0091943 Ga0436364_0091943_1487_2611 365
17 3300039450 Ga0436363_1040280 Ga0436363_1040280_921_2045 365
18 iso_pu_bacteria 2643221595 2643986891 365
19 iso_pu_bacteria 2643221627 2644156266 365
20 3300047472 Ga0495686_0030357 Ga0495686_0030357_548_1729 366
21 3300049575 Ga0501039_0091864 Ga0501039_0091864_707_1888 366
22 3300049576 Ga0501040_0127345 Ga0501040_0127345_291_1472 366
23 3300049587 Ga0501071_0096645 Ga0501071_0096645_591_1772 366
24 3300049588 Ga0501072_0055606 Ga0501072_0055606_1910_3091 366
25 3300049590 Ga0501074_0150502 Ga0501074_0150502_308_1489 366
26 3300049591 Ga0501075_0065485 Ga0501075_0065485_280_1461 366
27 3300049592 Ga0501076_0063246 Ga0501076_0063246_498_1679 366
28 3300060353 Ga0501082_0106962 Ga0501082_0106962_827_2008 366
29 3300005539 Ga0068853_100001116 Ga0068853_1000011169 368
30 3300026041 Ga0207639_10000275 Ga0207639_1000027526 368
31 3300054114 Ga0501084_0223568 Ga0501084_0223568_116_1306 368
32 3300010375 Ga0105239_10168146 Ga0105239_101681462 369
33 iso_pu_bacteria 2965032056 2965038013 372
34 3300048928 Ga0496125_0002647 Ga0496125_0002647_4961_6109 373
35 3300006847 Ga0075431_100120013 Ga0075431_1001200133 374
36 3300037853 Ga0436364_0773657 Ga0436364_0773657_21853_23001 377
37 iso_pu_bacteria 2738541277 2738721103 377
38 iso_pu_bacteria 2738543019 2739280302 377
39 iso_pu_bacteria 2904541872 2904547639 377
40 iso_pu_bacteria 2929160207 2929167120 377
41 3300049581 Ga0501047_0250989 Ga0501047_0250989_54_1244 378
42 3300001979 JGI24740J21852_10029387 JGI24740J21852_100293872 379
43 3300005563 Ga0068855_100177547 Ga0068855_1001775472 379
44 3300005577 Ga0068857_100055786 Ga0068857_1000557862 379
45 3300006178 Ga0075367_10029837 Ga0075367_100298373 379
46 3300006353 Ga0075370_10136056 Ga0075370_101360561 379
47 3300010375 Ga0105239_10066557 Ga0105239_100665572 379
48 3300046460 Ga0495638_0003619 Ga0495638_0003619_8911_10065 379
49 3300046519 Ga0495632_0001919 Ga0495632_0001919_6129_7283 379
50 3300046558 Ga0495633_0001343 Ga0495633_0001343_560_1714 379
51 3300046616 Ga0495668_0053107 Ga0495668_0053107_1069_2223 379
52 3300047469 Ga0495673_0005213 Ga0495673_0005213_2461_3615 379
53 3300053142 Ga0500577_0001083 Ga0500577_0001083_3636_4790 379
54 3300025297 Ga0209758_1031423 Ga0209758_10314232 380
55 3300025904 Ga0207647_10009585 Ga0207647_100095856 380
56 3300025933 Ga0207706_10106672 Ga0207706_101066723 380
57 3300026041 Ga0207639_10123185 Ga0207639_101231852 380
58 3300026078 Ga0207702_10268897 Ga0207702_102688971 380
59 3300026116 Ga0207674_10056185 Ga0207674_100561854 380
60 3300003187 JGI25151J46595_10002569 JGI25151J46595_100025696 381
61 3300025294 Ga0209025_1000079 Ga0209025_1000079138 381
62 3300032004 Ga0307414_10157101 Ga0307414_101571012 381
63 3300048904 Ga0496101_0017056 Ga0496101_0017056_2306_3478 381
64 iso_pu_bacteria 2937113482 2937117742 381
65 iso_pu_bacteria 2957415311 2957419013 381
66 iso_pu_bacteria 2977523885 2977524756 381
67 3300003794 Ga0055531_10000610 Ga0055531_1000061025 382
68 3300009545 Ga0105237_10102563 Ga0105237_101025632 382
69 3300031616 Ga0307508_10000005 Ga0307508_10000005132 382
70 iso_pu_bacteria 2503198000 2503201440 382
71 iso_pu_bacteria 2512875024 2512959428 382
72 iso_pu_bacteria 2513237164 2514033515 382
73 iso_pu_bacteria 2878730984 2878732259 382
74 3300021388 Ga0213875_10037067 Ga0213875_100370671 383
75 3300025304 Ga0209257_1002211 Ga0209257_100221112 383
76 3300049568 Ga0501031_0038003 Ga0501031_0038003_1515_2696 383
77 3300049575 Ga0501039_0026233 Ga0501039_0026233_2652_3833 383
78 3300049582 Ga0501048_0075095 Ga0501048_0075095_34_1215 383
79 3300049588 Ga0501072_0006671 Ga0501072_0006671_7353_8534 383
80 3300049591 Ga0501075_0042878 Ga0501075_0042878_606_1787 383
81 3300049743 Ga0501081_0027552 Ga0501081_0027552_1896_3077 383
82 3300049824 Ga0501045_0006764 Ga0501045_0006764_2825_4006 383
83 iso_pu_bacteria 2510917021 2511125929 383
84 iso_pu_bacteria 2512875026 2512975369 383
85 iso_pu_bacteria 2513237089 2513605681 383
86 iso_pu_bacteria 2513237160 2514008625 383
87 iso_pu_bacteria 2517487022 2517566976 383
88 iso_pu_bacteria 2524023250 2524613584 383
89 iso_pu_bacteria 2582581280 2585153547 383
90 iso_pu_bacteria 2582581293 2585197351 383
91 iso_pu_bacteria 2599185292 2599904305 383
92 iso_pu_bacteria 2643221552 2643780225 383
93 iso_pu_bacteria 2643221569 2643859461 383
94 iso_pu_bacteria 2643221584 2643928580 383
95 iso_pu_bacteria 2643221594 2643982955 383
96 iso_pu_bacteria 2643221607 2644048077 383
97 iso_pu_bacteria 2643221621 2644123661 383
