F471495
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 638 | 321 | 633 | 163 |
Family's Representative Sequence
| Representative Sequence | 3300005455|Ga0070663_100756418|Ga0070663_1007564181 |
| Length | 149 |
| Sequence | MKRWIRTLAVVMATLTVGVAASPAAIAEDQLSFTGTTKPAVLWFWTPWCPFCNQEAPNVSQVAAANPKVTFVGIAARSDVGQMEGFVSKYNLNFTNLNDADGSLWARFNVPWQPAYVFLRPDGTSTFVNNPTSAMSEQELSDRVHALVS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 2 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 3 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 4 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 5 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 6 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 7 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 8 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 91 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 121 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 181 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 183 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 184 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 185 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 186 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 188 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 189 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 190 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 191 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 192 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 193 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 197 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 199 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 200 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 204 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 207 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 208 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 209 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 210 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 211 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 212 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 213 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 215 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 216 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 217 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 218 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 219 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 220 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 221 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 222 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 223 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 224 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 225 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 226 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 227 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 228 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 229 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 230 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 231 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 232 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 233 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 234 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 256 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 257 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 258 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 259 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 260 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 261 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 265 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 266 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 267 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 268 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 269 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 270 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 271 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 272 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 273 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 274 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 275 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 276 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 277 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 278 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 279 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 297 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 298 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 299 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 300 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 301 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 302 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 308 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 309 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 310 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 311 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 312 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 313 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 314 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 315 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 316 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 317 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 318 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 319 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 320 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 321 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.22 |
| Metatranscriptomes | 0 |
| Isolates | 0.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.76 |
| Nodule | 0 |
| Rhizoplane | 11.91 |
| Rhizosphere | 71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1033091 | 3300002070 | Bacteria | 765 |
| 2 | JGI24748J21848_1009575 | 3300002074 | Bacteria | 1141 |
| 3 | JGI24749J21850_1021094 | 3300002076 | Bacteria | 921 |
| 4 | JGI24744J21845_10000463 | 3300002077 | Bacteria | 7178 |
| 5 | JGI24034J26672_10013638 | 3300002239 | Bacteria | 1234 |
| 6 | JGI24034J26672_10025056 | 3300002239 | Bacteria | 953 |
| 7 | JGI24751J29686_10027693 | 3300002459 | Bacteria | 1177 |
| 8 | Ga0070683_100434795 | 3300005329 | Bacteria | 1252 |
| 9 | Ga0070690_100007309 | 3300005330 | Bacteria | 6326 |
| 10 | Ga0070670_100031486 | 3300005331 | Bacteria | 4568 |
| 11 | Ga0068869_100031587 | 3300005334 | Bacteria | 3725 |
| 12 | Ga0068869_100091634 | 3300005334 | Bacteria | 2286 |
| 13 | Ga0070666_10026947 | 3300005335 | Bacteria | 3760 |
| 14 | Ga0070680_100205289 | 3300005336 | Bacteria | 1662 |
| 15 | Ga0070682_100010070 | 3300005337 | Bacteria | 5358 |
| 16 | Ga0070682_100010372 | 3300005337 | Bacteria | 5287 |
| 17 | Ga0070682_100065893 | 3300005337 | Bacteria | 2303 |
| 18 | Ga0070682_100371301 | 3300005337 | Bacteria | 1073 |
| 19 | Ga0068868_100000227 | 3300005338 | Bacteria | 38201 |
| 20 | Ga0070660_100169774 | 3300005339 | Bacteria | 1761 |
| 21 | Ga0070689_100080916 | 3300005340 | Bacteria | 2550 |
| 22 | Ga0070691_10012681 | 3300005341 | Bacteria | 3860 |
| 23 | Ga0070691_10020911 | 3300005341 | Bacteria | 3026 |
| 24 | Ga0070692_10137121 | 3300005345 | Bacteria | 1381 |
| 25 | Ga0070668_100004054 | 3300005347 | Bacteria | 10847 |
| 26 | Ga0070668_100008930 | 3300005347 | Bacteria | 7441 |
| 27 | Ga0070668_100100583 | 3300005347 | Bacteria | 2290 |
| 28 | Ga0070668_100715813 | 3300005347 | Bacteria | 884 |
| 29 | Ga0070669_100063130 | 3300005353 | Bacteria | 2726 |
| 30 | Ga0070671_100007716 | 3300005355 | Bacteria | 8596 |
| 31 | Ga0070671_100043898 | 3300005355 | Bacteria | 3715 |
| 32 | Ga0070674_100000223 | 3300005356 | Bacteria | 27721 |
| 33 | Ga0070674_100760108 | 3300005356 | Bacteria | 834 |
| 34 | Ga0070688_100018740 | 3300005365 | Bacteria | 4000 |
| 35 | Ga0070659_100171375 | 3300005366 | Bacteria | 1778 |
| 36 | Ga0070667_100000190 | 3300005367 | Bacteria | 73682 |
| 37 | Ga0070667_100014397 | 3300005367 | Bacteria | 6536 |
| 38 | Ga0070667_100153415 | 3300005367 | Bacteria | 2025 |
| 39 | Ga0070667_100618509 | 3300005367 | Bacteria | 999 |
| 40 | Ga0070709_10051067 | 3300005434 | Bacteria | 2594 |
| 41 | Ga0070714_100037899 | 3300005435 | Bacteria | 4053 |
| 42 | Ga0070714_100106423 | 3300005435 | Bacteria | 2478 |
| 43 | Ga0070714_100421264 | 3300005435 | Bacteria | 1265 |
| 44 | Ga0070713_100020391 | 3300005436 | Bacteria | 5082 |
| 45 | Ga0070710_10001219 | 3300005437 | Bacteria | 12171 |
| 46 | Ga0070710_10005585 | 3300005437 | Bacteria | 5990 |
| 47 | Ga0070710_10007995 | 3300005437 | Bacteria | 5141 |
| 48 | Ga0070701_10000228 | 3300005438 | Bacteria | 17759 |
| 49 | Ga0070711_100000141 | 3300005439 | Bacteria | 38743 |
| 50 | Ga0070711_100003908 | 3300005439 | Bacteria | 8748 |
| 51 | Ga0070705_100194688 | 3300005440 | Bacteria | 1385 |
| 52 | Ga0070700_100017490 | 3300005441 | Bacteria | 4102 |
| 53 | Ga0070700_100063552 | 3300005441 | Bacteria | 2335 |
| 54 | Ga0070694_100006459 | 3300005444 | Bacteria | 7119 |
| 55 | Ga0070663_100005376 | 3300005455 | Bacteria | 7606 |
| 56 | Ga0070663_100011553 | 3300005455 | Bacteria | 5550 |
| 57 | Ga0070663_100368779 | 3300005455 | Bacteria | 1166 |
| 58 | Ga0070663_100756418 | 3300005455 | Bacteria | 830 |
| 59 | Ga0070678_100001400 | 3300005456 | Bacteria | 12843 |
| 60 | Ga0070678_100033449 | 3300005456 | Bacteria | 3569 |
| 61 | Ga0070678_100143105 | 3300005456 | Bacteria | 1916 |
| 62 | Ga0070662_100010632 | 3300005457 | Bacteria | 6051 |
| 63 | Ga0070662_100473987 | 3300005457 | Bacteria | 1041 |
| 64 | Ga0070662_100477121 | 3300005457 | Bacteria | 1038 |
| 65 | Ga0068867_100003180 | 3300005459 | Bacteria | 11578 |
| 66 | Ga0070685_10198667 | 3300005466 | Bacteria | 1302 |
| 67 | Ga0070697_100857464 | 3300005536 | Bacteria | 805 |
| 68 | Ga0068853_100005781 | 3300005539 | Bacteria | 9742 |
| 69 | Ga0068853_100160522 | 3300005539 | Bacteria | 2028 |
| 70 | Ga0070672_100098442 | 3300005543 | Bacteria | 2369 |
| 71 | Ga0070686_100113787 | 3300005544 | Bacteria | 1848 |
| 72 | Ga0070695_100296411 | 3300005545 | Bacteria | 1194 |
| 73 | Ga0070696_100175599 | 3300005546 | Bacteria | 1586 |
| 74 | Ga0070693_100012047 | 3300005547 | Bacteria | 4367 |
| 75 | Ga0070693_100781726 | 3300005547 | Bacteria | 706 |
| 76 | Ga0070665_100013464 | 3300005548 | Bacteria | 8228 |
| 77 | Ga0070665_100014376 | 3300005548 | Bacteria | 7943 |
| 78 | Ga0070665_100054494 | 3300005548 | Bacteria | 4011 |
| 79 | Ga0070665_100158524 | 3300005548 | Bacteria | 2265 |
| 80 | Ga0070665_100300849 | 3300005548 | Bacteria | 1607 |
| 81 | Ga0070704_100000712 | 3300005549 | Bacteria | 16223 |
| 82 | Ga0070704_100189676 | 3300005549 | Bacteria | 1651 |
| 83 | Ga0068855_100043985 | 3300005563 | Bacteria | 5287 |
| 84 | Ga0070664_100238794 | 3300005564 | Bacteria | 1631 |
| 85 | Ga0068854_100000492 | 3300005578 | Bacteria | 24084 |
| 86 | Ga0068854_100077794 | 3300005578 | Bacteria | 2442 |
| 87 | Ga0068854_101435636 | 3300005578 | Bacteria | 625 |
| 88 | Ga0068856_100539368 | 3300005614 | Bacteria | 1188 |
| 89 | Ga0070702_100001938 | 3300005615 | Bacteria | 8707 |
| 90 | Ga0070702_100687643 | 3300005615 | Bacteria | 778 |
| 91 | Ga0068852_100104127 | 3300005616 | Bacteria | 2568 |
| 92 | Ga0068859_100003815 | 3300005617 | Bacteria | 15385 |
| 93 | Ga0068859_100005865 | 3300005617 | Bacteria | 12467 |