98 iso_pu_bacteria 2643221629 2644167918 383
99 iso_pu_bacteria 2643221636 2644200333 383
100 iso_pu_bacteria 2643221662 2644348614 383
101 iso_pu_bacteria 2643221686 2644480872 383
102 iso_pu_bacteria 2643221689 2644502037 383
103 iso_pu_bacteria 2738541293 2738805634 383
104 iso_pu_bacteria 2802428858 2802721171 383
105 iso_pu_bacteria 2802428859 2802728385 383
106 iso_pu_bacteria 2802428860 2802733853 383
107 iso_pu_bacteria 2802428861 2802740509 383
108 iso_pu_bacteria 2802428862 2802746792 383
109 iso_pu_bacteria 2802428863 2802753649 383
110 iso_pu_bacteria 2808606395 2809033542 383
111 iso_pu_bacteria 2848297114 2848299267 383
112 iso_pu_bacteria 2857504554 2857506554 383
113 iso_pu_bacteria 2857576091 2857579473 383
114 iso_pu_bacteria 2871466892 2871468554 383
115 iso_pu_bacteria 2883291878 2883293747 383
116 iso_pu_bacteria 2883354860 2883357716 383
117 iso_pu_bacteria 2915980308 2915983422 383
118 iso_pu_bacteria 2916061851 2916066740 383
119 iso_pu_bacteria 2921250672 2921254811 383
120 iso_pu_bacteria 2937029754 2937032181 383
121 iso_pu_bacteria 2937036028 2937039531 383
122 iso_pu_bacteria 2937078374 2937081876 383
123 iso_pu_bacteria 2937084907 2937088359 383
124 iso_pu_bacteria 2939669807 2939671049 383
125 iso_pu_bacteria 2941479691 2941484511 383
126 iso_pu_bacteria 2946787523 2946791320 383
127 iso_pu_bacteria 2957375807 2957380365 383
128 iso_pu_bacteria 2957437181 2957443742 383
129 iso_pu_bacteria 2960591022 2960592990 383
130 iso_pu_bacteria 2960631154 2960633565 383
131 iso_pu_bacteria 2960680706 2960683914 383
132 iso_pu_bacteria 2960693952 2960698490 383
133 iso_pu_bacteria 2967686174 2967691105 383
134 iso_pu_bacteria 2967728569 2967731901 383
135 iso_pu_bacteria 2970026789 2970033155 383
136 iso_pu_bacteria 2970122695 2970127971 383
137 iso_pu_bacteria 2970143518 2970147922 383
138 iso_pu_bacteria 2977530762 2977536542 383
139 iso_pu_bacteria 2977544691 2977550965 383
140 iso_pu_bacteria 2989771324 2989772969 383
141 iso_pu_bacteria 8003999396 8004005551 383
142 iso_pu_bacteria 8054302542 8054302990 383
143 3300046616 Ga0495668_0000014 Ga0495668_0000014_142855_144024 384
144 3300053119 Ga0500595_000582 Ga0500595_000582_15630_16799 384
145 3300053122 Ga0500608_000049 Ga0500608_000049_29561_30730 384
146 3300053136 Ga0500559_0001602 Ga0500559_0001602_4101_5270 384
147 3300053156 Ga0500622_0004230 Ga0500622_0004230_2002_3171 384
148 iso_pu_bacteria 2508501123 2509113038 384
149 iso_pu_bacteria 2508501127 2509143976 384
150 iso_pu_bacteria 2509276018 2509367922 384
151 iso_pu_bacteria 2509276022 2509396212 384
152 iso_pu_bacteria 2510065057 2510304792 384
153 iso_pu_bacteria 2510065059 2510315604 384
154 iso_pu_bacteria 2513237090 2513611379 384
155 iso_pu_bacteria 2513237091 2513616010 384
156 iso_pu_bacteria 2513237351 2514588019 384
157 iso_pu_bacteria 2515154107 2515610121 384
158 iso_pu_bacteria 2516653046 2516898074 384
159 iso_pu_bacteria 2551306091 2551725806 384
160 iso_pu_bacteria 2597489875 2597813313 384
161 iso_pu_bacteria 2599185301 2599936836 384
162 iso_pu_bacteria 2687453392 2688598349 384
163 iso_pu_bacteria 2693429783 2694630990 384
164 iso_pu_bacteria 2693429784 2694636512 384
165 iso_pu_bacteria 2751185800 2753357084 384
166 iso_pu_bacteria 2756170246 2756672506 384
167 iso_pu_bacteria 2758568016 2758639370 384
168 iso_pu_bacteria 2818991435 2819536673 384
169 iso_pu_bacteria 2818991454 2819645834 384
170 iso_pu_bacteria 2837651117 2837654040 384
171 iso_pu_bacteria 2841734538 2841739106 384
172 iso_pu_bacteria 2844002411 2844007532 384
173 iso_pu_bacteria 2844009547 2844013602 384
174 iso_pu_bacteria 2852387548 2852395195 384
175 iso_pu_bacteria 2856320880 2856327578 384
176 iso_pu_bacteria 2856328259 2856334467 384
177 iso_pu_bacteria 2856334872 2856338925 384
178 iso_pu_bacteria 2856342000 2856343931 384
179 iso_pu_bacteria 2857367948 2857370893 384
180 iso_pu_bacteria 2869169390 2869169872 384
181 iso_pu_bacteria 2869234852 2869236884 384
182 iso_pu_bacteria 2869242130 2869248450 384
183 iso_pu_bacteria 2869249662 2869255578 384
184 iso_pu_bacteria 2869256925 2869257876 384
185 iso_pu_bacteria 2869264136 2869268032 384
186 iso_pu_bacteria 2869271264 2869276905 384
187 iso_pu_bacteria 2869278585 2869280467 384
188 iso_pu_bacteria 2871435913 2871436414 384
189 iso_pu_bacteria 2871451962 2871452570 384
190 iso_pu_bacteria 2871474448 2871475912 384
191 iso_pu_bacteria 2871481445 2871485560 384
192 iso_pu_bacteria 2874116593 2874119566 384
193 iso_pu_bacteria 2874123672 2874130518 384
194 iso_pu_bacteria 2874131515 2874135255 384
195 iso_pu_bacteria 2874139085 2874144121 384
196 iso_pu_bacteria 2874162495 2874163626 384
197 iso_pu_bacteria 2874168670 2874169759 384
198 iso_pu_bacteria 2876377896 2876378460 384
199 iso_pu_bacteria 2876386047 2876391862 384
200 iso_pu_bacteria 2876399893 2876403631 384
201 iso_pu_bacteria 2876420981 2876425544 384
202 iso_pu_bacteria 2878738818 2878745116 384
203 iso_pu_bacteria 2878774303 2878776298 384
204 iso_pu_bacteria 2878781027 2878782095 384
205 iso_pu_bacteria 2878788777 2878795710 384
206 iso_pu_bacteria 2881147464 2881151238 384
207 iso_pu_bacteria 2885312484 2885318067 384
208 iso_pu_bacteria 2888337043 2888339330 384
209 iso_pu_bacteria 2888343758 2888346714 384
210 iso_pu_bacteria 2889790730 2889792421 384
211 iso_pu_bacteria 2894817345 2894818262 384
212 iso_pu_bacteria 2903513507 2903515866 384
213 iso_pu_bacteria 2906363423 2906363648 384
214 iso_pu_bacteria 2906370794 2906372428 384
215 iso_pu_bacteria 2906378014 2906383774 384
216 iso_pu_bacteria 2906386501 2906390544 384
217 iso_pu_bacteria 2906393657 2906397042 384
218 iso_pu_bacteria 2906401398 2906403056 384
219 iso_pu_bacteria 2906408224 2906413778 384
220 iso_pu_bacteria 2909042592 2909046135 384
221 iso_pu_bacteria 2915650412 2915654432 384
222 iso_pu_bacteria 2916021584 2916025631 384
223 iso_pu_bacteria 2916041962 2916043203 384
224 iso_pu_bacteria 2916048683 2916049386 384
225 iso_pu_bacteria 2916076590 2916076607 384
226 iso_pu_bacteria 2921257292 2921259667 384
227 iso_pu_bacteria 2922151315 2922157818 384
228 iso_pu_bacteria 2922172374 2922175331 384
229 iso_pu_bacteria 2922178524 2922185501 384
230 iso_pu_bacteria 2924710171 2924715510 384
231 iso_pu_bacteria 2924733363 2924735839 384
232 iso_pu_bacteria 2924748358 2924749379 384
233 iso_pu_bacteria 2924754689 2924762585 384
234 iso_pu_bacteria 2924762789 2924768284 384
235 iso_pu_bacteria 2924776078 2924783253 384
236 iso_pu_bacteria 2936996657 2936999495 384
237 iso_pu_bacteria 2937009748 2937012315 384
238 iso_pu_bacteria 2937023124 2937026253 384
239 iso_pu_bacteria 2937836603 2937843150 384
240 iso_pu_bacteria 2937848649 2937853458 384
241 iso_pu_bacteria 2937861824 2937861832 384
242 iso_pu_bacteria 2937868953 2937872855 384
243 iso_pu_bacteria 2937877337 2937882220 384
244 iso_pu_bacteria 2937972304 2937978681 384
245 iso_pu_bacteria 2937980651 2937987371 384
246 iso_pu_bacteria 2938014810 2938016116 384
247 iso_pu_bacteria 2957382221 2957384050 384
248 iso_pu_bacteria 2957395598 2957399670 384
249 iso_pu_bacteria 2957402308 2957405391 384
250 iso_pu_bacteria 2957408893 2957412748 384
251 iso_pu_bacteria 2957450854 2957454141 384
252 iso_pu_bacteria 2958034702 2958036338 384
253 iso_pu_bacteria 2958041894 2958045701 384
254 iso_pu_bacteria 2958071322 2958072031 384
255 iso_pu_bacteria 2958084443 2958089342 384
256 iso_pu_bacteria 2958122699 2958123730 384
257 iso_pu_bacteria 2958137437 2958139208 384
258 iso_pu_bacteria 2958144490 2958149471 384
259 iso_pu_bacteria 2958158011 2958165011 384
260 iso_pu_bacteria 2960610863 2960611539 384
261 iso_pu_bacteria 2960687367 2960691278 384
262 iso_pu_bacteria 2961136820 2961142840 384
263 iso_pu_bacteria 2961183825 2961185158 384
264 iso_pu_bacteria 2964615318 2964617694 384
265 iso_pu_bacteria 2964636051 2964638702 384
266 iso_pu_bacteria 2964698721 2964701116 384
267 iso_pu_bacteria 2965025482 2965031852 384
268 iso_pu_bacteria 2965047637 2965053889 384
269 iso_pu_bacteria 2965089291 2965095036 384
270 iso_pu_bacteria 2965102966 2965107295 384
271 iso_pu_bacteria 2965110997 2965118920 384
272 iso_pu_bacteria 2967755722 2967756845 384
273 iso_pu_bacteria 2968016561 2968018548 384
274 iso_pu_bacteria 2970102677 2970106305 384
275 iso_pu_bacteria 2970177841 2970183549 384
276 iso_pu_bacteria 2970469710 2970471279 384
277 iso_pu_bacteria 2970489779 2970492979 384
278 iso_pu_bacteria 2970510686 2970516363 384
279 iso_pu_bacteria 2970524798 2970528498 384
280 iso_pu_bacteria 2970532167 2970532198 384
281 iso_pu_bacteria 2970540015 2970546823 384
282 iso_pu_bacteria 2970547951 2970548908 384
283 iso_pu_bacteria 2970593180 2970595064 384
284 iso_pu_bacteria 2970619444 2970620287 384
285 iso_pu_bacteria 2970627176 2970627785 384
286 iso_pu_bacteria 2977516862 2977517509 384
287 iso_pu_bacteria 2977565890 2977567782 384
288 iso_pu_bacteria 2977851361 2977851900 384
289 iso_pu_bacteria 2977864932 2977867165 384
290 iso_pu_bacteria 2977872689 2977879784 384
291 iso_pu_bacteria 2977898635 2977903625 384
292 iso_pu_bacteria 2977907340 2977914242 384