| 94 | Ga0068859_100275604 | 3300005617 | Bacteria | 1774 |
| 95 | Ga0068859_100389408 | 3300005617 | Bacteria | 1489 |
| 96 | Ga0068864_100065577 | 3300005618 | Bacteria | 3150 |
| 97 | Ga0068864_100091698 | 3300005618 | Bacteria | 2681 |
| 98 | Ga0068864_100457140 | 3300005618 | Bacteria | 1222 |
| 99 | Ga0068864_101167259 | 3300005618 | Bacteria | 768 |
| 100 | Ga0068866_10000345 | 3300005718 | Bacteria | 21934 |
| 101 | Ga0068866_10041768 | 3300005718 | Bacteria | 2277 |
| 102 | Ga0068866_10047802 | 3300005718 | Bacteria | 2159 |
| 103 | Ga0068861_100001560 | 3300005719 | Bacteria | 14572 |
| 104 | Ga0068861_100157582 | 3300005719 | Bacteria | 1869 |
| 105 | Ga0068861_100260967 | 3300005719 | Bacteria | 1483 |
| 106 | Ga0068863_100001346 | 3300005841 | Bacteria | 24433 |
| 107 | Ga0068863_100007330 | 3300005841 | Bacteria | 10798 |
| 108 | Ga0068863_100059644 | 3300005841 | Bacteria | 3610 |
| 109 | Ga0068863_100134869 | 3300005841 | Bacteria | 2359 |
| 110 | Ga0068858_100003458 | 3300005842 | Bacteria | 15667 |
| 111 | Ga0068858_100446852 | 3300005842 | Bacteria | 1245 |
| 112 | Ga0068858_100495156 | 3300005842 | Bacteria | 1180 |
| 113 | Ga0068860_100000099 | 3300005843 | Bacteria | 145436 |
| 114 | Ga0068860_100000971 | 3300005843 | Bacteria | 31764 |
| 115 | Ga0068860_100119478 | 3300005843 | Bacteria | 2523 |
| 116 | Ga0068862_100000086 | 3300005844 | Bacteria | 110489 |
| 117 | Ga0068862_100006044 | 3300005844 | Bacteria | 10080 |
| 118 | Ga0068862_100185425 | 3300005844 | Bacteria | 1869 |
| 119 | Ga0081455_10038937 | 3300005937 | Bacteria | 4206 |
| 120 | Ga0081538_10066974 | 3300005981 | Bacteria | 2008 |
| 121 | Ga0070717_10261911 | 3300006028 | Bacteria | 1530 |
| 122 | Ga0075365_10023895 | 3300006038 | Bacteria | 3850 |
| 123 | Ga0075365_10047190 | 3300006038 | Bacteria | 2830 |
| 124 | Ga0075365_10110047 | 3300006038 | Bacteria | 1893 |
| 125 | Ga0075363_100000092 | 3300006048 | Bacteria | 19660 |
| 126 | Ga0075363_100006312 | 3300006048 | Bacteria | 5371 |
| 127 | Ga0075363_100019432 | 3300006048 | Bacteria | 3398 |
| 128 | Ga0075363_100097136 | 3300006048 | Bacteria | 1627 |
| 129 | Ga0075363_100101914 | 3300006048 | Bacteria | 1589 |
| 130 | Ga0075363_100210492 | 3300006048 | Bacteria | 1113 |
| 131 | Ga0075363_100253855 | 3300006048 | Bacteria | 1013 |
| 132 | Ga0075364_10000628 | 3300006051 | Bacteria | 18192 |
| 133 | Ga0075364_10002372 | 3300006051 | Bacteria | 10569 |
| 134 | Ga0075364_10007671 | 3300006051 | Bacteria | 6418 |
| 135 | Ga0075364_10008061 | 3300006051 | Bacteria | 6280 |
| 136 | Ga0075364_10480315 | 3300006051 | Bacteria | 849 |
| 137 | Ga0070715_10004747 | 3300006163 | Bacteria | 4492 |
| 138 | Ga0070715_10177847 | 3300006163 | Bacteria | 1065 |
| 139 | Ga0070716_100001458 | 3300006173 | Bacteria | 10532 |
| 140 | Ga0070716_100116837 | 3300006173 | Bacteria | 1663 |
| 141 | Ga0070716_100442987 | 3300006173 | Bacteria | 945 |
| 142 | Ga0070712_100000607 | 3300006175 | Bacteria | 21017 |
| 143 | Ga0070712_100027836 | 3300006175 | Bacteria | 3777 |
| 144 | Ga0070712_100044230 | 3300006175 | Bacteria | 3070 |
| 145 | Ga0070712_100529341 | 3300006175 | Bacteria | 991 |
| 146 | Ga0075362_10069694 | 3300006177 | Bacteria | 1604 |
| 147 | Ga0075367_10010088 | 3300006178 | Bacteria | 4954 |
| 148 | Ga0075367_10056712 | 3300006178 | Bacteria | 2328 |
| 149 | Ga0075367_10209963 | 3300006178 | Bacteria | 1217 |
| 150 | Ga0075367_10282754 | 3300006178 | Bacteria | 1043 |
| 151 | Ga0075369_10002372 | 3300006186 | Bacteria | 6714 |
| 152 | Ga0075369_10014693 | 3300006186 | Bacteria | 3132 |
| 153 | Ga0075369_10050856 | 3300006186 | Bacteria | 1793 |
| 154 | Ga0075369_10104945 | 3300006186 | Bacteria | 1270 |
| 155 | Ga0075369_10250351 | 3300006186 | Bacteria | 823 |
| 156 | Ga0097621_100369637 | 3300006237 | Bacteria | 1279 |
| 157 | Ga0075370_10054724 | 3300006353 | Bacteria | 2266 |
| 158 | Ga0075370_10085933 | 3300006353 | Bacteria | 1811 |
| 159 | Ga0075370_10092346 | 3300006353 | Bacteria | 1747 |
| 160 | Ga0075370_10201937 | 3300006353 | Bacteria | 1173 |
| 161 | Ga0075370_10268511 | 3300006353 | Bacteria | 1012 |
| 162 | Ga0075370_10342781 | 3300006353 | Bacteria | 892 |
| 163 | Ga0068871_100143544 | 3300006358 | Bacteria | 2031 |
| 164 | Ga0068871_100627753 | 3300006358 | Bacteria | 979 |
| 165 | Ga0075428_100001179 | 3300006844 | Bacteria | 27960 |
| 166 | Ga0075430_100092657 | 3300006846 | Bacteria | 2526 |
| 167 | Ga0075430_100176930 | 3300006846 | Bacteria | 1775 |
| 168 | Ga0075431_100009007 | 3300006847 | Bacteria | 10005 |
| 169 | Ga0075434_100862359 | 3300006871 | Bacteria | 921 |
| 170 | Ga0075429_100197257 | 3300006880 | Bacteria | 1763 |
| 171 | Ga0068865_100001324 | 3300006881 | Bacteria | 14443 |
| 172 | Ga0068865_100102934 | 3300006881 | Bacteria | 2093 |
| 173 | Ga0097620_100003815 | 3300006931 | Bacteria | 15385 |
| 174 | Ga0097620_100005865 | 3300006931 | Bacteria | 12467 |
| 175 | Ga0097620_100275605 | 3300006931 | Bacteria | 1774 |
| 176 | Ga0097620_100389447 | 3300006931 | Bacteria | 1489 |
| 177 | Ga0099795_10013911 | 3300007788 | Bacteria | 2482 |
| 178 | Ga0105250_10121000 | 3300009092 | Bacteria | 1076 |
| 179 | Ga0105240_11128359 | 3300009093 | Bacteria | 833 |
| 180 | Ga0111539_10733351 | 3300009094 | Bacteria | 1150 |
| 181 | Ga0111539_11465352 | 3300009094 | Bacteria | 792 |
| 182 | Ga0105245_10000678 | 3300009098 | Bacteria | 30775 |
| 183 | Ga0105247_10000051 | 3300009101 | Bacteria | 145981 |
| 184 | Ga0105247_10001857 | 3300009101 | Bacteria | 14779 |
| 185 | Ga0105247_10129897 | 3300009101 | Bacteria | 1641 |
| 186 | Ga0114129_10024772 | 3300009147 | Bacteria | 8506 |
| 187 | Ga0105243_10000534 | 3300009148 | Bacteria | 38657 |
| 188 | Ga0105243_10203784 | 3300009148 | Bacteria | 1737 |
| 189 | Ga0105241_10020235 | 3300009174 | Bacteria | 4916 |
| 190 | Ga0105241_10596646 | 3300009174 | Bacteria | 997 |
| 191 | Ga0105242_10000328 | 3300009176 | Bacteria | 38119 |
| 192 | Ga0105242_10255947 | 3300009176 | Bacteria | 1579 |
| 193 | Ga0105242_10441811 | 3300009176 | Bacteria | 1224 |
| 194 | Ga0105242_11225223 | 3300009176 | Bacteria | 771 |
| 195 | Ga0105248_10000339 | 3300009177 | Bacteria | 55050 |
| 196 | Ga0105248_10000842 | 3300009177 | Bacteria | 34503 |
| 197 | Ga0105248_10415985 | 3300009177 | Bacteria | 1514 |
| 198 | Ga0105248_10617038 | 3300009177 | Bacteria | 1224 |
| 199 | Ga0105237_10171491 | 3300009545 | Bacteria | 2170 |
| 200 | Ga0105237_10297449 | 3300009545 | Bacteria | 1617 |
| 201 | Ga0105238_10117110 | 3300009551 | Bacteria | 2644 |
| 202 | Ga0105238_10599816 | 3300009551 | Bacteria | 1109 |
| 203 | Ga0105249_10000020 | 3300009553 | Bacteria | 260634 |
| 204 | Ga0105249_12653933 | 3300009553 | Bacteria | 573 |
| 205 | Ga0099796_10012357 | 3300010159 | Bacteria | 2409 |
| 206 | Ga0105239_10012440 | 3300010375 | Bacteria | 9479 |
| 207 | Ga0105246_10036013 | 3300011119 | Bacteria | 3312 |
| 208 | Ga0157371_10526855 | 3300013102 | Bacteria | 874 |
| 209 | Ga0157369_11128941 | 3300013105 | Bacteria | 801 |
| 210 | Ga0157374_10966538 | 3300013296 | Bacteria | 870 |
| 211 | Ga0157374_11784822 | 3300013296 | Bacteria | 640 |
| 212 | Ga0157378_10001491 | 3300013297 | Bacteria | 21150 |
| 213 | Ga0163162_10337334 | 3300013306 | Bacteria | 1640 |
| 214 | Ga0163162_10573343 | 3300013306 | Bacteria | 1256 |
| 215 | Ga0157372_10052464 | 3300013307 | Bacteria | 4541 |
| 216 | Ga0163163_10002474 | 3300014325 | Bacteria | 15621 |
| 217 | Ga0163163_10009758 | 3300014325 | Bacteria | 8597 |
| 218 | Ga0157380_10003919 | 3300014326 | Bacteria | 10266 |
| 219 | Ga0157377_10235151 | 3300014745 | Bacteria | 1180 |
| 220 | Ga0157379_10004006 | 3300014968 | Bacteria | 12555 |
| 221 | Ga0157379_10798237 | 3300014968 | Bacteria | 891 |
| 222 | Ga0157376_10084506 | 3300014969 | Bacteria | 2733 |
| 223 | Ga0163161_10001669 | 3300017792 | Bacteria | 16273 |
| 224 | Ga0163161_10012322 | 3300017792 | Bacteria | 5934 |
| 225 | Ga0213876_10168431 | 3300021384 | Bacteria | 1165 |
| 226 | Ga0213875_10035194 | 3300021388 | Bacteria | 2363 |
| 227 | Ga0213875_10132752 | 3300021388 | Bacteria | 1164 |
| 228 | Ga0209051_1000021 | 3300025303 | Bacteria | 507633 |
| 229 | Ga0207692_10009243 | 3300025898 | Bacteria | 4107 |
| 230 | Ga0207642_10000241 | 3300025899 | Bacteria | 16282 |
| 231 | Ga0207642_10016135 | 3300025899 | Bacteria | 2805 |
| 232 | Ga0207710_10000010 | 3300025900 | Bacteria | 482087 |
| 233 | Ga0207710_10007136 | 3300025900 | Bacteria | 4739 |
| 234 | Ga0207710_10429077 | 3300025900 | Bacteria | 681 |
| 235 | Ga0207688_10000427 | 3300025901 | Bacteria | 19816 |
| 236 | Ga0207688_10001234 | 3300025901 | Bacteria | 13252 |
| 237 | Ga0207680_10213389 | 3300025903 | Bacteria | 1320 |
| 238 | Ga0207647_10116939 | 3300025904 | Bacteria | 1574 |
| 239 | Ga0207685_10011792 | 3300025905 | Bacteria | 2643 |
| 240 | Ga0207685_10045983 | 3300025905 | Bacteria | 1659 |
| 241 | Ga0207699_10011688 | 3300025906 | Bacteria | 4443 |
| 242 | Ga0207699_10012233 | 3300025906 | Bacteria | 4361 |
| 243 | Ga0207645_10071186 | 3300025907 | Bacteria | 2225 |
| 244 | Ga0207643_10174110 | 3300025908 | Bacteria | 1300 |
| 245 | Ga0207654_10055015 | 3300025911 | Bacteria | 2302 |
| 246 | Ga0207695_10834189 | 3300025913 | Bacteria | 802 |
| 247 | Ga0207671_10127158 | 3300025914 | Bacteria | 1953 |
| 248 | Ga0207693_10001162 | 3300025915 | Bacteria | 23484 |
| 249 | Ga0207693_10002211 | 3300025915 | Bacteria | 16958 |
| 250 | Ga0207663_10000264 | 3300025916 | Bacteria | 22813 |
| 251 | Ga0207663_10006459 | 3300025916 | Bacteria | 5998 |
| 252 | Ga0207663_10410249 | 3300025916 | Bacteria | 1038 |
| 253 | Ga0207660_10206788 | 3300025917 | Bacteria | 1535 |
| 254 | Ga0207657_10088328 | 3300025919 | Bacteria | 2591 |
| 255 | Ga0207681_10002097 | 3300025923 | Bacteria | 12770 |
| 256 | Ga0207681_10060089 | 3300025923 | Bacteria | 2608 |
| 257 | Ga0207694_10652284 | 3300025924 | Bacteria | 887 |
| 258 | Ga0207650_10464444 | 3300025925 | Bacteria | 1055 |
| 259 | Ga0207659_10143551 | 3300025926 | Bacteria | 1856 |
| 260 | Ga0207687_10001116 | 3300025927 | Bacteria | 18250 |
| 261 | Ga0207687_10047008 | 3300025927 | Bacteria | 2990 |
| 262 | Ga0207700_10391942 | 3300025928 | Bacteria | 1216 |
| 263 | Ga0207664_10201017 | 3300025929 | Bacteria | 1720 |
| 264 | Ga0207644_10004614 | 3300025931 | Bacteria | 8962 |
| 265 | Ga0207644_10176599 | 3300025931 | Bacteria | 1671 |
| 266 | Ga0207706_10012871 | 3300025933 | Bacteria | 7615 |
| 267 | Ga0207706_10174203 | 3300025933 | Bacteria | 1890 |
| 268 | Ga0207686_10005970 | 3300025934 | Bacteria | 6536 |
| 269 | Ga0207686_10026557 | 3300025934 | Bacteria | 3379 |
| 270 | Ga0207709_10014636 | 3300025935 | Bacteria | 4335 |
| 271 | Ga0207709_10307948 | 3300025935 | Bacteria | 1180 |
| 272 | Ga0207709_10597074 | 3300025935 | Bacteria | 874 |
| 273 | Ga0207709_11444106 | 3300025935 | Bacteria | 570 |
| 274 | Ga0207670_10128409 | 3300025936 | Bacteria | 1853 |
| 275 | Ga0207670_10441742 | 3300025936 | Bacteria | 1047 |
| 276 | Ga0207669_10003531 | 3300025937 | Bacteria | 6769 |
| 277 | Ga0207669_10199713 | 3300025937 | Bacteria | 1450 |
| 278 | Ga0207704_10000621 | 3300025938 | Bacteria | 15698 |
| 279 | Ga0207665_10002223 | 3300025939 | Bacteria | 13090 |
| 280 | Ga0207665_10003744 | 3300025939 | Bacteria | 10158 |
| 281 | Ga0207665_10231394 | 3300025939 | Bacteria | 1358 |
| 282 | Ga0207665_10244953 | 3300025939 | Bacteria | 1322 |
| 283 | Ga0207665_10367720 | 3300025939 | Bacteria | 1089 |
| 284 | Ga0207691_10134866 | 3300025940 | Bacteria | 2178 |
| 285 | Ga0207711_10000301 | 3300025941 | Bacteria | 52993 |