293 iso_pu_bacteria 2977915119 2977920270 384
294 iso_pu_bacteria 2977922695 2977924125 384
295 iso_pu_bacteria 2977935797 2977936113 384
296 iso_pu_bacteria 2977950692 2977955451 384
297 iso_pu_bacteria 2979764755 2979766726 384
298 iso_pu_bacteria 2979793036 2979799806 384
299 iso_pu_bacteria 2987645492 2987650704 384
300 iso_pu_bacteria 2987666974 2987671297 384
301 iso_pu_bacteria 2987673487 2987675855 384
302 iso_pu_bacteria 2996310559 2996315015 384
303 iso_pu_bacteria 2996348954 2996350070 384
304 iso_pu_bacteria 2996386984 2996391378 384
305 iso_pu_bacteria 3000135777 3000140765 384
306 iso_pu_bacteria 3004167301 3004168798 384
307 iso_pu_bacteria 3004195979 3004202250 384
308 iso_pu_bacteria 3004211236 3004215860 384
309 iso_pu_bacteria 3004218560 3004220233 384
310 iso_pu_bacteria 3004232784 3004233831 384
311 iso_pu_bacteria 3004239961 3004242859 384
312 iso_pu_bacteria 3004248173 3004255401 384
313 iso_pu_bacteria 3004268573 3004274839 384
314 iso_pu_bacteria 3004275668 3004276769 384
315 iso_pu_bacteria 3004289098 3004295663 384
316 iso_pu_bacteria 3004334049 3004334461 384
317 iso_pu_bacteria 648276728 648736256 384
318 iso_pu_bacteria 649633066 649872879 384
319 iso_pu_bacteria 8003992118 8003998616 384
320 iso_pu_bacteria 8004300914 8004303864 384
321 iso_pu_bacteria 8004312739 8004319587 384
322 iso_pu_bacteria 8004361976 8004367310 384
323 iso_pu_bacteria 8004395343 8004402331 384
324 iso_pu_bacteria 8004633249 8004637807 384
325 iso_pu_bacteria 8004640170 8004640916 384
326 iso_pu_bacteria 8004695233 8004701311 384
327 iso_pu_bacteria 8004727605 8004732808 384
328 iso_pu_bacteria 8024486573 8024487315 384
329 iso_pu_bacteria 8055617313 8055620687 384
330 iso_pu_bacteria 8057575449 8057576468 384
331 3300009545 Ga0105237_10090603 Ga0105237_100906032 385
332 3300025914 Ga0207671_10164099 Ga0207671_101640992 385
333 3300037853 Ga0436364_0168878 Ga0436364_0168878_955_2145 385
334 3300039437 Ga0436365_0099515 Ga0436365_0099515_1211_2401 385
335 3300042007 Ga0439449_0074899 Ga0439449_0074899_55_1227 385
336 3300003316 rootH1_10131482 rootH1_101314822 386
337 3300003322 rootL2_10079358 rootL2_100793582 386
338 3300005539 Ga0068853_100120794 Ga0068853_1001207942 386
339 3300006051 Ga0075364_10015730 Ga0075364_100157303 386
340 3300009093 Ga0105240_10505318 Ga0105240_105053182 386
341 3300010375 Ga0105239_10169798 Ga0105239_101697982 386
342 3300013104 Ga0157370_10310244 Ga0157370_103102441 386
343 3300014497 Ga0182008_10022730 Ga0182008_100227302 386
344 3300015684 Ga0183365_10003 Ga0183365_10003151 386
345 3300025913 Ga0207695_10329681 Ga0207695_103296812 386
346 3300026041 Ga0207639_10092331 Ga0207639_100923312 386
347 3300044684 Ga0466966_0036760 Ga0466966_0036760_1542_2819 386
348 3300045049 Ga0466959_0018824 Ga0466959_0018824_74_1351 386
349 3300048915 Ga0496112_0013656 Ga0496112_0013656_2740_3915 386
350 3300048922 Ga0496119_0125847 Ga0496119_0125847_159_1334 386
351 3300048923 Ga0496120_0040566 Ga0496120_0040566_18_1193 386
352 3300048929 Ga0496126_0010902 Ga0496126_0010902_1046_2233 386
353 3300048929 Ga0496126_0110266 Ga0496126_0110266_494_1681 386
354 3300049571 Ga0501034_0124419 Ga0501034_0124419_399_1574 386
355 3300050491 nmdc:mga00v17_22373_c1 nmdc:mga00v17_22373_c1_1765_2967 386
356 3300053080 Ga0500635_0000919 Ga0500635_0000919_1045_2220 386
357 3300053122 Ga0500608_000141 Ga0500608_000141_14466_15641 386
358 3300002773 JGI25152J39213_1000133 JGI25152J39213_100013320 387
359 3300002774 JGI25150J39212_1000097 JGI25150J39212_100009720 387
360 3300003187 JGI25151J46595_10000334 JGI25151J46595_1000033420 387
361 3300003215 JGI25153J46596_10000583 JGI25153J46596_100005838 387
362 3300003215 JGI25153J46596_10028517 JGI25153J46596_100285171 387
363 3300003322 rootL2_10283227 rootL2_102832271 387
364 3300003781 Ga0055536_1000224 Ga0055536_100022431 387
365 3300003781 Ga0055536_1000722 Ga0055536_100072222 387
366 3300003791 Ga0055530_10001038 Ga0055530_100010385 387
367 3300003791 Ga0055530_10009730 Ga0055530_100097303 387
368 3300003791 Ga0055530_10017859 Ga0055530_100178592 387
369 3300003794 Ga0055531_10001285 Ga0055531_1000128513 387
370 3300003794 Ga0055531_10001590 Ga0055531_100015903 387
371 3300005546 Ga0070696_100152024 Ga0070696_1001520241 387
372 3300005983 Ga0081540_1044057 Ga0081540_10440572 387
373 3300005985 Ga0081539_10014851 Ga0081539_100148512 387
374 3300006353 Ga0075370_10125501 Ga0075370_101255012 387
375 3300006852 Ga0075433_10243613 Ga0075433_102436132 387
376 3300009093 Ga0105240_10298350 Ga0105240_102983502 387