| 286 | Ga0207711_10011033 | 3300025941 | Bacteria | 7508 |
| 287 | Ga0207711_11477164 | 3300025941 | Bacteria | 623 |
| 288 | Ga0207689_10132614 | 3300025942 | Bacteria | 2051 |
| 289 | Ga0207679_10262469 | 3300025945 | Bacteria | 1474 |
| 290 | Ga0207667_10389193 | 3300025949 | Bacteria | 1420 |
| 291 | Ga0207651_10568873 | 3300025960 | Bacteria | 987 |
| 292 | Ga0207712_10000010 | 3300025961 | Bacteria | 455972 |
| 293 | Ga0207712_10005160 | 3300025961 | Bacteria | 8262 |
| 294 | Ga0207712_10012964 | 3300025961 | Bacteria | 5337 |
| 295 | Ga0207712_10311836 | 3300025961 | Bacteria | 1295 |
| 296 | Ga0207668_10001338 | 3300025972 | Bacteria | 14604 |
| 297 | Ga0207668_10002603 | 3300025972 | Bacteria | 10548 |
| 298 | Ga0207668_10087665 | 3300025972 | Bacteria | 2277 |
| 299 | Ga0207640_10001865 | 3300025981 | Bacteria | 11303 |
| 300 | Ga0207640_10665501 | 3300025981 | Bacteria | 889 |
| 301 | Ga0207640_10885200 | 3300025981 | Bacteria | 779 |
| 302 | Ga0207658_10000138 | 3300025986 | Bacteria | 77096 |
| 303 | Ga0207658_10011329 | 3300025986 | Bacteria | 6070 |
| 304 | Ga0207658_10149779 | 3300025986 | Bacteria | 1899 |
| 305 | Ga0207658_10320711 | 3300025986 | Bacteria | 1341 |
| 306 | Ga0207658_10364748 | 3300025986 | Bacteria | 1261 |
| 307 | Ga0207658_10800937 | 3300025986 | Bacteria | 855 |
| 308 | Ga0207677_10001437 | 3300026023 | Bacteria | 12665 |
| 309 | Ga0207677_10200329 | 3300026023 | Bacteria | 1586 |
| 310 | Ga0207703_11238811 | 3300026035 | Bacteria | 717 |
| 311 | Ga0207639_10040020 | 3300026041 | Bacteria | 3496 |
| 312 | Ga0207639_10171812 | 3300026041 | Bacteria | 1836 |
| 313 | Ga0207639_10946749 | 3300026041 | Bacteria | 806 |
| 314 | Ga0207678_10009628 | 3300026067 | Bacteria | 8496 |
| 315 | Ga0207678_10012044 | 3300026067 | Bacteria | 7596 |
| 316 | Ga0207678_10021794 | 3300026067 | Bacteria | 5619 |
| 317 | Ga0207708_10016016 | 3300026075 | Bacteria | 5630 |
| 318 | Ga0207708_10052297 | 3300026075 | Bacteria | 3111 |
| 319 | Ga0207708_10407303 | 3300026075 | Bacteria | 1126 |
| 320 | Ga0207641_10001050 | 3300026088 | Bacteria | 27871 |
| 321 | Ga0207641_10213098 | 3300026088 | Bacteria | 1787 |
| 322 | Ga0207641_10902839 | 3300026088 | Bacteria | 877 |
| 323 | Ga0207648_10000085 | 3300026089 | Bacteria | 88563 |
| 324 | Ga0207648_10026164 | 3300026089 | Bacteria | 5187 |
| 325 | Ga0207676_10070562 | 3300026095 | Bacteria | 2802 |
| 326 | Ga0207676_10074733 | 3300026095 | Bacteria | 2732 |
| 327 | Ga0207676_10078661 | 3300026095 | Bacteria | 2672 |
| 328 | Ga0207676_10379107 | 3300026095 | Bacteria | 1316 |
| 329 | Ga0207676_10792313 | 3300026095 | Bacteria | 924 |
| 330 | Ga0207675_100010626 | 3300026118 | Bacteria | 8623 |
| 331 | Ga0207675_100217198 | 3300026118 | Bacteria | 1841 |
| 332 | Ga0207675_100338192 | 3300026118 | Bacteria | 1473 |
| 333 | Ga0207675_100601417 | 3300026118 | Bacteria | 1103 |
| 334 | Ga0207683_10000040 | 3300026121 | Bacteria | 95127 |
| 335 | Ga0207683_10053379 | 3300026121 | Bacteria | 3544 |
| 336 | Ga0207698_10219016 | 3300026142 | Bacteria | 1718 |
| 337 | Ga0207698_10987316 | 3300026142 | Bacteria | 852 |
| 338 | Ga0209179_1011560 | 3300027512 | Bacteria | 1566 |
| 339 | Ga0209813_10086999 | 3300027866 | Bacteria | 1042 |
| 340 | Ga0268266_10016548 | 3300028379 | Bacteria | 6304 |
| 341 | Ga0268266_10072868 | 3300028379 | Bacteria | 2979 |
| 342 | Ga0268266_10205587 | 3300028379 | Bacteria | 1804 |
| 343 | Ga0268266_10291797 | 3300028379 | Bacteria | 1519 |
| 344 | Ga0268266_10382682 | 3300028379 | Bacteria | 1327 |
| 345 | Ga0268265_10000014 | 3300028380 | Bacteria | 330186 |
| 346 | Ga0268265_10020473 | 3300028380 | Bacteria | 4616 |
| 347 | Ga0268264_10000137 | 3300028381 | Bacteria | 176081 |
| 348 | Ga0268264_10000983 | 3300028381 | Bacteria | 29174 |
| 349 | Ga0268264_10249385 | 3300028381 | Bacteria | 1648 |
| 350 | Ga0268264_10965613 | 3300028381 | Bacteria | 858 |
| 351 | Ga0316576_10514226 | 3300031727 | Bacteria | 880 |
| 352 | Ga0307405_10173113 | 3300031731 | Bacteria | 1542 |
| 353 | Ga0307413_10181182 | 3300031824 | Bacteria | 1502 |
| 354 | Ga0307413_10573391 | 3300031824 | Bacteria | 919 |
| 355 | Ga0307410_10062066 | 3300031852 | Bacteria | 2559 |
| 356 | Ga0307410_10390390 | 3300031852 | Bacteria | 1122 |
| 357 | Ga0307410_10501750 | 3300031852 | Bacteria | 998 |
| 358 | Ga0326468_10001010 | 3300031889 | Bacteria | 2681 |
| 359 | Ga0307407_10299614 | 3300031903 | Bacteria | 1120 |
| 360 | Ga0307412_11369526 | 3300031911 | Bacteria | 639 |
| 361 | Ga0307409_100166827 | 3300031995 | Bacteria | 1933 |
| 362 | Ga0307409_100959164 | 3300031995 | Bacteria | 871 |
| 363 | Ga0307416_100669382 | 3300032002 | Bacteria | 1124 |
| 364 | Ga0307414_10564690 | 3300032004 | Bacteria | 1016 |
| 365 | Ga0307411_10411288 | 3300032005 | Bacteria | 1121 |
| 366 | Ga0307415_100235662 | 3300032126 | Bacteria | 1477 |
| 367 | Ga0316583_10217576 | 3300032133 | Bacteria | 662 |
| 368 | Ga0373948_0036634 | 3300034817 | Bacteria | 1011 |
| 369 | Ga0373940_0221083 | 3300035088 | Bacteria | 629 |
| 370 | Ga0373951_0044105 | 3300035091 | Bacteria | 1082 |
| 371 | Ga0373952_0148817 | 3300035092 | Bacteria | 655 |
| 372 | Ga0373960_0016686 | 3300035121 | Bacteria | 1893 |
| 373 | Ga0373960_0088793 | 3300035121 | Bacteria | 985 |
| 374 | Ga0373962_0067657 | 3300035242 | Bacteria | 1061 |
| 375 | Ga0316574_0275339 | 3300035398 | Bacteria | 1073 |
| 376 | Ga0373931_0023608 | 3300035691 | Bacteria | 3107 |
| 377 | Ga0373931_0031990 | 3300035691 | Bacteria | 2719 |
| 378 | Ga0373935_0686182 | 3300035692 | Bacteria | 753 |
| 379 | Ga0373937_0880327 | 3300036401 | Bacteria | 844 |
| 380 | Ga0316582_0411255 | 3300036647 | Bacteria | 932 |
| 381 | Ga0316584_0015038 | 3300036712 | Bacteria | 5528 |
| 382 | Ga0395900_0942841 | 3300037418 | Bacteria | 785 |
| 383 | Ga0395898_1819952 | 3300037466 | Bacteria | 530 |
| 384 | Ga0436364_0459520 | 3300037853 | Bacteria | 1896 |
| 385 | Ga0436364_0725072 | 3300037853 | Bacteria | 620 |
| 386 | Ga0436365_0607166 | 3300039437 | Bacteria | 1240 |
| 387 | Ga0436365_1177168 | 3300039437 | Bacteria | 16605 |
| 388 | Ga0436365_1640827 | 3300039437 | Bacteria | 22352 |
| 389 | Ga0436363_0182495 | 3300039450 | Bacteria | 661 |
| 390 | Ga0436363_0656406 | 3300039450 | Bacteria | 3762 |
| 391 | Ga0439461_0001144 | 3300041410 | Bacteria | 4031 |
| 392 | Ga0439466_0028779 | 3300041411 | Bacteria | 1915 |
| 393 | Ga0439466_0105135 | 3300041411 | Bacteria | 878 |
| 394 | Ga0439466_0120704 | 3300041411 | Bacteria | 809 |
| 395 | Ga0439465_0005453 | 3300041413 | Bacteria | 4060 |
| 396 | Ga0439465_0022979 | 3300041413 | Bacteria | 1960 |
| 397 | Ga0451802_1940043 | 3300041460 | Bacteria | 1213 |
| 398 | Ga0451843_0613428 | 3300041509 | Bacteria | 653 |
| 399 | Ga0451853_4104438 | 3300041512 | Bacteria | 1257 |
| 400 | Ga0439450_183732 | 3300042008 | Bacteria | 556 |
| 401 | Ga0439434_0011814 | 3300042435 | Bacteria | 2582 |
| 402 | Ga0439464_0087681 | 3300042439 | Bacteria | 935 |
| 403 | Ga0466969_0081797 | 3300044656 | Bacteria | 1540 |
| 404 | Ga0466969_0260317 | 3300044656 | Bacteria | 786 |
| 405 | Ga0466972_0003083 | 3300044658 | Bacteria | 8256 |
| 406 | Ga0466972_0006973 | 3300044658 | Bacteria | 5666 |
| 407 | Ga0466972_0016656 | 3300044658 | Bacteria | 3675 |
| 408 | Ga0466972_0101775 | 3300044658 | Bacteria | 1359 |
| 409 | Ga0466965_0000201 | 3300044683 | Bacteria | 18636 |
| 410 | Ga0466965_0008833 | 3300044683 | Bacteria | 4673 |
| 411 | Ga0466965_0017396 | 3300044683 | Bacteria | 3436 |
| 412 | Ga0466965_0036885 | 3300044683 | Bacteria | 2399 |
| 413 | Ga0466966_0017019 | 3300044684 | Bacteria | 4806 |
| 414 | Ga0466966_0298785 | 3300044684 | Bacteria | 968 |
| 415 | Ga0466961_0011981 | 3300044693 | Bacteria | 5542 |
| 416 | Ga0466961_0024792 | 3300044693 | Bacteria | 3858 |
| 417 | Ga0466963_0283596 | 3300044694 | Bacteria | 1164 |
| 418 | Ga0466963_0708948 | 3300044694 | Bacteria | 710 |
| 419 | Ga0466964_0499576 | 3300044706 | Bacteria | 653 |
| 420 | Ga0466971_0087821 | 3300044719 | Bacteria | 1422 |
| 421 | Ga0466971_0106129 | 3300044719 | Bacteria | 1294 |
| 422 | Ga0466971_0318525 | 3300044719 | Bacteria | 749 |
| 423 | Ga0466968_0020280 | 3300044735 | Bacteria | 2682 |
| 424 | Ga0466968_0038061 | 3300044735 | Bacteria | 2020 |
| 425 | Ga0466970_0001116 | 3300044765 | Bacteria | 13006 |
| 426 | Ga0466970_0014404 | 3300044765 | Bacteria | 4060 |
| 427 | Ga0466970_0052593 | 3300044765 | Bacteria | 2174 |
| 428 | Ga0466970_0076218 | 3300044765 | Bacteria | 1806 |
| 429 | Ga0466970_0444498 | 3300044765 | Bacteria | 743 |
| 430 | Ga0466970_0625815 | 3300044765 | Bacteria | 625 |
| 431 | Ga0466957_0295316 | 3300044842 | Bacteria | 1087 |
| 432 | Ga0466957_0657629 | 3300044842 | Bacteria | 737 |
| 433 | Ga0466960_0000223 | 3300044901 | Bacteria | 19745 |
| 434 | Ga0466960_0016320 | 3300044901 | Bacteria | 3218 |
| 435 | Ga0466960_0093886 | 3300044901 | Bacteria | 1534 |
| 436 | Ga0466959_0012525 | 3300045049 | Bacteria | 6130 |
| 437 | Ga0466959_0024644 | 3300045049 | Bacteria | 4457 |
| 438 | Ga0466959_0034727 | 3300045049 | Bacteria | 3730 |
| 439 | Ga0466959_0194331 | 3300045049 | Bacteria | 1415 |
| 440 | Ga0466958_0006271 | 3300045836 | Bacteria | 6459 |
| 441 | Ga0466958_0457874 | 3300045836 | Bacteria | 826 |
| 442 | Ga0466967_0049434 | 3300045976 | Bacteria | 3677 |
| 443 | Ga0466967_0125293 | 3300045976 | Bacteria | 2379 |
| 444 | Ga0466967_0191213 | 3300045976 | Bacteria | 1934 |
| 445 | Ga0466967_0827053 | 3300045976 | Bacteria | 920 |
| 446 | Ga0495592_0775188 | 3300046454 | Bacteria | 571 |
| 447 | Ga0495638_0033042 | 3300046460 | Bacteria | 3310 |
| 448 | Ga0495582_0022796 | 3300046473 | Bacteria | 3425 |
| 449 | Ga0495662_0144308 | 3300046476 | Bacteria | 1172 |
| 450 | Ga0495583_0292731 | 3300046506 | Bacteria | 648 |
| 451 | Ga0495616_0170941 | 3300046513 | Bacteria | 972 |
| 452 | Ga0495648_0113201 | 3300046524 | Bacteria | 1472 |
| 453 | Ga0495652_0307998 | 3300046529 | Bacteria | 1149 |
| 454 | Ga0495652_1063769 | 3300046529 | Bacteria | 527 |
| 455 | Ga0495665_0154961 | 3300046531 | Bacteria | 1195 |
| 456 | Ga0495640_0055584 | 3300046533 | Bacteria | 2708 |
| 457 | Ga0495635_0266893 | 3300046663 | Bacteria | 1152 |
| 458 | Ga0495658_0034547 | 3300046683 | Bacteria | 2775 |
| 459 | Ga0495649_0143517 | 3300046694 | Bacteria | 1256 |
| 460 | Ga0495581_0040799 | 3300047315 | Bacteria | 2685 |
| 461 | Ga0495674_0056183 | 3300047319 | Bacteria | 3449 |
| 462 | Ga0495672_0107481 | 3300047320 | Bacteria | 1503 |
| 463 | Ga0495672_0173434 | 3300047320 | Bacteria | 1098 |
| 464 | Ga0495672_0249832 | 3300047320 | Bacteria | 861 |
| 465 | Ga0495676_0136027 | 3300047321 | Bacteria | 1767 |
| 466 | Ga0495602_0686450 | 3300048088 | Bacteria | 696 |
| 467 | Ga0495614_0223423 | 3300048089 | Bacteria | 856 |
| 468 | Ga0496100_0001224 | 3300048903 | Bacteria | 12472 |
| 469 | Ga0496100_0041233 | 3300048903 | Bacteria | 2942 |
| 470 | Ga0496100_0048881 | 3300048903 | Bacteria | 2732 |
| 471 | Ga0496101_0001744 | 3300048904 | Bacteria | 13025 |
| 472 | Ga0496101_0001844 | 3300048904 | Bacteria | 12776 |
| 473 | Ga0496101_0007711 | 3300048904 | Bacteria | 6992 |
| 474 | Ga0496101_0009820 | 3300048904 | Bacteria | 6304 |
| 475 | Ga0496101_0594179 | 3300048904 | Bacteria | 875 |
| 476 | Ga0496102_0000118 | 3300048905 | Bacteria | 113499 |
| 477 | Ga0496102_0004227 | 3300048905 | Bacteria | 12139 |
| 478 | Ga0496102_0005536 | 3300048905 | Bacteria | 10727 |
| 479 | Ga0496102_0089231 | 3300048905 | Bacteria | 2852 |
| 480 | Ga0496102_0120445 | 3300048905 | Bacteria | 2450 |
| 481 | Ga0496102_0231650 | 3300048905 | Bacteria | 1741 |
| 482 | Ga0496102_0249032 | 3300048905 | Bacteria | 1675 |
| 483 | Ga0496102_0343136 | 3300048905 | Bacteria | 1406 |
| 484 | Ga0496103_0000129 | 3300048906 | Bacteria | 81081 |
| 485 | Ga0496103_0061224 | 3300048906 | Bacteria | 2340 |
| 486 | Ga0496103_0092004 | 3300048906 | Bacteria | 1914 |
| 487 | Ga0496103_0199000 | 3300048906 | Bacteria | 1288 |
| 488 | Ga0496103_0205468 | 3300048906 | Bacteria | 1267 |
| 489 | Ga0496103_0619317 | 3300048906 | Bacteria | 689 |
| 490 | Ga0496104_0007843 | 3300048907 | Bacteria | 9462 |
| 491 | Ga0496104_0013061 | 3300048907 | Bacteria | 7480 |
| 492 | Ga0496104_0277844 | 3300048907 | Bacteria | 1588 |
| 493 | Ga0496105_0019113 | 3300048908 | Bacteria | 5522 |
| 494 | Ga0496105_0185865 | 3300048908 | Bacteria | 1701 |
| 495 | Ga0496105_0381037 | 3300048908 | Bacteria | 1122 |
| 496 | Ga0496105_0401635 | 3300048908 | Bacteria | 1088 |
| 497 | Ga0496105_0865117 | 3300048908 | Bacteria | 683 |
| 498 | Ga0496105_0878267 | 3300048908 | Bacteria | 677 |
| 499 | Ga0496106_0001227 | 3300048909 | Bacteria | 19204 |
| 500 | Ga0496106_0002950 | 3300048909 | Bacteria | 12662 |
| 501 | Ga0496106_0063575 | 3300048909 | Bacteria | 2805 |
| 502 | Ga0496106_0343844 | 3300048909 | Bacteria | 1198 |
| 503 | Ga0496107_0001410 | 3300048910 | Bacteria | 14818 |
| 504 | Ga0496107_0002601 | 3300048910 | Bacteria | 11772 |
| 505 | Ga0496107_0016066 | 3300048910 | Bacteria | 5254 |
| 506 | Ga0496107_0106849 | 3300048910 | Bacteria | 2056 |
| 507 | Ga0496107_0343306 | 3300048910 | Bacteria | 1111 |
| 508 | Ga0496108_0005964 | 3300048911 | Bacteria | 9870 |
| 509 | Ga0496108_0048811 | 3300048911 | Bacteria | 3540 |
| 510 | Ga0496108_0063232 | 3300048911 | Bacteria | 3117 |
| 511 | Ga0496108_0134748 | 3300048911 | Bacteria | 2124 |
| 512 | Ga0496109_0067894 | 3300048912 | Bacteria | 3267 |
| 513 | Ga0496109_0083715 | 3300048912 | Bacteria | 2942 |
| 514 | Ga0496109_0257093 | 3300048912 | Bacteria | 1645 |
| 515 | Ga0496110_0034275 | 3300048913 | Bacteria | 4397 |
| 516 | Ga0496110_0034536 | 3300048913 | Bacteria | 4381 |
| 517 | Ga0496110_0306324 | 3300048913 | Bacteria | 1447 |
| 518 | Ga0496110_1440542 | 3300048913 | Bacteria | 598 |
| 519 | Ga0496111_0210148 | 3300048914 | Bacteria | 1446 |
| 520 | Ga0496111_0233083 | 3300048914 | Bacteria | 1367 |
| 521 | Ga0496111_0267080 | 3300048914 | Bacteria | 1269 |
| 522 | Ga0496112_0007818 | 3300048915 | Bacteria | 9516 |
| 523 | Ga0496112_0011611 | 3300048915 | Bacteria | 8056 |
| 524 | Ga0496112_0066915 | 3300048915 | Bacteria | 3545 |
| 525 | Ga0496112_0086353 | 3300048915 | Bacteria | 3104 |
| 526 | Ga0496113_0036482 | 3300048916 | Bacteria | 3602 |
| 527 | Ga0496113_0041631 | 3300048916 | Bacteria | 3391 |
| 528 | Ga0496113_0078719 | 3300048916 | Bacteria | 2522 |
| 529 | Ga0496113_0217941 | 3300048916 | Bacteria | 1521 |
| 530 | Ga0496113_0654535 | 3300048916 | Bacteria | 840 |
| 531 | Ga0496114_0003799 | 3300048917 | Bacteria | 11644 |
| 532 | Ga0496114_0003967 | 3300048917 | Bacteria | 11426 |
| 533 | Ga0496114_0176568 | 3300048917 | Bacteria | 1864 |
| 534 | Ga0496114_0218137 | 3300048917 | Bacteria | 1674 |
| 535 | Ga0496114_0305118 | 3300048917 | Bacteria | 1406 |
| 536 | Ga0496114_0306663 | 3300048917 | Bacteria | 1402 |
| 537 | Ga0496114_0346724 | 3300048917 | Bacteria | 1313 |
| 538 | Ga0496114_0538537 | 3300048917 | Bacteria | 1032 |
| 539 | Ga0496115_0004528 | 3300048918 | Bacteria | 10051 |
| 540 | Ga0496115_0007150 | 3300048918 | Bacteria | 8198 |
| 541 | Ga0496115_0084499 | 3300048918 | Bacteria | 2588 |
| 542 | Ga0496115_0420218 | 3300048918 | Bacteria | 1083 |
| 543 | Ga0496116_0072685 | 3300048919 | Bacteria | 2172 |
| 544 | Ga0496117_0000304 | 3300048920 | Bacteria | 85823 |
| 545 | Ga0496118_0000341 | 3300048921 | Bacteria | 79469 |
| 546 | Ga0496118_0001559 | 3300048921 | Bacteria | 34060 |
| 547 | Ga0496119_0004722 | 3300048922 | Bacteria | 13387 |
| 548 | Ga0496120_0078678 | 3300048923 | Bacteria | 1791 |
| 549 | Ga0496120_0125389 | 3300048923 | Bacteria | 1322 |
| 550 | Ga0496121_0036684 | 3300048924 | Bacteria | 4364 |
| 551 | Ga0496123_0012228 | 3300048926 | Bacteria | 7341 |
| 552 | Ga0496124_0345328 | 3300048927 | Bacteria | 1055 |
| 553 | Ga0496125_0024308 | 3300048928 | Bacteria | 5574 |
| 554 | Ga0496125_0190367 | 3300048928 | Bacteria | 1355 |
| 555 | Ga0496125_0221224 | 3300048928 | Bacteria | 1220 |
| 556 | Ga0496126_0003099 | 3300048929 | Bacteria | 21487 |
| 557 | Ga0496126_0016764 | 3300048929 | Bacteria | 7317 |
| 558 | Ga0496126_0019824 | 3300048929 | Bacteria | 6614 |
| 559 | Ga0496126_0057958 | 3300048929 | Bacteria | 3493 |
| 560 | Ga0496126_0488989 | 3300048929 | Bacteria | 985 |
| 561 | Ga0501032_0001735 | 3300049569 | Bacteria | 17236 |
| 562 | Ga0501033_0090630 | 3300049570 | Bacteria | 2237 |
| 563 | Ga0501034_0016890 | 3300049571 | Bacteria | 7482 |
| 564 | Ga0501034_0095168 | 3300049571 | Bacteria | 2975 |
| 565 | Ga0501036_0009059 | 3300049572 | Bacteria | 8186 |
| 566 | Ga0501037_0000434 | 3300049573 | Bacteria | 34407 |
| 567 | Ga0501037_0594270 | 3300049573 | Bacteria | 744 |
| 568 | Ga0501038_0003103 | 3300049574 | Bacteria | 15496 |
| 569 | Ga0501039_0001870 | 3300049575 | Bacteria | 15557 |
| 570 | Ga0501040_0503770 | 3300049576 | Bacteria | 873 |
| 571 | Ga0501043_0002065 | 3300049579 | Bacteria | 17125 |
| 572 | Ga0501047_0015226 | 3300049581 | Bacteria | 7325 |
| 573 | Ga0501047_0417136 | 3300049581 | Bacteria | 1174 |
| 574 | Ga0501068_0069412 | 3300049584 | Bacteria | 2149 |
| 575 | Ga0501070_0000764 | 3300049586 | Bacteria | 29355 |
| 576 | Ga0501070_0139895 | 3300049586 | Bacteria | 1999 |
| 577 | Ga0501073_0022196 | 3300049589 | Bacteria | 4574 |
| 578 | Ga0501080_0877617 | 3300049742 | Bacteria | 783 |
| 579 | Ga0501035_0276189 | 3300049822 | Bacteria | 1421 |
| 580 | Ga0501044_0025213 | 3300049823 | Bacteria | 6305 |
| 581 | Ga0501044_0287611 | 3300049823 | Bacteria | 1576 |
| 582 | Ga0501045_1121087 | 3300049824 | Bacteria | 575 |
| 583 | nmdc:mga03683_45385_c1 | 3300050489 | Bacteria | 1818 |
| 584 | nmdc:mga03n38_128167_c1 | 3300050490 | Bacteria | 1255 |
| 585 | nmdc:mga03n38_145986_c1 | 3300050490 | Bacteria | 1186 |
| 586 | nmdc:mga03n38_146469_c1 | 3300050490 | Bacteria | 1184 |
| 587 | nmdc:mga03n38_213511_c1 | 3300050490 | Bacteria | 1004 |
| 588 | nmdc:mga03n38_3021_c1 | 3300050490 | Bacteria | 5330 |
| 589 | nmdc:mga03n38_31418_c1 | 3300050490 | Bacteria | 2241 |
| 590 | nmdc:mga03n38_498_c1 | 3300050490 | Bacteria | 9885 |
| 591 | nmdc:mga00v17_4797_c1 | 3300050491 | Bacteria | 7077 |
| 592 | nmdc:mga00v17_4944_c1 | 3300050491 | Bacteria | 6991 |
| 593 | nmdc:mga00v17_61367_c1 | 3300050491 | Bacteria | 2311 |
| 594 | nmdc:mga00v17_6288_c1 | 3300050491 | Bacteria | 6297 |
| 595 | nmdc:mga0yw44_14790_c1 | 3300050492 | Bacteria | 4156 |
| 596 | nmdc:mga0yw44_151511_c1 | 3300050492 | Bacteria | 1513 |
| 597 | nmdc:mga0yw44_801924_c1 | 3300050492 | Bacteria | 639 |
| 598 | nmdc:mga06z11_114290_c1 | 3300050494 | Bacteria | 1498 |
| 599 | nmdc:mga06z11_190771_c1 | 3300050494 | Bacteria | 1186 |
| 600 | nmdc:mga07m45_10512_c1 | 3300050496 | Bacteria | 4836 |
| 601 | nmdc:mga07m45_127118_c1 | 3300050496 | Bacteria | 1474 |
| 602 | nmdc:mga07m45_273574_c1 | 3300050496 | Bacteria | 982 |
| 603 | nmdc:mga07m45_3531_c1 | 3300050496 | Bacteria | 7550 |
| 604 | nmdc:mga05p37_723596_c1 | 3300050507 | Bacteria | 1102 |
| 605 | nmdc:mga09592_711915_c1 | 3300050508 | Bacteria | 854 |
| 606 | nmdc:mga0qj67_245454_c1 | 3300050509 | Bacteria | 1453 |
| 607 | nmdc:mga0qj67_98568_c1 | 3300050509 | Bacteria | 2354 |
| 608 | nmdc:mga08y16_1622875_c1 | 3300050511 | Bacteria | 604 |
| 609 | nmdc:mga0n895_757912_c1 | 3300050512 | Bacteria | 963 |
| 610 | nmdc:mga0sz30_14668_c1 | 3300050516 | Bacteria | 3088 |
| 611 | nmdc:mga0sz30_14998_c1 | 3300050516 | Bacteria | 3058 |
| 612 | nmdc:mga0sz30_2809_c1 | 3300050516 | Bacteria | 6219 |
| 613 | nmdc:mga0sz30_322_c1 | 3300050516 | Bacteria | 18342 |
| 614 | Ga0500635_0082410 | 3300053080 | Bacteria | 1158 |
| 615 | Ga0500578_0180790 | 3300053086 | Bacteria | 1300 |
| 616 | Ga0500641_0309353 | 3300053096 | Bacteria | 646 |
| 617 | Ga0500650_0070832 | 3300053098 | Bacteria | 1630 |
| 618 | Ga0500556_0003368 | 3300053104 | Bacteria | 4717 |
| 619 | Ga0500556_0041733 | 3300053104 | Bacteria | 1619 |
| 620 | Ga0500652_015433 | 3300053131 | Bacteria | 2756 |
| 621 | Ga0500652_063258 | 3300053131 | Bacteria | 1527 |
| 622 | Ga0500559_0105764 | 3300053136 | Bacteria | 1300 |
| 623 | Ga0500564_178160 | 3300053138 | Bacteria | 888 |
| 624 | Ga0500577_0012053 | 3300053142 | Bacteria | 2602 |
| 625 | Ga0500588_0176554 | 3300053146 | Bacteria | 784 |
| 626 | Ga0500616_0006360 | 3300053153 | Bacteria | 7752 |
| 627 | Ga0500616_0036902 | 3300053153 | Bacteria | 2649 |
| 628 | Ga0500627_0045410 | 3300053158 | Bacteria | 1901 |
| 629 | Ga0500645_000112 | 3300053730 | Bacteria | 64943 |
| 630 | Ga0500645_058790 | 3300053730 | Bacteria | 1113 |
| 631 | Ga0466962_0064051 | 3300061719 | Bacteria | 1755 |
| 632 | Ga0466962_0070005 | 3300061719 | Bacteria | 1675 |
| 633 | Ga0466962_0417171 | 3300061719 | Bacteria | 673 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042439 | Ga0439464_0087681 | Ga0439464_0087681_33_524 | 125 |
| 2 | 3300031889 | Ga0326468_10001010 | Ga0326468_100010102 | 133 |
| 3 | 3300044658 | Ga0466972_0016656 | Ga0466972_0016656_1538_2029 | 146 |
| 4 | 3300044901 | Ga0466960_0000223 | Ga0466960_0000223_14053_14544 | 146 |
| 5 | 3300005455 | Ga0070663_100756418 | Ga0070663_1007564181 | 147 |
| 6 | 3300048929 | Ga0496126_0057958 | Ga0496126_0057958_2665_3153 | 147 |
| 7 | 3300053730 | Ga0500645_000112 | Ga0500645_000112_39928_40416 | 147 |
| 8 | 3300031852 | Ga0307410_10501750 | Ga0307410_105017502 | 148 |
| 9 | 3300048918 | Ga0496115_0420218 | Ga0496115_0420218_395_883 | 148 |
| 10 | 3300049569 | Ga0501032_0001735 | Ga0501032_0001735_1168_1653 | 148 |
| 11 | 3300049571 | Ga0501034_0016890 | Ga0501034_0016890_4565_5050 | 148 |
| 12 | 3300049572 | Ga0501036_0009059 | Ga0501036_0009059_3176_3661 | 148 |
| 13 | 3300049573 | Ga0501037_0000434 | Ga0501037_0000434_820_1305 | 148 |
| 14 | 3300049574 | Ga0501038_0003103 | Ga0501038_0003103_13076_13561 | 148 |
| 15 | 3300049575 | Ga0501039_0001870 | Ga0501039_0001870_1098_1583 | 148 |
| 16 | 3300049576 | Ga0501040_0503770 | Ga0501040_0503770_13_498 | 148 |
| 17 | 3300049579 | Ga0501043_0002065 | Ga0501043_0002065_11535_12020 | 148 |
| 18 | 3300049584 | Ga0501068_0069412 | Ga0501068_0069412_725_1210 | 148 |
| 19 | 3300049586 | Ga0501070_0000764 | Ga0501070_0000764_15220_15705 | 148 |
| 20 | 3300049589 | Ga0501073_0022196 | Ga0501073_0022196_384_869 | 148 |
| 21 | 3300049823 | Ga0501044_0025213 | Ga0501044_0025213_1816_2301 | 148 |
| 22 | 3300049824 | Ga0501045_1121087 | Ga0501045_1121087_50_535 | 148 |
| 23 | 3300009176 | Ga0105242_10255947 | Ga0105242_102559472 | 151 |
| 24 | 3300009545 | Ga0105237_10171491 | Ga0105237_101714913 | 151 |
| 25 | 3300009551 | Ga0105238_10599816 | Ga0105238_105998162 | 151 |
| 26 | 3300011119 | Ga0105246_10036013 | Ga0105246_100360136 | 151 |
| 27 | 3300013102 | Ga0157371_10526855 | Ga0157371_105268551 | 151 |
| 28 | 3300034817 | Ga0373948_0036634 | Ga0373948_0036634_461_916 | 151 |
| 29 | 3300035092 | Ga0373952_0148817 | Ga0373952_0148817_134_589 | 151 |
| 30 | 3300035121 | Ga0373960_0016686 | Ga0373960_0016686_871_1326 | 151 |
| 31 | 3300035242 | Ga0373962_0067657 | Ga0373962_0067657_512_967 | 151 |
| 32 | 3300035691 | Ga0373931_0023608 | Ga0373931_0023608_1851_2306 | 151 |