377 3300009094 Ga0111539_10003929 Ga0111539_1000392913 387
378 3300009147 Ga0114129_10436623 Ga0114129_104366232 387
379 3300009545 Ga0105237_10134938 Ga0105237_101349382 387
380 3300009551 Ga0105238_10106048 Ga0105238_101060482 387
381 3300022739 Ga0228711_1005574 Ga0228711_100557415 387
382 3300022740 Ga0228710_1006649 Ga0228710_100664915 387
383 3300025245 Ga0207425_1000186 Ga0207425_100018620 387
384 3300025258 Ga0209129_1000165 Ga0209129_100016533 387
385 3300025284 Ga0209130_1023663 Ga0209130_10236631 387
386 3300025292 Ga0209676_1000087 Ga0209676_100008770 387
387 3300025292 Ga0209676_1000136 Ga0209676_100013690 387
388 3300025294 Ga0209025_1000362 Ga0209025_100036265 387
389 3300025297 Ga0209758_1000571 Ga0209758_100057131 387
390 3300025297 Ga0209758_1000685 Ga0209758_100068520 387
391 3300025298 Ga0209050_1000083 Ga0209050_100008370 387
392 3300025298 Ga0209050_1000238 Ga0209050_100023859 387
393 3300025298 Ga0209050_1002036 Ga0209050_100203613 387
394 3300025298 Ga0209050_1026621 Ga0209050_10266212 387
395 3300025303 Ga0209051_1001350 Ga0209051_100135012 387
396 3300025304 Ga0209257_1000142 Ga0209257_100014290 387
397 3300025304 Ga0209257_1002452 Ga0209257_10024526 387
398 3300025913 Ga0207695_10015090 Ga0207695_100150902 387
399 3300025913 Ga0207695_10102617 Ga0207695_101026172 387
400 3300025914 Ga0207671_10138726 Ga0207671_101387262 387
401 3300025919 Ga0207657_10093082 Ga0207657_100930823 387
402 3300027111 Ga0209281_1001012 Ga0209281_100101220 387
403 3300027312 Ga0209371_1010501 Ga0209371_10105011 387
404 3300027666 Ga0209282_1000296 Ga0209282_100029610 387
405 3300027907 Ga0207428_10000133 Ga0207428_1000013391 387
406 3300028794 Ga0307515_10001908 Ga0307515_1000190815 387
407 3300028794 Ga0307515_10211048 Ga0307515_102110482 387
408 3300030500 Ga0268256_1012697 Ga0268256_10126971 387
409 3300031507 Ga0307509_10000038 Ga0307509_1000003841 387
410 3300031901 Ga0307406_10066733 Ga0307406_100667332 387
411 3300031911 Ga0307412_10000118 Ga0307412_1000011811 387
412 3300031911 Ga0307412_10025426 Ga0307412_100254262 387
413 3300031967 Ga0315914_1001884 Ga0315914_10018842 387
414 3300033430 Ga0315913_1000879 Ga0315913_100087927 387
415 3300033464 Ga0315915_1000436 Ga0315915_100043613 387
416 3300037471 Ga0395905_0004612 Ga0395905_0004612_8898_10076 387
417 3300039437 Ga0436365_1579648 Ga0436365_1579648_383_1582 387
418 3300039438 Ga0436360_1340661 Ga0436360_1340661_952_2133 387
419 3300039447 Ga0436361_0055035 Ga0436361_0055035_189_1370 387
420 3300039447 Ga0436361_0395993 Ga0436361_0395993_191_1393 387
421 3300041406 Ga0439439_0006481 Ga0439439_0006481_285_1478 387
422 3300041413 Ga0439465_0015086 Ga0439465_0015086_489_1682 387
423 3300042004 Ga0439445_0013580 Ga0439445_0013580_290_1483 387
424 3300042015 Ga0439462_0011741 Ga0439462_0011741_201_1394 387
425 3300045051 Ga0451576_0016714 Ga0451576_0016714_6030_7217 387
426 3300046453 Ga0495627_001789 Ga0495627_001789_9638_10828 387
427 3300046471 Ga0495650_0000877 Ga0495650_0000877_13142_14332 387
428 3300046492 Ga0495585_0084659 Ga0495585_0084659_417_1595 387
429 3300046500 Ga0495596_0000084 Ga0495596_0000084_31354_32532 387
430 3300046500 Ga0495596_0001192 Ga0495596_0001192_7231_8409 387
431 3300046501 Ga0495607_0029049 Ga0495607_0029049_49_1227 387
432 3300046506 Ga0495583_0069486 Ga0495583_0069486_44_1222 387
433 3300046512 Ga0495610_0000019 Ga0495610_0000019_248381_249559 387
434 3300046512 Ga0495610_0003229 Ga0495610_0003229_7884_9062 387
435 3300046512 Ga0495610_0020194 Ga0495610_0020194_698_1876 387
436 3300046513 Ga0495616_0000674 Ga0495616_0000674_8823_10001 387
437 3300046515 Ga0495620_0036378 Ga0495620_0036378_451_1629 387
438 3300046519 Ga0495632_0000001 Ga0495632_0000001_461002_462180 387
439 3300046519 Ga0495632_0000844 Ga0495632_0000844_12352_13542 387
440 3300046519 Ga0495632_0028806 Ga0495632_0028806_1668_2861 387
441 3300046520 Ga0495637_0000183 Ga0495637_0000183_28236_29414 387
442 3300046522 Ga0495643_0000006 Ga0495643_0000006_151415_152593 387
443 3300046522 Ga0495643_0008714 Ga0495643_0008714_4822_6000 387
444 3300046524 Ga0495648_0000075 Ga0495648_0000075_41855_43033 387
445 3300046524 Ga0495648_0074928 Ga0495648_0074928_119_1297 387
446 3300046525 Ga0495663_0000001 Ga0495663_0000001_411116_412294 387
447 3300046558 Ga0495633_0000360 Ga0495633_0000360_39903_41081 387
448 3300046558 Ga0495633_0000520 Ga0495633_0000520_3901_5079 387
449 3300046660 Ga0495625_0116341 Ga0495625_0116341_270_1448 387
450 3300046692 Ga0495671_0000008 Ga0495671_0000008_151415_152593 387