| 33 | 3300044658 | Ga0466972_0101775 | Ga0466972_0101775_882_1337 | 151 |
| 34 | 3300044765 | Ga0466970_0625815 | Ga0466970_0625815_156_611 | 151 |
| 35 | 3300045049 | Ga0466959_0194331 | Ga0466959_0194331_642_1097 | 151 |
| 36 | 3300048903 | Ga0496100_0048881 | Ga0496100_0048881_1623_2078 | 151 |
| 37 | 3300048905 | Ga0496102_0231650 | Ga0496102_0231650_973_1428 | 151 |
| 38 | 3300048906 | Ga0496103_0199000 | Ga0496103_0199000_457_912 | 151 |
| 39 | 3300048908 | Ga0496105_0865117 | Ga0496105_0865117_42_533 | 151 |
| 40 | 3300048908 | Ga0496105_0878267 | Ga0496105_0878267_169_624 | 151 |
| 41 | 3300048909 | Ga0496106_0063575 | Ga0496106_0063575_1122_1577 | 151 |
| 42 | 3300048910 | Ga0496107_0106849 | Ga0496107_0106849_614_1069 | 151 |
| 43 | 3300048911 | Ga0496108_0005964 | Ga0496108_0005964_8455_8910 | 151 |
| 44 | 3300048912 | Ga0496109_0083715 | Ga0496109_0083715_439_894 | 151 |
| 45 | 3300048915 | Ga0496112_0011611 | Ga0496112_0011611_6582_7037 | 151 |
| 46 | 3300048915 | Ga0496112_0086353 | Ga0496112_0086353_1769_2260 | 151 |
| 47 | 3300048916 | Ga0496113_0036482 | Ga0496113_0036482_423_914 | 151 |
| 48 | 3300048916 | Ga0496113_0041631 | Ga0496113_0041631_1364_1819 | 151 |
| 49 | 3300048917 | Ga0496114_0306663 | Ga0496114_0306663_802_1257 | 151 |
| 50 | 3300048918 | Ga0496115_0084499 | Ga0496115_0084499_601_1056 | 151 |
| 51 | 3300048923 | Ga0496120_0125389 | Ga0496120_0125389_64_555 | 151 |
| 52 | 3300048926 | Ga0496123_0012228 | Ga0496123_0012228_5061_5552 | 151 |
| 53 | 3300048927 | Ga0496124_0345328 | Ga0496124_0345328_25_516 | 151 |
| 54 | 3300048928 | Ga0496125_0221224 | Ga0496125_0221224_55_546 | 151 |
| 55 | 3300048929 | Ga0496126_0019824 | Ga0496126_0019824_3508_3999 | 151 |
| 56 | 3300006175 | Ga0070712_100044230 | Ga0070712_1000442302 | 152 |
| 57 | 3300035692 | Ga0373935_0686182 | Ga0373935_0686182_33_491 | 152 |
| 58 | 3300036401 | Ga0373937_0880327 | Ga0373937_0880327_41_499 | 152 |
| 59 | 3300036647 | Ga0316582_0411255 | Ga0316582_0411255_184_645 | 152 |
| 60 | 3300041413 | Ga0439465_0005453 | Ga0439465_0005453_3568_4026 | 152 |
| 61 | 3300044683 | Ga0466965_0000201 | Ga0466965_0000201_3640_4131 | 152 |
| 62 | 3300046454 | Ga0495592_0775188 | Ga0495592_0775188_33_491 | 152 |
| 63 | 3300046473 | Ga0495582_0022796 | Ga0495582_0022796_1453_1911 | 152 |
| 64 | 3300046476 | Ga0495662_0144308 | Ga0495662_0144308_147_605 | 152 |
| 65 | 3300046529 | Ga0495652_0307998 | Ga0495652_0307998_259_717 | 152 |
| 66 | 3300046531 | Ga0495665_0154961 | Ga0495665_0154961_626_1084 | 152 |
| 67 | 3300046533 | Ga0495640_0055584 | Ga0495640_0055584_1476_1934 | 152 |
| 68 | 3300046663 | Ga0495635_0266893 | Ga0495635_0266893_157_615 | 152 |
| 69 | 3300046683 | Ga0495658_0034547 | Ga0495658_0034547_1894_2352 | 152 |
| 70 | 3300047315 | Ga0495581_0040799 | Ga0495581_0040799_1699_2157 | 152 |
| 71 | 3300047319 | Ga0495674_0056183 | Ga0495674_0056183_2835_3293 | 152 |
| 72 | 3300047321 | Ga0495676_0136027 | Ga0495676_0136027_1060_1518 | 152 |
| 73 | 3300048089 | Ga0495614_0223423 | Ga0495614_0223423_366_824 | 152 |
| 74 | 3300048917 | Ga0496114_0538537 | Ga0496114_0538537_526_987 | 152 |
| 75 | 3300006038 | Ga0075365_10023895 | Ga0075365_100238953 | 153 |
| 76 | 3300006038 | Ga0075365_10110047 | Ga0075365_101100472 | 153 |
| 77 | 3300021388 | Ga0213875_10132752 | Ga0213875_101327522 | 153 |
| 78 | 3300037853 | Ga0436364_0459520 | Ga0436364_0459520_433_948 | 153 |
| 79 | 3300039450 | Ga0436363_0656406 | Ga0436363_0656406_1520_2071 | 153 |
| 80 | 3300046529 | Ga0495652_1063769 | Ga0495652_1063769_33_503 | 153 |
| 81 | 3300050492 | nmdc:mga0yw44_14790_c1 | nmdc:mga0yw44_14790_c1_1116_1634 | 153 |
| 82 | 3300053086 | Ga0500578_0180790 | Ga0500578_0180790_624_1124 | 153 |
| 83 | 3300005548 | Ga0070665_100158524 | Ga0070665_1001585243 | 154 |
| 84 | 3300005718 | Ga0068866_10047802 | Ga0068866_100478022 | 154 |
| 85 | 3300005719 | Ga0068861_100260967 | Ga0068861_1002609672 | 154 |
| 86 | 3300006186 | Ga0075369_10104945 | Ga0075369_101049452 | 154 |
| 87 | 3300006353 | Ga0075370_10092346 | Ga0075370_100923462 | 154 |
| 88 | 3300006353 | Ga0075370_10201937 | Ga0075370_102019372 | 154 |
| 89 | 3300006358 | Ga0068871_100627753 | Ga0068871_1006277532 | 154 |
| 90 | 3300009094 | Ga0111539_11465352 | Ga0111539_114653522 | 154 |
| 91 | 3300009101 | Ga0105247_10129897 | Ga0105247_101298972 | 154 |
| 92 | 3300009148 | Ga0105243_10203784 | Ga0105243_102037842 | 154 |
| 93 | 3300009176 | Ga0105242_10441811 | Ga0105242_104418111 | 154 |
| 94 | 3300009177 | Ga0105248_10617038 | Ga0105248_106170382 | 154 |
| 95 | 3300009553 | Ga0105249_10000020 | Ga0105249_1000002048 | 154 |
| 96 | 3300014325 | Ga0163163_10009758 | Ga0163163_100097588 | 154 |
| 97 | 3300014968 | Ga0157379_10798237 | Ga0157379_107982371 | 154 |
| 98 | 3300025935 | Ga0207709_10307948 | Ga0207709_103079482 | 154 |
| 99 | 3300025961 | Ga0207712_10000010 | Ga0207712_10000010216 | 154 |
| 100 | 3300025986 | Ga0207658_10320711 | Ga0207658_103207112 | 154 |
| 101 | 3300026035 | Ga0207703_11238811 | Ga0207703_112388111 | 154 |
| 102 | 3300026118 | Ga0207675_100601417 | Ga0207675_1006014172 | 154 |
| 103 | 3300031727 | Ga0316576_10514226 | Ga0316576_105142262 | 154 |
| 104 | 3300032133 | Ga0316583_10217576 | Ga0316583_102175761 | 154 |
| 105 | 3300035398 | Ga0316574_0275339 | Ga0316574_0275339_292_798 | 154 |
| 106 | 3300036712 | Ga0316584_0015038 | Ga0316584_0015038_4196_4702 | 154 |
| 107 | 3300042008 | Ga0439450_183732 | Ga0439450_183732_38_505 | 154 |
| 108 | 3300046524 | Ga0495648_0113201 | Ga0495648_0113201_174_683 | 154 |
| 109 | 3300048903 | Ga0496100_0001224 | Ga0496100_0001224_6977_7480 | 154 |
| 110 | 3300048904 | Ga0496101_0001744 | Ga0496101_0001744_5648_6151 | 154 |
| 111 | 3300048905 | Ga0496102_0120445 | Ga0496102_0120445_1436_1939 | 154 |
| 112 | 3300048907 | Ga0496104_0013061 | Ga0496104_0013061_2201_2704 | 154 |
| 113 | 3300048908 | Ga0496105_0019113 | Ga0496105_0019113_1489_1992 | 154 |
| 114 | 3300048909 | Ga0496106_0002950 | Ga0496106_0002950_3495_3998 | 154 |
| 115 | 3300048910 | Ga0496107_0002601 | Ga0496107_0002601_3264_3767 | 154 |
| 116 | 3300048917 | Ga0496114_0003799 | Ga0496114_0003799_6775_7278 | 154 |
| 117 | 3300048917 | Ga0496114_0176568 | Ga0496114_0176568_1302_1817 | 154 |
| 118 | 3300048918 | Ga0496115_0007150 | Ga0496115_0007150_6434_6937 | 154 |
| 119 | 3300048928 | Ga0496125_0024308 | Ga0496125_0024308_2372_2881 | 154 |
| 120 | 3300050491 | nmdc:mga00v17_61367_c1 | nmdc:mga00v17_61367_c1_1512_1979 | 154 |
| 121 | 3300050492 | nmdc:mga0yw44_151511_c1 | nmdc:mga0yw44_151511_c1_880_1347 | 154 |
| 122 | 3300050492 | nmdc:mga0yw44_801924_c1 | nmdc:mga0yw44_801924_c1_132_599 | 154 |
| 123 | 3300050496 | nmdc:mga07m45_127118_c1 | nmdc:mga07m45_127118_c1_92_595 | 154 |
| 124 | 3300050511 | nmdc:mga08y16_1622875_c1 | nmdc:mga08y16_1622875_c1_63_530 | 154 |
| 125 | 3300053096 | Ga0500641_0309353 | Ga0500641_0309353_95_565 | 154 |
| 126 | 3300053131 | Ga0500652_015433 | Ga0500652_015433_227_730 | 154 |
| 127 | 3300009174 | Ga0105241_10596646 | Ga0105241_105966461 | 155 |
| 128 | 3300009545 | Ga0105237_10297449 | Ga0105237_102974493 | 155 |
| 129 | 3300009551 | Ga0105238_10117110 | Ga0105238_101171101 | 155 |
| 130 | 3300013105 | Ga0157369_11128941 | Ga0157369_111289412 | 155 |
| 131 | 3300013296 | Ga0157374_11784822 | Ga0157374_117848222 | 155 |
| 132 | 3300021388 | Ga0213875_10035194 | Ga0213875_100351942 | 155 |
| 133 | 3300041460 | Ga0451802_1940043 | Ga0451802_1940043_31_504 | 155 |
| 134 | 3300041512 | Ga0451853_4104438 | Ga0451853_4104438_330_803 | 155 |
| 135 | 3300044656 | Ga0466969_0081797 | Ga0466969_0081797_577_1050 | 155 |
| 136 | 3300044684 | Ga0466966_0017019 | Ga0466966_0017019_3591_4064 | 155 |
| 137 | 3300044694 | Ga0466963_0283596 | Ga0466963_0283596_293_766 | 155 |
| 138 | 3300044719 | Ga0466971_0318525 | Ga0466971_0318525_166_639 | 155 |
| 139 | 3300044735 | Ga0466968_0020280 | Ga0466968_0020280_1746_2219 | 155 |
| 140 | 3300044765 | Ga0466970_0014404 | Ga0466970_0014404_562_1035 | 155 |
| 141 | 3300044765 | Ga0466970_0444498 | Ga0466970_0444498_118_591 | 155 |
| 142 | 3300044842 | Ga0466957_0657629 | Ga0466957_0657629_238_711 | 155 |
| 143 | 3300045836 | Ga0466958_0006271 | Ga0466958_0006271_303_776 | 155 |
| 144 | 3300048908 | Ga0496105_0401635 | Ga0496105_0401635_462_935 | 155 |
| 145 | 3300048911 | Ga0496108_0048811 | Ga0496108_0048811_1932_2405 | 155 |
| 146 | 3300048913 | Ga0496110_0034536 | Ga0496110_0034536_2960_3433 | 155 |
| 147 | 3300048915 | Ga0496112_0007818 | Ga0496112_0007818_2225_2698 | 155 |
| 148 | 3300050490 | nmdc:mga03n38_3021_c1 | nmdc:mga03n38_3021_c1_426_899 | 155 |
| 149 | 3300050516 | nmdc:mga0sz30_322_c1 | nmdc:mga0sz30_322_c1_8286_8759 | 155 |
| 150 | 3300053080 | Ga0500635_0082410 | Ga0500635_0082410_508_1035 | 155 |
| 151 | 3300053136 | Ga0500559_0105764 | Ga0500559_0105764_337_864 | 155 |
| 152 | 3300053153 | Ga0500616_0036902 | Ga0500616_0036902_551_1057 | 155 |
| 153 | 3300053158 | Ga0500627_0045410 | Ga0500627_0045410_799_1314 | 155 |
| 154 | 3300006048 | Ga0075363_100000092 | Ga0075363_10000009210 | 156 |
| 155 | 3300006051 | Ga0075364_10007671 | Ga0075364_100076717 | 156 |
| 156 | 3300006173 | Ga0070716_100442987 | Ga0070716_1004429871 | 156 |
| 157 | 3300006178 | Ga0075367_10282754 | Ga0075367_102827542 | 156 |
| 158 | 3300006353 | Ga0075370_10054724 | Ga0075370_100547242 | 156 |
| 159 | 3300009176 | Ga0105242_11225223 | Ga0105242_112252231 | 156 |
| 160 | 3300009177 | Ga0105248_10415985 | Ga0105248_104159852 | 156 |
| 161 | 3300025939 | Ga0207665_10367720 | Ga0207665_103677201 | 156 |
| 162 | 3300026075 | Ga0207708_10407303 | Ga0207708_104073032 | 156 |
| 163 | 3300031824 | Ga0307413_10573391 | Ga0307413_105733912 | 156 |
| 164 | 3300031852 | Ga0307410_10390390 | Ga0307410_103903902 | 156 |
| 165 | 3300031995 | Ga0307409_100959164 | Ga0307409_1009591641 | 156 |
| 166 | 3300044656 | Ga0466969_0260317 | Ga0466969_0260317_53_556 | 156 |
| 167 | 3300044658 | Ga0466972_0006973 | Ga0466972_0006973_2575_3078 | 156 |
| 168 | 3300044683 | Ga0466965_0017396 | Ga0466965_0017396_2167_2670 | 156 |
| 169 | 3300044693 | Ga0466961_0024792 | Ga0466961_0024792_712_1215 | 156 |
| 170 | 3300044706 | Ga0466964_0499576 | Ga0466964_0499576_59_535 | 156 |
| 171 | 3300044719 | Ga0466971_0106129 | Ga0466971_0106129_272_775 | 156 |
| 172 | 3300044765 | Ga0466970_0001116 | Ga0466970_0001116_11962_12465 | 156 |
| 173 | 3300044765 | Ga0466970_0052593 | Ga0466970_0052593_716_1198 | 156 |
| 174 | 3300045049 | Ga0466959_0012525 | Ga0466959_0012525_238_741 | 156 |
| 175 | 3300048913 | Ga0496110_1440542 | Ga0496110_1440542_71_547 | 156 |
| 176 | 3300048929 | Ga0496126_0016764 | Ga0496126_0016764_2043_2525 | 156 |
| 177 | 3300050490 | nmdc:mga03n38_498_c1 | nmdc:mga03n38_498_c1_7915_8421 | 156 |
| 178 | 3300050491 | nmdc:mga00v17_6288_c1 | nmdc:mga00v17_6288_c1_2236_2742 | 156 |
| 179 | 3300050494 | nmdc:mga06z11_190771_c1 | nmdc:mga06z11_190771_c1_642_1148 | 156 |
| 180 | 3300050496 | nmdc:mga07m45_10512_c1 | nmdc:mga07m45_10512_c1_2092_2598 | 156 |
| 181 | 3300050516 | nmdc:mga0sz30_14668_c1 | nmdc:mga0sz30_14668_c1_207_713 | 156 |
| 182 | 3300061719 | Ga0466962_0064051 | Ga0466962_0064051_12_515 | 156 |
| 183 | iso_pu_bacteria | 2738541274 | 2738704438 | 156 |
| 184 | iso_pu_bacteria | 2738543028 | 2739331079 | 156 |
| 185 | 3300005367 | Ga0070667_100000190 | Ga0070667_10000019013 | 157 |
| 186 | 3300005548 | Ga0070665_100054494 | Ga0070665_1000544944 | 157 |
| 187 | 3300005617 | Ga0068859_100005865 | Ga0068859_1000058652 | 157 |
| 188 | 3300005618 | Ga0068864_100091698 | Ga0068864_1000916982 | 157 |
| 189 | 3300005841 | Ga0068863_100001346 | Ga0068863_10000134612 | 157 |
| 190 | 3300005842 | Ga0068858_100446852 | Ga0068858_1004468522 | 157 |
| 191 | 3300005843 | Ga0068860_100000099 | Ga0068860_10000009993 | 157 |
| 192 | 3300005844 | Ga0068862_100000086 | Ga0068862_10000008694 | 157 |
| 193 | 3300006931 | Ga0097620_100005865 | Ga0097620_10000586513 | 157 |
| 194 | 3300009101 | Ga0105247_10000051 | Ga0105247_1000005189 | 157 |
| 195 | 3300009177 | Ga0105248_10000339 | Ga0105248_100003392 | 157 |
| 196 | 3300025900 | Ga0207710_10000010 | Ga0207710_10000010178 | 157 |
| 197 | 3300025923 | Ga0207681_10002097 | Ga0207681_100020976 | 157 |
| 198 | 3300025941 | Ga0207711_10000301 | Ga0207711_100003012 | 157 |
| 199 | 3300025986 | Ga0207658_10000138 | Ga0207658_1000013843 | 157 |
| 200 | 3300026088 | Ga0207641_10001050 | Ga0207641_1000105013 | 157 |
| 201 | 3300026095 | Ga0207676_10074733 | Ga0207676_100747332 | 157 |
| 202 | 3300028379 | Ga0268266_10072868 | Ga0268266_100728682 | 157 |
| 203 | 3300028380 | Ga0268265_10000014 | Ga0268265_10000014226 | 157 |
| 204 | 3300028381 | Ga0268264_10000137 | Ga0268264_1000013774 | 157 |
| 205 | 3300048903 | Ga0496100_0041233 | Ga0496100_0041233_928_1437 | 157 |
| 206 | 3300048904 | Ga0496101_0009820 | Ga0496101_0009820_728_1237 | 157 |
| 207 | 3300048905 | Ga0496102_0000118 | Ga0496102_0000118_22316_22825 | 157 |
| 208 | 3300048906 | Ga0496103_0000129 | Ga0496103_0000129_46135_46644 | 157 |
| 209 | 3300048910 | Ga0496107_0016066 | Ga0496107_0016066_235_744 | 157 |
| 210 | 3300048912 | Ga0496109_0257093 | Ga0496109_0257093_752_1261 | 157 |
| 211 | 3300048914 | Ga0496111_0210148 | Ga0496111_0210148_736_1245 | 157 |
| 212 | 3300048917 | Ga0496114_0218137 | Ga0496114_0218137_729_1238 | 157 |
| 213 | 3300048919 | Ga0496116_0072685 | Ga0496116_0072685_886_1395 | 157 |
| 214 | 3300048920 | Ga0496117_0000304 | Ga0496117_0000304_83737_84246 | 157 |
| 215 | 3300048921 | Ga0496118_0001559 | Ga0496118_0001559_25012_25521 | 157 |
| 216 | 3300048922 | Ga0496119_0004722 | Ga0496119_0004722_11875_12384 | 157 |
| 217 | 3300048923 | Ga0496120_0078678 | Ga0496120_0078678_863_1372 | 157 |
| 218 | 3300048924 | Ga0496121_0036684 | Ga0496121_0036684_532_1041 | 157 |
| 219 | 3300048929 | Ga0496126_0003099 | Ga0496126_0003099_3147_3656 | 157 |
| 220 | 3300021384 | Ga0213876_10168431 | Ga0213876_101684312 | 158 |
| 221 | 3300039437 | Ga0436365_1640827 | Ga0436365_1640827_9684_10190 | 158 |
| 222 | 3300049573 | Ga0501037_0594270 | Ga0501037_0594270_242_727 | 158 |
| 223 | 3300049581 | Ga0501047_0015226 | Ga0501047_0015226_3205_3690 | 158 |
| 224 | 3300049586 | Ga0501070_0139895 | Ga0501070_0139895_1380_1865 | 158 |
| 225 | 3300009553 | Ga0105249_12653933 | Ga0105249_126539331 | 159 |
| 226 | 3300048905 | Ga0496102_0089231 | Ga0496102_0089231_1478_1963 | 159 |
| 227 | 3300048906 | Ga0496103_0205468 | Ga0496103_0205468_320_805 | 159 |
| 228 | 3300048908 | Ga0496105_0185865 | Ga0496105_0185865_666_1151 | 159 |
| 229 | 3300048909 | Ga0496106_0343844 | Ga0496106_0343844_20_505 | 159 |
| 230 | 3300048917 | Ga0496114_0346724 | Ga0496114_0346724_642_1127 | 159 |
| 231 | 3300005347 | Ga0070668_100008930 | Ga0070668_1000089304 | 160 |
| 232 | 3300009092 | Ga0105250_10121000 | Ga0105250_101210002 | 160 |
| 233 | 3300025972 | Ga0207668_10002603 | Ga0207668_1000260310 | 160 |
| 234 | 3300046460 | Ga0495638_0033042 | Ga0495638_0033042_2482_2988 | 160 |
| 235 | 3300053104 | Ga0500556_0003368 | Ga0500556_0003368_3856_4362 | 160 |
| 236 | 3300053131 | Ga0500652_063258 | Ga0500652_063258_477_983 | 160 |
| 237 | 3300053142 | Ga0500577_0012053 | Ga0500577_0012053_1151_1657 | 160 |
| 238 | 3300053146 | Ga0500588_0176554 | Ga0500588_0176554_153_659 | 160 |
| 239 | 3300041509 | Ga0451843_0613428 | Ga0451843_0613428_120_638 | 161 |
| 240 | 3300044658 | Ga0466972_0003083 | Ga0466972_0003083_716_1204 | 161 |
| 241 | 3300044683 | Ga0466965_0008833 | Ga0466965_0008833_1577_2065 | 161 |
| 242 | 3300044684 | Ga0466966_0298785 | Ga0466966_0298785_375_863 | 161 |
| 243 | 3300044694 | Ga0466963_0708948 | Ga0466963_0708948_206_694 | 161 |
| 244 | 3300044719 | Ga0466971_0087821 | Ga0466971_0087821_554_1042 | 161 |
| 245 | 3300044735 | Ga0466968_0038061 | Ga0466968_0038061_536_1024 | 161 |
| 246 | 3300044765 | Ga0466970_0076218 | Ga0466970_0076218_603_1091 | 161 |
| 247 | 3300044842 | Ga0466957_0295316 | Ga0466957_0295316_478_966 | 161 |
| 248 | 3300044901 | Ga0466960_0016320 | Ga0466960_0016320_2001_2489 | 161 |
| 249 | 3300045049 | Ga0466959_0024644 | Ga0466959_0024644_3219_3707 | 161 |
| 250 | 3300045976 | Ga0466967_0191213 | Ga0466967_0191213_73_561 | 161 |
| 251 | 3300061719 | Ga0466962_0417171 | Ga0466962_0417171_117_605 | 161 |
| 252 | iso_pu_bacteria | 2939582691 | 2939589166 | 162 |
| 253 | 3300053153 | Ga0500616_0006360 | Ga0500616_0006360_1803_2309 | 163 |
| 254 | 3300005435 | Ga0070714_100037899 | Ga0070714_1000378995 | 164 |
| 255 | 3300005436 | Ga0070713_100020391 | Ga0070713_1000203912 | 164 |
| 256 | 3300005437 | Ga0070710_10007995 | Ga0070710_100079953 | 164 |
| 257 | 3300006028 | Ga0070717_10261911 | Ga0070717_102619112 | 164 |
| 258 | 3300006173 | Ga0070716_100116837 | Ga0070716_1001168372 | 164 |
| 259 | 3300006175 | Ga0070712_100529341 | Ga0070712_1005293411 | 164 |
| 260 | 3300025916 | Ga0207663_10410249 | Ga0207663_104102492 | 164 |
| 261 | 3300025939 | Ga0207665_10231394 | Ga0207665_102313942 | 164 |
| 262 | 3300044693 | Ga0466961_0011981 | Ga0466961_0011981_1004_1504 | 164 |
| 263 | 3300045049 | Ga0466959_0034727 | Ga0466959_0034727_1977_2477 | 164 |
| 264 | 3300047320 | Ga0495672_0249832 | Ga0495672_0249832_181_681 | 164 |
| 265 | 3300048928 | Ga0496125_0190367 | Ga0496125_0190367_129_629 | 164 |
| 266 | 3300053098 | Ga0500650_0070832 | Ga0500650_0070832_775_1275 | 164 |
| 267 | 3300053730 | Ga0500645_058790 | Ga0500645_058790_259_759 | 164 |
| 268 | 3300005435 | Ga0070714_100421264 | Ga0070714_1004212641 | 165 |
| 269 | 3300037853 | Ga0436364_0725072 | Ga0436364_0725072_33_539 | 165 |
| 270 | 3300049823 | Ga0501044_0287611 | Ga0501044_0287611_726_1229 | 165 |
| 271 | 3300053104 | Ga0500556_0041733 | Ga0500556_0041733_1093_1599 | 165 |
| 272 | 3300002070 | JGI24750J21931_1033091 | JGI24750J21931_10330911 | 166 |
| 273 | 3300002074 | JGI24748J21848_1009575 | JGI24748J21848_10095752 | 166 |
| 274 | 3300002076 | JGI24749J21850_1021094 | JGI24749J21850_10210942 | 166 |
| 275 | 3300002077 | JGI24744J21845_10000463 | JGI24744J21845_100004639 | 166 |
| 276 | 3300002239 | JGI24034J26672_10013638 | JGI24034J26672_100136382 | 166 |
| 277 | 3300002239 | JGI24034J26672_10025056 | JGI24034J26672_100250562 | 166 |
| 278 | 3300002459 | JGI24751J29686_10027693 | JGI24751J29686_100276931 | 166 |
| 279 | 3300005329 | Ga0070683_100434795 | Ga0070683_1004347952 | 166 |
| 280 | 3300005330 | Ga0070690_100007309 | Ga0070690_1000073092 | 166 |
| 281 | 3300005331 | Ga0070670_100031486 | Ga0070670_1000314863 | 166 |
| 282 | 3300005334 | Ga0068869_100031587 | Ga0068869_1000315875 | 166 |
| 283 | 3300005334 | Ga0068869_100091634 | Ga0068869_1000916343 | 166 |
| 284 | 3300005335 | Ga0070666_10026947 | Ga0070666_100269474 | 166 |
| 285 | 3300005336 | Ga0070680_100205289 | Ga0070680_1002052892 | 166 |
| 286 | 3300005337 | Ga0070682_100010070 | Ga0070682_1000100709 | 166 |
| 287 | 3300005337 | Ga0070682_100010372 | Ga0070682_1000103724 | 166 |
| 288 | 3300005337 | Ga0070682_100065893 | Ga0070682_1000658934 | 166 |
| 289 | 3300005337 | Ga0070682_100371301 | Ga0070682_1003713012 | 166 |
| 290 | 3300005338 | Ga0068868_100000227 | Ga0068868_10000022719 | 166 |
| 291 | 3300005339 | Ga0070660_100169774 | Ga0070660_1001697742 | 166 |
| 292 | 3300005340 | Ga0070689_100080916 | Ga0070689_1000809162 | 166 |
| 293 | 3300005341 | Ga0070691_10012681 | Ga0070691_100126814 | 166 |
| 294 | 3300005341 | Ga0070691_10020911 | Ga0070691_100209112 | 166 |
| 295 | 3300005345 | Ga0070692_10137121 | Ga0070692_101371211 | 166 |
| 296 | 3300005347 | Ga0070668_100004054 | Ga0070668_1000040545 | 166 |
| 297 | 3300005347 | Ga0070668_100100583 | Ga0070668_1001005833 | 166 |
| 298 | 3300005347 | Ga0070668_100715813 | Ga0070668_1007158132 | 166 |
| 299 | 3300005353 | Ga0070669_100063130 | Ga0070669_1000631304 | 166 |
| 300 | 3300005355 | Ga0070671_100007716 | Ga0070671_1000077162 | 166 |
| 301 | 3300005355 | Ga0070671_100043898 | Ga0070671_1000438985 | 166 |
| 302 | 3300005356 | Ga0070674_100000223 | Ga0070674_10000022328 | 166 |
| 303 | 3300005356 | Ga0070674_100760108 | Ga0070674_1007601082 | 166 |
| 304 | 3300005365 | Ga0070688_100018740 | Ga0070688_1000187402 | 166 |
| 305 | 3300005366 | Ga0070659_100171375 | Ga0070659_1001713752 | 166 |
| 306 | 3300005367 | Ga0070667_100014397 | Ga0070667_1000143973 | 166 |
| 307 | 3300005367 | Ga0070667_100153415 | Ga0070667_1001534153 | 166 |
| 308 | 3300005367 | Ga0070667_100618509 | Ga0070667_1006185092 | 166 |
| 309 | 3300005434 | Ga0070709_10051067 | Ga0070709_100510675 | 166 |
| 310 | 3300005435 | Ga0070714_100106423 | Ga0070714_1001064232 | 166 |
| 311 | 3300005437 | Ga0070710_10001219 | Ga0070710_100012196 | 166 |
| 312 | 3300005437 | Ga0070710_10005585 | Ga0070710_100055854 | 166 |
| 313 | 3300005438 | Ga0070701_10000228 | Ga0070701_1000022824 | 166 |
| 314 | 3300005439 | Ga0070711_100000141 | Ga0070711_10000014139 | 166 |
| 315 | 3300005439 | Ga0070711_100003908 | Ga0070711_1000039083 | 166 |
| 316 | 3300005440 | Ga0070705_100194688 | Ga0070705_1001946882 | 166 |
| 317 | 3300005441 | Ga0070700_100017490 | Ga0070700_1000174903 | 166 |
| 318 | 3300005441 | Ga0070700_100063552 | Ga0070700_1000635524 | 166 |
| 319 | 3300005444 | Ga0070694_100006459 | Ga0070694_1000064598 | 166 |
| 320 | 3300005455 | Ga0070663_100005376 | Ga0070663_1000053764 | 166 |
| 321 | 3300005455 | Ga0070663_100011553 | Ga0070663_1000115537 | 166 |
| 322 | 3300005455 | Ga0070663_100368779 | Ga0070663_1003687791 | 166 |
| 323 | 3300005456 | Ga0070678_100001400 | Ga0070678_10000140010 | 166 |
| 324 | 3300005456 | Ga0070678_100033449 | Ga0070678_1000334492 | 166 |
| 325 | 3300005456 | Ga0070678_100143105 | Ga0070678_1001431052 | 166 |
| 326 | 3300005457 | Ga0070662_100010632 | Ga0070662_1000106329 | 166 |
| 327 | 3300005457 | Ga0070662_100473987 | Ga0070662_1004739872 | 166 |
| 328 | 3300005457 | Ga0070662_100477121 | Ga0070662_1004771211 | 166 |
| 329 | 3300005459 | Ga0068867_100003180 | Ga0068867_1000031808 | 166 |
| 330 | 3300005466 | Ga0070685_10198667 | Ga0070685_101986672 | 166 |
| 331 | 3300005536 | Ga0070697_100857464 | Ga0070697_1008574642 | 166 |
| 332 | 3300005539 | Ga0068853_100005781 | Ga0068853_1000057812 | 166 |
| 333 | 3300005539 | Ga0068853_100160522 | Ga0068853_1001605222 | 166 |
| 334 | 3300005543 | Ga0070672_100098442 | Ga0070672_1000984422 | 166 |
| 335 | 3300005544 | Ga0070686_100113787 | Ga0070686_1001137873 | 166 |
| 336 | 3300005545 | Ga0070695_100296411 | Ga0070695_1002964112 | 166 |
| 337 | 3300005546 | Ga0070696_100175599 | Ga0070696_1001755992 | 166 |
| 338 | 3300005547 | Ga0070693_100012047 | Ga0070693_1000120475 | 166 |
| 339 | 3300005547 | Ga0070693_100781726 | Ga0070693_1007817261 | 166 |
| 340 | 3300005548 | Ga0070665_100013464 | Ga0070665_1000134649 | 166 |
| 341 | 3300005548 | Ga0070665_100014376 | Ga0070665_1000143768 | 166 |
| 342 | 3300005548 | Ga0070665_100300849 | Ga0070665_1003008492 | 166 |
| 343 | 3300005549 | Ga0070704_100000712 | Ga0070704_10000071214 | 166 |
| 344 | 3300005549 | Ga0070704_100189676 | Ga0070704_1001896762 | 166 |
| 345 | 3300005563 | Ga0068855_100043985 | Ga0068855_1000439857 | 166 |