451 3300046692 Ga0495671_0064458 Ga0495671_0064458_79_1257 387
452 3300046692 Ga0495671_0083752 Ga0495671_0083752_25_1203 387
453 3300046810 Ga0495660_0002388 Ga0495660_0002388_4633_5811 387
454 3300047469 Ga0495673_0000139 Ga0495673_0000139_59458_60636 387
455 3300047470 Ga0495681_0000061 Ga0495681_0000061_70422_71612 387
456 3300047470 Ga0495681_0002763 Ga0495681_0002763_1997_3175 387
457 3300047470 Ga0495681_0056167 Ga0495681_0056167_70_1251 387
458 3300048090 Ga0495615_0000200 Ga0495615_0000200_4991_6169 387
459 3300048091 Ga0495626_0002915 Ga0495626_0002915_3141_4319 387
460 3300048910 Ga0496107_0106353 Ga0496107_0106353_28_1206 387
461 3300048924 Ga0496121_0000094 Ga0496121_0000094_137315_138493 387
462 3300048925 Ga0496122_0000115 Ga0496122_0000115_80886_82064 387
463 3300048925 Ga0496122_0004130 Ga0496122_0004130_7945_9123 387
464 3300048925 Ga0496122_0132659 Ga0496122_0132659_228_1436 387
465 3300048926 Ga0496123_0000129 Ga0496123_0000129_44583_45761 387
466 3300048926 Ga0496123_0002858 Ga0496123_0002858_7933_9111 387
467 3300048926 Ga0496123_0056970 Ga0496123_0056970_809_2017 387
468 3300048927 Ga0496124_0012214 Ga0496124_0012214_2867_4045 387
469 3300048927 Ga0496124_0021606 Ga0496124_0021606_4509_5717 387
470 3300048928 Ga0496125_0015143 Ga0496125_0015143_3030_4208 387
471 3300048929 Ga0496126_0094488 Ga0496126_0094488_740_1918 387
472 3300049568 Ga0501031_0002443 Ga0501031_0002443_884_2062 387
473 3300049569 Ga0501032_0035380 Ga0501032_0035380_1185_2363 387
474 3300049570 Ga0501033_0017682 Ga0501033_0017682_3027_4205 387
475 3300049570 Ga0501033_0076581 Ga0501033_0076581_196_1374 387
476 3300049571 Ga0501034_0004086 Ga0501034_0004086_565_1743 387
477 3300049571 Ga0501034_0029840 Ga0501034_0029840_1789_2967 387
478 3300049571 Ga0501034_0156354 Ga0501034_0156354_196_1374 387
479 3300049572 Ga0501036_0015674 Ga0501036_0015674_565_1743 387
480 3300049573 Ga0501037_0012823 Ga0501037_0012823_514_1692 387
481 3300049573 Ga0501037_0042342 Ga0501037_0042342_984_2162 387
482 3300049574 Ga0501038_0037600 Ga0501038_0037600_1886_3064 387
483 3300049575 Ga0501039_0004012 Ga0501039_0004012_92_1270 387
484 3300049579 Ga0501043_0061273 Ga0501043_0061273_495_1673 387
485 3300049580 Ga0501046_0001581 Ga0501046_0001581_7643_8821 387
486 3300049581 Ga0501047_0085817 Ga0501047_0085817_1282_2460 387
487 3300049582 Ga0501048_0026574 Ga0501048_0026574_1911_3089 387
488 3300049584 Ga0501068_0100457 Ga0501068_0100457_465_1643 387
489 3300049586 Ga0501070_0161319 Ga0501070_0161319_316_1494 387
490 3300049742 Ga0501080_0153565 Ga0501080_0153565_89_1267 387
491 3300049744 Ga0501083_0024864 Ga0501083_0024864_1555_2763 387
492 3300049823 Ga0501044_0021574 Ga0501044_0021574_1185_2363 387
493 3300049824 Ga0501045_0011646 Ga0501045_0011646_1637_2815 387
494 3300050496 nmdc:mga07m45_92526_c1 nmdc:mga07m45_92526_c1_540_1721 387
495 3300050511 nmdc:mga08y16_211_c1 nmdc:mga08y16_211_c1_50941_52119 387
496 3300050515 nmdc:mga0a205_323075_c1 nmdc:mga0a205_323075_c1_130_1308 387
497 3300053087 Ga0500643_003610 Ga0500643_003610_3438_4637 387
498 3300053088 Ga0500644_0000005 Ga0500644_0000005_39209_40387 387
499 3300053088 Ga0500644_0001691 Ga0500644_0001691_1943_3154 387
500 3300053122 Ga0500608_008028 Ga0500608_008028_2953_4164 387
501 3300053134 Ga0500658_0004568 Ga0500658_0004568_718_1917 387
502 3300053138 Ga0500564_000013 Ga0500564_000013_38211_39389 387
503 3300053139 Ga0500568_0019618 Ga0500568_0019618_1234_2433 387
504 3300053153 Ga0500616_0008205 Ga0500616_0008205_5318_6496 387
505 3300053156 Ga0500622_0000159 Ga0500622_0000159_24321_25532 387
506 3300053158 Ga0500627_0086678 Ga0500627_0086678_34_1212 387
507 3300053731 Ga0500609_003179 Ga0500609_003179_585_1763 387
508 3300001979 JGI24740J21852_10021190 JGI24740J21852_100211902 388
509 3300002987 JGI25159J45721_1000158 JGI25159J45721_10001584 388
510 3300003214 JGI25165J46597_1000015 JGI25165J46597_1000015272 388
511 3300003354 JGI25160J50197_1000026 JGI25160J50197_100002658 388
512 3300003374 JGI25161J50226_1000014 JGI25161J50226_1000014132 388
513 3300003762 Ga0055542_1000088 Ga0055542_100008840 388
514 3300003763 Ga0055529_1000034 Ga0055529_100003440 388
515 3300004625 Ga0055543_1000079 Ga0055543_100007970 388
516 3300005262 Ga0065165_1000073 Ga0065165_1000073109 388
517 3300005327 Ga0070658_10002931 Ga0070658_100029314 388
518 3300005327 Ga0070658_10187265 Ga0070658_101872652 388
519 3300005328 Ga0070676_10029649 Ga0070676_100296493 388
520 3300005339 Ga0070660_100034900 Ga0070660_1000349003 388
521 3300005347 Ga0070668_100009387 Ga0070668_1000093872 388
522 3300005364 Ga0070673_100039497 Ga0070673_1000394974 388
523 3300005366 Ga0070659_100031467 Ga0070659_1000314674 388
524 3300005367 Ga0070667_100076354 Ga0070667_1000763542 388
525 3300005459 Ga0068867_100182065 Ga0068867_1001820652 388
526 3300005530 Ga0070679_100177105 Ga0070679_1001771052 388
527 3300005539 Ga0068853_100019005 Ga0068853_1000190052 388
528 3300005539 Ga0068853_100054689 Ga0068853_1000546894 388
529 3300005548 Ga0070665_100005166 Ga0070665_1000051669 388
530 3300005548 Ga0070665_100050304 Ga0070665_1000503041 388
531 3300005548 Ga0070665_100252599 Ga0070665_1002525992 388
532 3300005548 Ga0070665_100263813 Ga0070665_1002638132 388
533 3300005614 Ga0068856_100056091 Ga0068856_1000560914 388
534 3300005616 Ga0068852_100012893 Ga0068852_1000128933 388
535 3300005841 Ga0068863_100003967 Ga0068863_10000396711 388
536 3300005843 Ga0068860_100000536 Ga0068860_1000005366 388
537 3300006038 Ga0075365_10009599 Ga0075365_100095992 388
538 3300006038 Ga0075365_10045943 Ga0075365_100459433 388
539 3300006038 Ga0075365_10050738 Ga0075365_100507382 388
540 3300006038 Ga0075365_10068347 Ga0075365_100683472 388
541 3300006177 Ga0075362_10000827 Ga0075362_100008278 388
542 3300006177 Ga0075362_10083742 Ga0075362_100837421 388
543 3300006186 Ga0075369_10014686 Ga0075369_100146862 388
544 3300006353 Ga0075370_10078247 Ga0075370_100782472 388
545 3300006946 Ga0079104_1003039 Ga0079104_10030396 388
546 3300009093 Ga0105240_10030016 Ga0105240_100300162 388
547 3300009148 Ga0105243_10199012 Ga0105243_101990123 388
548 3300009545 Ga0105237_10018220 Ga0105237_100182204 388
549 3300009551 Ga0105238_10057544 Ga0105238_100575442 388
550 3300009551 Ga0105238_10060557 Ga0105238_100605573 388
551 3300009553 Ga0105249_10024598 Ga0105249_100245982 388
552 3300009553 Ga0105249_10505640 Ga0105249_105056401 388
553 3300010375 Ga0105239_10032071 Ga0105239_100320712 388
554 3300010375 Ga0105239_10262379 Ga0105239_102623792 388
555 3300010375 Ga0105239_10268061 Ga0105239_102680611 388
556 3300013100 Ga0157373_10016893 Ga0157373_100168934 388
557 3300013104 Ga0157370_10342278 Ga0157370_103422781 388
558 3300013105 Ga0157369_10069256 Ga0157369_100692562 388
559 3300025254 Ga0209148_1000093 Ga0209148_100009342 388
560 3300025254 Ga0209148_1000233 Ga0209148_100023391 388
561 3300025261 Ga0209233_1000010 Ga0209233_1000010369 388
562 3300025261 Ga0209233_1000360 Ga0209233_100036028 388
563 3300025272 Ga0209455_1000045 Ga0209455_1000045183 388
564 3300025272 Ga0209455_1000062 Ga0209455_1000062339 388
565 3300025284 Ga0209130_1000219 Ga0209130_100021966 388
566 3300025302 Ga0207426_1000075 Ga0207426_1000075148 388
567 3300025304 Ga0209257_1004870 Ga0209257_10048708 388
568 3300025907 Ga0207645_10010175 Ga0207645_100101752 388
569 3300025913 Ga0207695_10021793 Ga0207695_100217937 388
570 3300025913 Ga0207695_10171049 Ga0207695_101710492 388
571 3300025913 Ga0207695_10223822 Ga0207695_102238222 388
572 3300025919 Ga0207657_10014102 Ga0207657_100141027 388
573 3300025919 Ga0207657_10021558 Ga0207657_100215586 388
574 3300025919 Ga0207657_10064189 Ga0207657_100641893 388
575 3300025924 Ga0207694_10040103 Ga0207694_100401033 388
576 3300025924 Ga0207694_10283204 Ga0207694_102832041 388
577 3300025932 Ga0207690_10096719 Ga0207690_100967193 388
578 3300025932 Ga0207690_10135660 Ga0207690_101356602 388
579 3300025937 Ga0207669_10037798 Ga0207669_100377983 388
580 3300025937 Ga0207669_10038725 Ga0207669_100387252 388
581 3300025949 Ga0207667_10002994 Ga0207667_1000299413 388
582 3300025949 Ga0207667_10410682 Ga0207667_104106821 388
583 3300025960 Ga0207651_10050045 Ga0207651_100500454 388
584 3300025961 Ga0207712_10024320 Ga0207712_100243201 388
585 3300025986 Ga0207658_10043261 Ga0207658_100432612 388
586 3300026041 Ga0207639_10060218 Ga0207639_100602182 388
587 3300026088 Ga0207641_10000785 Ga0207641_1000078519 388
588 3300026089 Ga0207648_10148350 Ga0207648_101483502 388
589 3300026116 Ga0207674_10019756 Ga0207674_100197568 388
590 3300027111 Ga0209281_1001545 Ga0209281_10015459 388
591 3300028379 Ga0268266_10002386 Ga0268266_100023869 388
592 3300028379 Ga0268266_10199804 Ga0268266_101998042 388
593 3300028379 Ga0268266_10308253 Ga0268266_103082532 388
594 3300028380 Ga0268265_10029014 Ga0268265_100290142 388
595 3300028381 Ga0268264_10000521 Ga0268264_1000052137 388
596 3300031456 Ga0307513_10128843 Ga0307513_101288432 388
597 3300033180 Ga0307510_10000008 Ga0307510_10000008344 388
598 3300033180 Ga0307510_10090583 Ga0307510_100905833 388
599 3300035113 Ga0373936_0000983 Ga0373936_0000983_2364_3680 388
600 3300035691 Ga0373931_0033614 Ga0373931_0033614_777_1961 388
601 3300037418 Ga0395900_0367844 Ga0395900_0367844_211_1392 388
602 3300037471 Ga0395905_0001090 Ga0395905_0001090_26465_27646 388
603 3300039438 Ga0436360_0635651 Ga0436360_0635651_50_1234 388
604 3300039453 Ga0436362_0831552 Ga0436362_0831552_865_2064 388
605 3300042007 Ga0439449_0038179 Ga0439449_0038179_593_1774 388
606 3300046460 Ga0495638_0014437 Ga0495638_0014437_116_1297 388
607 3300046471 Ga0495650_0000091 Ga0495650_0000091_18186_19376 388
608 3300046506 Ga0495583_0000364 Ga0495583_0000364_54850_56040 388
609 3300046512 Ga0495610_0015471 Ga0495610_0015471_2986_4167 388
610 3300046520 Ga0495637_0033281 Ga0495637_0033281_1023_2204 388
611 3300046522 Ga0495643_0014491 Ga0495643_0014491_441_1625 388
612 3300046660 Ga0495625_0049224 Ga0495625_0049224_1421_2608 388
613 3300046691 Ga0495670_0000048 Ga0495670_0000048_23997_25187 388
614 3300046694 Ga0495649_0055429 Ga0495649_0055429_581_1786 388
615 3300046809 Ga0495600_0002601 Ga0495600_0002601_6253_7443 388
616 3300048922 Ga0496119_0026237 Ga0496119_0026237_557_1738 388
617 3300048922 Ga0496119_0076016 Ga0496119_0076016_466_1647 388
618 3300048923 Ga0496120_0002324 Ga0496120_0002324_7604_8785 388
619 3300048924 Ga0496121_0012904 Ga0496121_0012904_7408_8589 388
620 3300048925 Ga0496122_0057726 Ga0496122_0057726_847_2028 388
621 3300048928 Ga0496125_0007911 Ga0496125_0007911_3891_5072 388
622 3300048929 Ga0496126_0026380 Ga0496126_0026380_3659_4840 388
623 3300049589 Ga0501073_0001496 Ga0501073_0001496_7581_8774 388
624 3300050489 nmdc:mga03683_86347_c1 nmdc:mga03683_86347_c1_25_1218 388
625 3300050492 nmdc:mga0yw44_68203_c1 nmdc:mga0yw44_68203_c1_714_1895 388
626 3300050492 nmdc:mga0yw44_72338_c1 nmdc:mga0yw44_72338_c1_331_1512 388
627 3300050492 nmdc:mga0yw44_88411_c1 nmdc:mga0yw44_88411_c1_222_1403 388
628 3300050516 nmdc:mga0sz30_1726_c1 nmdc:mga0sz30_1726_c1_2136_3317 388
629 3300050516 nmdc:mga0sz30_38958_c1 nmdc:mga0sz30_38958_c1_68_1249 388
630 3300053079 Ga0500610_0035513 Ga0500610_0035513_456_1637 388
631 3300053119 Ga0500595_005969 Ga0500595_005969_2656_3846 388
632 3300053134 Ga0500658_0017990 Ga0500658_0017990_14_1195 388
633 3300053136 Ga0500559_0024650 Ga0500559_0024650_668_1849 388
634 3300053139 Ga0500568_0000361 Ga0500568_0000361_23242_24426 388
635 3300053142 Ga0500577_0011243 Ga0500577_0011243_766_1950 388
636 3300053156 Ga0500622_0001692 Ga0500622_0001692_3031_4215 388
637 3300053156 Ga0500622_0010351 Ga0500622_0010351_3273_4457 388
638 3300053177 Ga0500636_0001131 Ga0500636_0001131_5452_6642 388

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14486

DUF4432

Domain of unknown function (DUF4432)

61

397

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ty1-assembly1.cif.gz_C crystal structure of a putative aldose 1-epimerase (kpn_04629) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.90 a resolution 0.9042 27 365
3ty1-assembly1.cif.gz_C crystal structure of a putative aldose 1-epimerase (kpn_04629) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.90 a resolution 0.7754 27 365
3k25-assembly2.cif.gz_B crystal structure of slr1438 protein from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr112 0.7244 49 355
3mwx-assembly2.cif.gz_B crystal structure of a putative galactose mutarotase (bsu18360) from bacillus subtilis at 1.45 a resolution 0.6797 27 354
2ciq-assembly1.cif.gz_A structure-based functional annotation: yeast ymr099c codes for a d- hexose-6-phosphate mutarotase. 0.6735 28 353
ID Description Score Start End Superfamily
3ty1C00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.8931 27 365 2.70.98.10
3ty1C00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.7644 27 365 2.70.98.10
3k25A00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.7338 49 355 2.70.98.10
af_B8A1H0_29_315_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.7241 27 355 2.70.98.10
af_A0A368UGQ6_22_308_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.6973 38 359 2.70.98.10
ID Description Score Start End GO Terms
AF-A0A526YQY0-F1-model_v4 DUF4432 family protein 0.9948 1 344 GO:0030246
AF-A0A0Q6P1L7-F1-model_v4 DUF4432 domain-containing protein 0.9914 1 387 GO:0030246
AF-A0A436I7C5-F1-model_v4 deleted 0.9908 152 388
AF-A0A526YQY0-F1-model_v4 DUF4432 family protein 0.989 1 344 GO:0030246
AF-A0A435PFZ4-F1-model_v4 deleted 0.9889 112 388

Feature Viewer

pLDDT pTM Quality
93.2 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map