| 346 | 3300005564 | Ga0070664_100238794 | Ga0070664_1002387942 | 166 |
| 347 | 3300005578 | Ga0068854_100000492 | Ga0068854_10000049218 | 166 |
| 348 | 3300005578 | Ga0068854_100077794 | Ga0068854_1000777942 | 166 |
| 349 | 3300005578 | Ga0068854_101435636 | Ga0068854_1014356361 | 166 |
| 350 | 3300005614 | Ga0068856_100539368 | Ga0068856_1005393682 | 166 |
| 351 | 3300005615 | Ga0070702_100001938 | Ga0070702_1000019388 | 166 |
| 352 | 3300005615 | Ga0070702_100687643 | Ga0070702_1006876431 | 166 |
| 353 | 3300005616 | Ga0068852_100104127 | Ga0068852_1001041273 | 166 |
| 354 | 3300005617 | Ga0068859_100003815 | Ga0068859_1000038152 | 166 |
| 355 | 3300005617 | Ga0068859_100275604 | Ga0068859_1002756044 | 166 |
| 356 | 3300005617 | Ga0068859_100389408 | Ga0068859_1003894083 | 166 |
| 357 | 3300005618 | Ga0068864_100065577 | Ga0068864_1000655772 | 166 |
| 358 | 3300005618 | Ga0068864_100457140 | Ga0068864_1004571402 | 166 |
| 359 | 3300005618 | Ga0068864_101167259 | Ga0068864_1011672591 | 166 |
| 360 | 3300005718 | Ga0068866_10000345 | Ga0068866_1000034514 | 166 |
| 361 | 3300005718 | Ga0068866_10041768 | Ga0068866_100417682 | 166 |
| 362 | 3300005719 | Ga0068861_100001560 | Ga0068861_10000156019 | 166 |
| 363 | 3300005719 | Ga0068861_100157582 | Ga0068861_1001575822 | 166 |
| 364 | 3300005841 | Ga0068863_100007330 | Ga0068863_1000073309 | 166 |
| 365 | 3300005841 | Ga0068863_100059644 | Ga0068863_1000596442 | 166 |
| 366 | 3300005841 | Ga0068863_100134869 | Ga0068863_1001348693 | 166 |
| 367 | 3300005842 | Ga0068858_100003458 | Ga0068858_10000345825 | 166 |
| 368 | 3300005842 | Ga0068858_100495156 | Ga0068858_1004951562 | 166 |
| 369 | 3300005843 | Ga0068860_100000971 | Ga0068860_10000097130 | 166 |
| 370 | 3300005843 | Ga0068860_100119478 | Ga0068860_1001194783 | 166 |
| 371 | 3300005844 | Ga0068862_100006044 | Ga0068862_1000060442 | 166 |
| 372 | 3300005844 | Ga0068862_100185425 | Ga0068862_1001854252 | 166 |
| 373 | 3300005937 | Ga0081455_10038937 | Ga0081455_100389374 | 166 |
| 374 | 3300005981 | Ga0081538_10066974 | Ga0081538_100669743 | 166 |
| 375 | 3300006038 | Ga0075365_10047190 | Ga0075365_100471904 | 166 |
| 376 | 3300006048 | Ga0075363_100006312 | Ga0075363_1000063122 | 166 |
| 377 | 3300006048 | Ga0075363_100019432 | Ga0075363_1000194325 | 166 |
| 378 | 3300006048 | Ga0075363_100097136 | Ga0075363_1000971362 | 166 |
| 379 | 3300006048 | Ga0075363_100101914 | Ga0075363_1001019142 | 166 |
| 380 | 3300006048 | Ga0075363_100210492 | Ga0075363_1002104922 | 166 |
| 381 | 3300006048 | Ga0075363_100253855 | Ga0075363_1002538552 | 166 |
| 382 | 3300006051 | Ga0075364_10000628 | Ga0075364_1000062810 | 166 |
| 383 | 3300006051 | Ga0075364_10002372 | Ga0075364_1000237210 | 166 |
| 384 | 3300006051 | Ga0075364_10008061 | Ga0075364_100080617 | 166 |
| 385 | 3300006051 | Ga0075364_10480315 | Ga0075364_104803151 | 166 |
| 386 | 3300006163 | Ga0070715_10004747 | Ga0070715_100047475 | 166 |
| 387 | 3300006163 | Ga0070715_10177847 | Ga0070715_101778472 | 166 |
| 388 | 3300006173 | Ga0070716_100001458 | Ga0070716_1000014583 | 166 |
| 389 | 3300006175 | Ga0070712_100000607 | Ga0070712_10000060714 | 166 |
| 390 | 3300006175 | Ga0070712_100027836 | Ga0070712_1000278366 | 166 |
| 391 | 3300006177 | Ga0075362_10069694 | Ga0075362_100696943 | 166 |
| 392 | 3300006178 | Ga0075367_10010088 | Ga0075367_100100882 | 166 |
| 393 | 3300006178 | Ga0075367_10056712 | Ga0075367_100567123 | 166 |
| 394 | 3300006178 | Ga0075367_10209963 | Ga0075367_102099632 | 166 |
| 395 | 3300006186 | Ga0075369_10002372 | Ga0075369_100023727 | 166 |
| 396 | 3300006186 | Ga0075369_10014693 | Ga0075369_100146934 | 166 |
| 397 | 3300006186 | Ga0075369_10050856 | Ga0075369_100508562 | 166 |
| 398 | 3300006186 | Ga0075369_10250351 | Ga0075369_102503511 | 166 |
| 399 | 3300006237 | Ga0097621_100369637 | Ga0097621_1003696372 | 166 |
| 400 | 3300006353 | Ga0075370_10085933 | Ga0075370_100859332 | 166 |
| 401 | 3300006353 | Ga0075370_10268511 | Ga0075370_102685112 | 166 |
| 402 | 3300006353 | Ga0075370_10342781 | Ga0075370_103427811 | 166 |
| 403 | 3300006358 | Ga0068871_100143544 | Ga0068871_1001435442 | 166 |
| 404 | 3300006844 | Ga0075428_100001179 | Ga0075428_1000011798 | 166 |
| 405 | 3300006846 | Ga0075430_100092657 | Ga0075430_1000926573 | 166 |
| 406 | 3300006846 | Ga0075430_100176930 | Ga0075430_1001769302 | 166 |
| 407 | 3300006847 | Ga0075431_100009007 | Ga0075431_10000900713 | 166 |
| 408 | 3300006871 | Ga0075434_100862359 | Ga0075434_1008623592 | 166 |
| 409 | 3300006880 | Ga0075429_100197257 | Ga0075429_1001972571 | 166 |
| 410 | 3300006881 | Ga0068865_100001324 | Ga0068865_10000132411 | 166 |
| 411 | 3300006881 | Ga0068865_100102934 | Ga0068865_1001029343 | 166 |
| 412 | 3300006931 | Ga0097620_100003815 | Ga0097620_1000038152 | 166 |
| 413 | 3300006931 | Ga0097620_100275605 | Ga0097620_1002756052 | 166 |
| 414 | 3300006931 | Ga0097620_100389447 | Ga0097620_1003894473 | 166 |
| 415 | 3300007788 | Ga0099795_10013911 | Ga0099795_100139113 | 166 |
| 416 | 3300009093 | Ga0105240_11128359 | Ga0105240_111283592 | 166 |
| 417 | 3300009094 | Ga0111539_10733351 | Ga0111539_107333511 | 166 |
| 418 | 3300009098 | Ga0105245_10000678 | Ga0105245_1000067827 | 166 |
| 419 | 3300009101 | Ga0105247_10001857 | Ga0105247_100018572 | 166 |
| 420 | 3300009147 | Ga0114129_10024772 | Ga0114129_100247724 | 166 |
| 421 | 3300009148 | Ga0105243_10000534 | Ga0105243_1000053417 | 166 |
| 422 | 3300009174 | Ga0105241_10020235 | Ga0105241_100202355 | 166 |
| 423 | 3300009176 | Ga0105242_10000328 | Ga0105242_100003282 | 166 |
| 424 | 3300009177 | Ga0105248_10000842 | Ga0105248_1000084221 | 166 |
| 425 | 3300010159 | Ga0099796_10012357 | Ga0099796_100123572 | 166 |
| 426 | 3300010375 | Ga0105239_10012440 | Ga0105239_100124409 | 166 |
| 427 | 3300013296 | Ga0157374_10966538 | Ga0157374_109665382 | 166 |
| 428 | 3300013297 | Ga0157378_10001491 | Ga0157378_1000149111 | 166 |
| 429 | 3300013306 | Ga0163162_10337334 | Ga0163162_103373342 | 166 |
| 430 | 3300013306 | Ga0163162_10573343 | Ga0163162_105733432 | 166 |
| 431 | 3300013307 | Ga0157372_10052464 | Ga0157372_100524642 | 166 |
| 432 | 3300014325 | Ga0163163_10002474 | Ga0163163_1000247419 | 166 |
| 433 | 3300014326 | Ga0157380_10003919 | Ga0157380_100039197 | 166 |
| 434 | 3300014745 | Ga0157377_10235151 | Ga0157377_102351512 | 166 |
| 435 | 3300014968 | Ga0157379_10004006 | Ga0157379_100040069 | 166 |
| 436 | 3300014969 | Ga0157376_10084506 | Ga0157376_100845062 | 166 |
| 437 | 3300017792 | Ga0163161_10001669 | Ga0163161_100016699 | 166 |
| 438 | 3300017792 | Ga0163161_10012322 | Ga0163161_100123222 | 166 |
| 439 | 3300025303 | Ga0209051_1000021 | Ga0209051_1000021139 | 166 |
| 440 | 3300025898 | Ga0207692_10009243 | Ga0207692_100092435 | 166 |
| 441 | 3300025899 | Ga0207642_10000241 | Ga0207642_1000024114 | 166 |
| 442 | 3300025899 | Ga0207642_10016135 | Ga0207642_100161352 | 166 |
| 443 | 3300025900 | Ga0207710_10007136 | Ga0207710_100071362 | 166 |
| 444 | 3300025900 | Ga0207710_10429077 | Ga0207710_104290772 | 166 |
| 445 | 3300025901 | Ga0207688_10000427 | Ga0207688_1000042713 | 166 |
| 446 | 3300025901 | Ga0207688_10001234 | Ga0207688_100012342 | 166 |
| 447 | 3300025903 | Ga0207680_10213389 | Ga0207680_102133892 | 166 |
| 448 | 3300025904 | Ga0207647_10116939 | Ga0207647_101169392 | 166 |
| 449 | 3300025905 | Ga0207685_10011792 | Ga0207685_100117924 | 166 |
| 450 | 3300025905 | Ga0207685_10045983 | Ga0207685_100459831 | 166 |
| 451 | 3300025906 | Ga0207699_10011688 | Ga0207699_100116884 | 166 |
| 452 | 3300025906 | Ga0207699_10012233 | Ga0207699_100122336 | 166 |
| 453 | 3300025907 | Ga0207645_10071186 | Ga0207645_100711862 | 166 |
| 454 | 3300025908 | Ga0207643_10174110 | Ga0207643_101741102 | 166 |
| 455 | 3300025911 | Ga0207654_10055015 | Ga0207654_100550154 | 166 |
| 456 | 3300025913 | Ga0207695_10834189 | Ga0207695_108341891 | 166 |
| 457 | 3300025914 | Ga0207671_10127158 | Ga0207671_101271583 | 166 |
| 458 | 3300025915 | Ga0207693_10001162 | Ga0207693_1000116217 | 166 |
| 459 | 3300025915 | Ga0207693_10002211 | Ga0207693_100022116 | 166 |
| 460 | 3300025916 | Ga0207663_10000264 | Ga0207663_1000026418 | 166 |
| 461 | 3300025916 | Ga0207663_10006459 | Ga0207663_100064596 | 166 |
| 462 | 3300025917 | Ga0207660_10206788 | Ga0207660_102067882 | 166 |
| 463 | 3300025919 | Ga0207657_10088328 | Ga0207657_100883283 | 166 |
| 464 | 3300025923 | Ga0207681_10060089 | Ga0207681_100600892 | 166 |
| 465 | 3300025924 | Ga0207694_10652284 | Ga0207694_106522841 | 166 |
| 466 | 3300025925 | Ga0207650_10464444 | Ga0207650_104644442 | 166 |
| 467 | 3300025926 | Ga0207659_10143551 | Ga0207659_101435512 | 166 |
| 468 | 3300025927 | Ga0207687_10001116 | Ga0207687_1000111610 | 166 |
| 469 | 3300025927 | Ga0207687_10047008 | Ga0207687_100470082 | 166 |
| 470 | 3300025928 | Ga0207700_10391942 | Ga0207700_103919422 | 166 |
| 471 | 3300025929 | Ga0207664_10201017 | Ga0207664_102010172 | 166 |
| 472 | 3300025931 | Ga0207644_10004614 | Ga0207644_1000461411 | 166 |
| 473 | 3300025931 | Ga0207644_10176599 | Ga0207644_101765992 | 166 |
| 474 | 3300025933 | Ga0207706_10012871 | Ga0207706_100128719 | 166 |
| 475 | 3300025933 | Ga0207706_10174203 | Ga0207706_101742033 | 166 |
| 476 | 3300025934 | Ga0207686_10005970 | Ga0207686_100059702 | 166 |
| 477 | 3300025934 | Ga0207686_10026557 | Ga0207686_100265574 | 166 |
| 478 | 3300025935 | Ga0207709_10014636 | Ga0207709_100146364 | 166 |
| 479 | 3300025935 | Ga0207709_10597074 | Ga0207709_105970741 | 166 |
| 480 | 3300025935 | Ga0207709_11444106 | Ga0207709_114441061 | 166 |
| 481 | 3300025936 | Ga0207670_10128409 | Ga0207670_101284092 | 166 |
| 482 | 3300025936 | Ga0207670_10441742 | Ga0207670_104417422 | 166 |
| 483 | 3300025937 | Ga0207669_10003531 | Ga0207669_1000353110 | 166 |
| 484 | 3300025937 | Ga0207669_10199713 | Ga0207669_101997131 | 166 |
| 485 | 3300025938 | Ga0207704_10000621 | Ga0207704_1000062113 | 166 |
| 486 | 3300025939 | Ga0207665_10002223 | Ga0207665_100022232 | 166 |
| 487 | 3300025939 | Ga0207665_10003744 | Ga0207665_100037447 | 166 |
| 488 | 3300025939 | Ga0207665_10244953 | Ga0207665_102449532 | 166 |
| 489 | 3300025940 | Ga0207691_10134866 | Ga0207691_101348662 | 166 |
| 490 | 3300025941 | Ga0207711_10011033 | Ga0207711_1001103310 | 166 |
| 491 | 3300025941 | Ga0207711_11477164 | Ga0207711_114771641 | 166 |
| 492 | 3300025942 | Ga0207689_10132614 | Ga0207689_101326142 | 166 |
| 493 | 3300025945 | Ga0207679_10262469 | Ga0207679_102624692 | 166 |
| 494 | 3300025949 | Ga0207667_10389193 | Ga0207667_103891932 | 166 |
| 495 | 3300025960 | Ga0207651_10568873 | Ga0207651_105688731 | 166 |
| 496 | 3300025961 | Ga0207712_10005160 | Ga0207712_100051608 | 166 |
| 497 | 3300025961 | Ga0207712_10012964 | Ga0207712_100129642 | 166 |
| 498 | 3300025961 | Ga0207712_10311836 | Ga0207712_103118361 | 166 |
| 499 | 3300025972 | Ga0207668_10001338 | Ga0207668_1000133818 | 166 |
| 500 | 3300025972 | Ga0207668_10087665 | Ga0207668_100876654 | 166 |
| 501 | 3300025981 | Ga0207640_10001865 | Ga0207640_1000186517 | 166 |
| 502 | 3300025981 | Ga0207640_10665501 | Ga0207640_106655011 | 166 |
| 503 | 3300025981 | Ga0207640_10885200 | Ga0207640_108852002 | 166 |
| 504 | 3300025986 | Ga0207658_10011329 | Ga0207658_100113292 | 166 |
| 505 | 3300025986 | Ga0207658_10149779 | Ga0207658_101497792 | 166 |
| 506 | 3300025986 | Ga0207658_10364748 | Ga0207658_103647482 | 166 |
| 507 | 3300025986 | Ga0207658_10800937 | Ga0207658_108009372 | 166 |
| 508 | 3300026023 | Ga0207677_10001437 | Ga0207677_1000143713 | 166 |
| 509 | 3300026023 | Ga0207677_10200329 | Ga0207677_102003293 | 166 |
| 510 | 3300026041 | Ga0207639_10040020 | Ga0207639_100400204 | 166 |
| 511 | 3300026041 | Ga0207639_10171812 | Ga0207639_101718122 | 166 |
| 512 | 3300026041 | Ga0207639_10946749 | Ga0207639_109467492 | 166 |
| 513 | 3300026067 | Ga0207678_10009628 | Ga0207678_100096289 | 166 |
| 514 | 3300026067 | Ga0207678_10012044 | Ga0207678_100120444 | 166 |
| 515 | 3300026067 | Ga0207678_10021794 | Ga0207678_100217948 | 166 |
| 516 | 3300026075 | Ga0207708_10016016 | Ga0207708_100160164 | 166 |
| 517 | 3300026075 | Ga0207708_10052297 | Ga0207708_100522973 | 166 |
| 518 | 3300026088 | Ga0207641_10213098 | Ga0207641_102130983 | 166 |
| 519 | 3300026088 | Ga0207641_10902839 | Ga0207641_109028392 | 166 |
| 520 | 3300026089 | Ga0207648_10000085 | Ga0207648_1000008585 | 166 |
| 521 | 3300026089 | Ga0207648_10026164 | Ga0207648_100261646 | 166 |
| 522 | 3300026095 | Ga0207676_10070562 | Ga0207676_100705624 | 166 |
| 523 | 3300026095 | Ga0207676_10078661 | Ga0207676_100786612 | 166 |
| 524 | 3300026095 | Ga0207676_10379107 | Ga0207676_103791071 | 166 |
| 525 | 3300026095 | Ga0207676_10792313 | Ga0207676_107923131 | 166 |
| 526 | 3300026118 | Ga0207675_100010626 | Ga0207675_1000106262 | 166 |
| 527 | 3300026118 | Ga0207675_100217198 | Ga0207675_1002171983 | 166 |
| 528 | 3300026118 | Ga0207675_100338192 | Ga0207675_1003381921 | 166 |
| 529 | 3300026121 | Ga0207683_10000040 | Ga0207683_1000004015 | 166 |
| 530 | 3300026121 | Ga0207683_10053379 | Ga0207683_100533792 | 166 |
| 531 | 3300026142 | Ga0207698_10219016 | Ga0207698_102190162 | 166 |
| 532 | 3300026142 | Ga0207698_10987316 | Ga0207698_109873161 | 166 |
| 533 | 3300027512 | Ga0209179_1011560 | Ga0209179_10115602 | 166 |
| 534 | 3300027866 | Ga0209813_10086999 | Ga0209813_100869992 | 166 |
| 535 | 3300028379 | Ga0268266_10016548 | Ga0268266_100165487 | 166 |
| 536 | 3300028379 | Ga0268266_10205587 | Ga0268266_102055872 | 166 |
| 537 | 3300028379 | Ga0268266_10291797 | Ga0268266_102917971 | 166 |
| 538 | 3300028379 | Ga0268266_10382682 | Ga0268266_103826822 | 166 |
| 539 | 3300028380 | Ga0268265_10020473 | Ga0268265_100204735 | 166 |
| 540 | 3300028381 | Ga0268264_10000983 | Ga0268264_1000098328 | 166 |
| 541 | 3300028381 | Ga0268264_10249385 | Ga0268264_102493852 | 166 |
| 542 | 3300028381 | Ga0268264_10965613 | Ga0268264_109656132 | 166 |
| 543 | 3300031731 | Ga0307405_10173113 | Ga0307405_101731132 | 166 |
| 544 | 3300031824 | Ga0307413_10181182 | Ga0307413_101811822 | 166 |
| 545 | 3300031852 | Ga0307410_10062066 | Ga0307410_100620662 | 166 |
| 546 | 3300031903 | Ga0307407_10299614 | Ga0307407_102996142 | 166 |
| 547 | 3300031911 | Ga0307412_11369526 | Ga0307412_113695261 | 166 |
| 548 | 3300031995 | Ga0307409_100166827 | Ga0307409_1001668272 | 166 |
| 549 | 3300032002 | Ga0307416_100669382 | Ga0307416_1006693822 | 166 |
| 550 | 3300032004 | Ga0307414_10564690 | Ga0307414_105646901 | 166 |
| 551 | 3300032005 | Ga0307411_10411288 | Ga0307411_104112881 | 166 |
| 552 | 3300032126 | Ga0307415_100235662 | Ga0307415_1002356622 | 166 |
| 553 | 3300035088 | Ga0373940_0221083 | Ga0373940_0221083_61_564 | 166 |
| 554 | 3300035091 | Ga0373951_0044105 | Ga0373951_0044105_540_1043 | 166 |
| 555 | 3300035121 | Ga0373960_0088793 | Ga0373960_0088793_12_515 | 166 |
| 556 | 3300035691 | Ga0373931_0031990 | Ga0373931_0031990_468_971 | 166 |
| 557 | 3300037418 | Ga0395900_0942841 | Ga0395900_0942841_13_516 | 166 |
| 558 | 3300037466 | Ga0395898_1819952 | Ga0395898_1819952_13_516 | 166 |
| 559 | 3300039437 | Ga0436365_0607166 | Ga0436365_0607166_477_983 | 166 |
| 560 | 3300039437 | Ga0436365_1177168 | Ga0436365_1177168_4888_5397 | 166 |
| 561 | 3300039450 | Ga0436363_0182495 | Ga0436363_0182495_51_560 | 166 |
| 562 | 3300041410 | Ga0439461_0001144 | Ga0439461_0001144_763_1266 | 166 |
| 563 | 3300041411 | Ga0439466_0028779 | Ga0439466_0028779_1126_1629 | 166 |
| 564 | 3300041411 | Ga0439466_0105135 | Ga0439466_0105135_280_783 | 166 |
| 565 | 3300041411 | Ga0439466_0120704 | Ga0439466_0120704_225_728 | 166 |
| 566 | 3300041413 | Ga0439465_0022979 | Ga0439465_0022979_808_1311 | 166 |
| 567 | 3300042435 | Ga0439434_0011814 | Ga0439434_0011814_1981_2484 | 166 |
| 568 | 3300044683 | Ga0466965_0036885 | Ga0466965_0036885_1705_2241 | 166 |
| 569 | 3300044901 | Ga0466960_0093886 | Ga0466960_0093886_81_584 | 166 |
| 570 | 3300045836 | Ga0466958_0457874 | Ga0466958_0457874_104_613 | 166 |
| 571 | 3300045976 | Ga0466967_0049434 | Ga0466967_0049434_2006_2515 | 166 |
| 572 | 3300045976 | Ga0466967_0125293 | Ga0466967_0125293_216_722 | 166 |
| 573 | 3300045976 | Ga0466967_0827053 | Ga0466967_0827053_259_762 | 166 |
| 574 | 3300046506 | Ga0495583_0292731 | Ga0495583_0292731_10_513 | 166 |
| 575 | 3300046513 | Ga0495616_0170941 | Ga0495616_0170941_41_547 | 166 |
| 576 | 3300046694 | Ga0495649_0143517 | Ga0495649_0143517_726_1229 | 166 |
| 577 | 3300047320 | Ga0495672_0107481 | Ga0495672_0107481_400_903 | 166 |
| 578 | 3300047320 | Ga0495672_0173434 | Ga0495672_0173434_579_1082 | 166 |
| 579 | 3300048088 | Ga0495602_0686450 | Ga0495602_0686450_51_566 | 166 |
| 580 | 3300048904 | Ga0496101_0001844 | Ga0496101_0001844_9706_10209 | 166 |
| 581 | 3300048904 | Ga0496101_0007711 | Ga0496101_0007711_4206_4766 | 166 |
| 582 | 3300048904 | Ga0496101_0594179 | Ga0496101_0594179_247_750 | 166 |
| 583 | 3300048905 | Ga0496102_0004227 | Ga0496102_0004227_7174_7677 | 166 |
| 584 | 3300048905 | Ga0496102_0005536 | Ga0496102_0005536_6255_6815 | 166 |
| 585 | 3300048905 | Ga0496102_0249032 | Ga0496102_0249032_573_1079 | 166 |
| 586 | 3300048905 | Ga0496102_0343136 | Ga0496102_0343136_561_1067 | 166 |
| 587 | 3300048906 | Ga0496103_0061224 | Ga0496103_0061224_353_913 | 166 |
| 588 | 3300048906 | Ga0496103_0092004 | Ga0496103_0092004_957_1460 | 166 |
| 589 | 3300048906 | Ga0496103_0619317 | Ga0496103_0619317_19_522 | 166 |
| 590 | 3300048907 | Ga0496104_0007843 | Ga0496104_0007843_6598_7101 | 166 |
| 591 | 3300048907 | Ga0496104_0277844 | Ga0496104_0277844_1074_1574 | 166 |
| 592 | 3300048908 | Ga0496105_0381037 | Ga0496105_0381037_187_747 | 166 |
| 593 | 3300048909 | Ga0496106_0001227 | Ga0496106_0001227_6760_7263 | 166 |
| 594 | 3300048910 | Ga0496107_0001410 | Ga0496107_0001410_3116_3619 | 166 |
| 595 | 3300048910 | Ga0496107_0343306 | Ga0496107_0343306_158_718 | 166 |
| 596 | 3300048911 | Ga0496108_0063232 | Ga0496108_0063232_1594_2094 | 166 |
| 597 | 3300048911 | Ga0496108_0134748 | Ga0496108_0134748_537_1043 | 166 |
| 598 | 3300048912 | Ga0496109_0067894 | Ga0496109_0067894_1475_1975 | 166 |
| 599 | 3300048913 | Ga0496110_0034275 | Ga0496110_0034275_3118_3621 | 166 |
| 600 | 3300048913 | Ga0496110_0306324 | Ga0496110_0306324_168_668 | 166 |
| 601 | 3300048914 | Ga0496111_0233083 | Ga0496111_0233083_717_1277 | 166 |
| 602 | 3300048914 | Ga0496111_0267080 | Ga0496111_0267080_494_994 | 166 |
| 603 | 3300048915 | Ga0496112_0066915 | Ga0496112_0066915_1274_1774 | 166 |
| 604 | 3300048916 | Ga0496113_0078719 | Ga0496113_0078719_1689_2189 | 166 |
| 605 | 3300048916 | Ga0496113_0217941 | Ga0496113_0217941_570_1130 | 166 |
| 606 | 3300048916 | Ga0496113_0654535 | Ga0496113_0654535_48_551 | 166 |
| 607 | 3300048917 | Ga0496114_0003967 | Ga0496114_0003967_689_1192 | 166 |
| 608 | 3300048917 | Ga0496114_0305118 | Ga0496114_0305118_211_714 | 166 |
| 609 | 3300048918 | Ga0496115_0004528 | Ga0496115_0004528_3706_4209 | 166 |
| 610 | 3300048921 | Ga0496118_0000341 | Ga0496118_0000341_46380_46886 | 166 |
| 611 | 3300048929 | Ga0496126_0488989 | Ga0496126_0488989_76_582 | 166 |
| 612 | 3300049570 | Ga0501033_0090630 | Ga0501033_0090630_349_858 | 166 |
| 613 | 3300049571 | Ga0501034_0095168 | Ga0501034_0095168_2012_2515 | 166 |
| 614 | 3300049581 | Ga0501047_0417136 | Ga0501047_0417136_127_630 | 166 |
| 615 | 3300049742 | Ga0501080_0877617 | Ga0501080_0877617_148_651 | 166 |
| 616 | 3300049822 | Ga0501035_0276189 | Ga0501035_0276189_408_917 | 166 |
| 617 | 3300050489 | nmdc:mga03683_45385_c1 | nmdc:mga03683_45385_c1_901_1404 | 166 |
| 618 | 3300050490 | nmdc:mga03n38_128167_c1 | nmdc:mga03n38_128167_c1_297_800 | 166 |
| 619 | 3300050490 | nmdc:mga03n38_145986_c1 | nmdc:mga03n38_145986_c1_444_947 | 166 |
| 620 | 3300050490 | nmdc:mga03n38_146469_c1 | nmdc:mga03n38_146469_c1_386_889 | 166 |
| 621 | 3300050490 | nmdc:mga03n38_213511_c1 | nmdc:mga03n38_213511_c1_287_790 | 166 |
| 622 | 3300050490 | nmdc:mga03n38_31418_c1 | nmdc:mga03n38_31418_c1_601_1104 | 166 |
| 623 | 3300050491 | nmdc:mga00v17_4797_c1 | nmdc:mga00v17_4797_c1_3351_3854 | 166 |
| 624 | 3300050491 | nmdc:mga00v17_4944_c1 | nmdc:mga00v17_4944_c1_3480_3983 | 166 |
| 625 | 3300050494 | nmdc:mga06z11_114290_c1 | nmdc:mga06z11_114290_c1_284_787 | 166 |
| 626 | 3300050496 | nmdc:mga07m45_273574_c1 | nmdc:mga07m45_273574_c1_276_779 | 166 |
| 627 | 3300050496 | nmdc:mga07m45_3531_c1 | nmdc:mga07m45_3531_c1_6516_7019 | 166 |
| 628 | 3300050507 | nmdc:mga05p37_723596_c1 | nmdc:mga05p37_723596_c1_22_525 | 166 |
| 629 | 3300050508 | nmdc:mga09592_711915_c1 | nmdc:mga09592_711915_c1_297_800 | 166 |
| 630 | 3300050509 | nmdc:mga0qj67_245454_c1 | nmdc:mga0qj67_245454_c1_147_650 | 166 |
| 631 | 3300050509 | nmdc:mga0qj67_98568_c1 | nmdc:mga0qj67_98568_c1_191_694 | 166 |
| 632 | 3300050512 | nmdc:mga0n895_757912_c1 | nmdc:mga0n895_757912_c1_281_829 | 166 |
| 633 | 3300050516 | nmdc:mga0sz30_14998_c1 | nmdc:mga0sz30_14998_c1_2092_2595 | 166 |
| 634 | 3300050516 | nmdc:mga0sz30_2809_c1 | nmdc:mga0sz30_2809_c1_3869_4372 | 166 |
| 635 | 3300053138 | Ga0500564_178160 | Ga0500564_178160_19_555 | 166 |
| 636 | 3300061719 | Ga0466962_0070005 | Ga0466962_0070005_731_1240 | 166 |
| 637 | iso_pu_bacteria | 2738541264 | 2738665379 | 166 |
| 638 | iso_pu_bacteria | 2738541356 | 2739144513 | 166 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1lu4-assembly1.cif.gz_A | 1.1 angstrom resolution crystal structure of a secreted mycobacterium tuberculosis disulfide oxidoreductase homologous to e. coli dsbe: implications for functions | 0.9867 | 32 | 164 |
| 1lu4-assembly1.cif.gz_A | 1.1 angstrom resolution crystal structure of a secreted mycobacterium tuberculosis disulfide oxidoreductase homologous to e. coli dsbe: implications for functions | 0.9722 | 32 | 164 |
| 3ios-assembly1.cif.gz_A | structure of mtb dsbf in its mixed oxidized and reduced forms | 0.9557 | 31 | 165 |
| 3ios-assembly1.cif.gz_A | structure of mtb dsbf in its mixed oxidized and reduced forms | 0.9488 | 31 | 165 |
| 2h1g-assembly1.cif.gz_A | resa c74a/c77a | 0.9222 | 37 | 165 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3iosA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9557 | 31 | 165 | 3.40.30.10 |
| 3iosA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9488 | 31 | 165 | 3.40.30.10 |
| 1st9A00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9215 | 37 | 165 | 3.40.30.10 |
| af_I6XYM2_34_182_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8965 | 23 | 164 | 3.40.30.10 |
| af_O06392_67_205_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8742 | 39 | 164 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A060IMM9-F1-model_v4 | Soluble secreted antigen | 0.9996 | 35 | 164 |
GO:0016209
GO:0016491 |
| AF-A0A2S8NGW2-F1-model_v4 | deleted | 0.9985 | 51 | 132 |
|
| AF-A0A655AQT7-F1-model_v4 | Soluble secreted antigen MPT53 | 0.9964 | 31 | 164 |
GO:0016209
GO:0016491 |
| AF-A0A1X0IL61-F1-model_v4 | Thiol:disulfide interchange protein | 0.972 | 35 | 165 |
GO:0016209
GO:0016491 |
| AF-A0A2S8NGW2-F1-model_v4 | deleted | 0.9633 | 51 | 132 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar