F471495

General Info

Members Datasets Scaffolds Average Seq Length
638 321 633 163

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100756418|Ga0070663_1007564181
Length 149
Sequence MKRWIRTLAVVMATLTVGVAASPAAIAEDQLSFTGTTKPAVLWFWTPWCPFCNQEAPNVSQVAAANPKVTFVGIAARSDVGQMEGFVSKYNLNFTNLNDADGSLWARFNVPWQPAYVFLRPDGTSTFVNNPTSAMSEQELSDRVHALVS

Samples

Sample ID Description Type Environment
1 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
2 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
3 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
4 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
5 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
193 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
194 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
195 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
196 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
197 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
198 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
199 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
204 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
210 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
211 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
212 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
213 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
214 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
215 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
216 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
217 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
218 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
219 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
220 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
221 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
222 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
223 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
224 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
225 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
226 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
227 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
228 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
229 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
230 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
231 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
232 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
233 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
234 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
235 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
236 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
237 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
238 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
239 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
240 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
241 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
242 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
243 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
250 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
261 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
270 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
271 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
272 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
273 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
276 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
277 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
278 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
279 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
290 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
291 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
297 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
298 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
299 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
300 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
301 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
302 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
303 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
304 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
305 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
306 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
307 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
308 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
309 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
310 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
311 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
312 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
313 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
314 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
315 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
316 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
317 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
318 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
319 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
320 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
321 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.76
Nodule 0
Rhizoplane 11.91
Rhizosphere 71
Stem 0
Stem Tuber 0
Unclassified 5.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1033091 3300002070 Bacteria 765
2 JGI24748J21848_1009575 3300002074 Bacteria 1141
3 JGI24749J21850_1021094 3300002076 Bacteria 921
4 JGI24744J21845_10000463 3300002077 Bacteria 7178
5 JGI24034J26672_10013638 3300002239 Bacteria 1234
6 JGI24034J26672_10025056 3300002239 Bacteria 953
7 JGI24751J29686_10027693 3300002459 Bacteria 1177
8 Ga0070683_100434795 3300005329 Bacteria 1252
9 Ga0070690_100007309 3300005330 Bacteria 6326
10 Ga0070670_100031486 3300005331 Bacteria 4568
11 Ga0068869_100031587 3300005334 Bacteria 3725
12 Ga0068869_100091634 3300005334 Bacteria 2286
13 Ga0070666_10026947 3300005335 Bacteria 3760
14 Ga0070680_100205289 3300005336 Bacteria 1662
15 Ga0070682_100010070 3300005337 Bacteria 5358
16 Ga0070682_100010372 3300005337 Bacteria 5287
17 Ga0070682_100065893 3300005337 Bacteria 2303
18 Ga0070682_100371301 3300005337 Bacteria 1073
19 Ga0068868_100000227 3300005338 Bacteria 38201
20 Ga0070660_100169774 3300005339 Bacteria 1761
21 Ga0070689_100080916 3300005340 Bacteria 2550
22 Ga0070691_10012681 3300005341 Bacteria 3860
23 Ga0070691_10020911 3300005341 Bacteria 3026
24 Ga0070692_10137121 3300005345 Bacteria 1381
25 Ga0070668_100004054 3300005347 Bacteria 10847
26 Ga0070668_100008930 3300005347 Bacteria 7441
27 Ga0070668_100100583 3300005347 Bacteria 2290
28 Ga0070668_100715813 3300005347 Bacteria 884
29 Ga0070669_100063130 3300005353 Bacteria 2726
30 Ga0070671_100007716 3300005355 Bacteria 8596
31 Ga0070671_100043898 3300005355 Bacteria 3715
32 Ga0070674_100000223 3300005356 Bacteria 27721
33 Ga0070674_100760108 3300005356 Bacteria 834
34 Ga0070688_100018740 3300005365 Bacteria 4000
35 Ga0070659_100171375 3300005366 Bacteria 1778
36 Ga0070667_100000190 3300005367 Bacteria 73682
37 Ga0070667_100014397 3300005367 Bacteria 6536
38 Ga0070667_100153415 3300005367 Bacteria 2025
39 Ga0070667_100618509 3300005367 Bacteria 999
40 Ga0070709_10051067 3300005434 Bacteria 2594
41 Ga0070714_100037899 3300005435 Bacteria 4053
42 Ga0070714_100106423 3300005435 Bacteria 2478
43 Ga0070714_100421264 3300005435 Bacteria 1265
44 Ga0070713_100020391 3300005436 Bacteria 5082
45 Ga0070710_10001219 3300005437 Bacteria 12171
46 Ga0070710_10005585 3300005437 Bacteria 5990
47 Ga0070710_10007995 3300005437 Bacteria 5141
48 Ga0070701_10000228 3300005438 Bacteria 17759
49 Ga0070711_100000141 3300005439 Bacteria 38743
50 Ga0070711_100003908 3300005439 Bacteria 8748
51 Ga0070705_100194688 3300005440 Bacteria 1385
52 Ga0070700_100017490 3300005441 Bacteria 4102
53 Ga0070700_100063552 3300005441 Bacteria 2335
54 Ga0070694_100006459 3300005444 Bacteria 7119
55 Ga0070663_100005376 3300005455 Bacteria 7606
56 Ga0070663_100011553 3300005455 Bacteria 5550
57 Ga0070663_100368779 3300005455 Bacteria 1166
58 Ga0070663_100756418 3300005455 Bacteria 830
59 Ga0070678_100001400 3300005456 Bacteria 12843
60 Ga0070678_100033449 3300005456 Bacteria 3569
61 Ga0070678_100143105 3300005456 Bacteria 1916
62 Ga0070662_100010632 3300005457 Bacteria 6051
63 Ga0070662_100473987 3300005457 Bacteria 1041
64 Ga0070662_100477121 3300005457 Bacteria 1038
65 Ga0068867_100003180 3300005459 Bacteria 11578
66 Ga0070685_10198667 3300005466 Bacteria 1302
67 Ga0070697_100857464 3300005536 Bacteria 805
68 Ga0068853_100005781 3300005539 Bacteria 9742
69 Ga0068853_100160522 3300005539 Bacteria 2028
70 Ga0070672_100098442 3300005543 Bacteria 2369
71 Ga0070686_100113787 3300005544 Bacteria 1848
72 Ga0070695_100296411 3300005545 Bacteria 1194
73 Ga0070696_100175599 3300005546 Bacteria 1586
74 Ga0070693_100012047 3300005547 Bacteria 4367
75 Ga0070693_100781726 3300005547 Bacteria 706
76 Ga0070665_100013464 3300005548 Bacteria 8228
77 Ga0070665_100014376 3300005548 Bacteria 7943
78 Ga0070665_100054494 3300005548 Bacteria 4011
79 Ga0070665_100158524 3300005548 Bacteria 2265
80 Ga0070665_100300849 3300005548 Bacteria 1607
81 Ga0070704_100000712 3300005549 Bacteria 16223
82 Ga0070704_100189676 3300005549 Bacteria 1651
83 Ga0068855_100043985 3300005563 Bacteria 5287
84 Ga0070664_100238794 3300005564 Bacteria 1631
85 Ga0068854_100000492 3300005578 Bacteria 24084
86 Ga0068854_100077794 3300005578 Bacteria 2442
87 Ga0068854_101435636 3300005578 Bacteria 625
88 Ga0068856_100539368 3300005614 Bacteria 1188
89 Ga0070702_100001938 3300005615 Bacteria 8707
90 Ga0070702_100687643 3300005615 Bacteria 778
91 Ga0068852_100104127 3300005616 Bacteria 2568
92 Ga0068859_100003815 3300005617 Bacteria 15385
93 Ga0068859_100005865 3300005617 Bacteria 12467
94 Ga0068859_100275604 3300005617 Bacteria 1774
95 Ga0068859_100389408 3300005617 Bacteria 1489
96 Ga0068864_100065577 3300005618 Bacteria 3150
97 Ga0068864_100091698 3300005618 Bacteria 2681
98 Ga0068864_100457140 3300005618 Bacteria 1222
99 Ga0068864_101167259 3300005618 Bacteria 768
100 Ga0068866_10000345 3300005718 Bacteria 21934
101 Ga0068866_10041768 3300005718 Bacteria 2277
102 Ga0068866_10047802 3300005718 Bacteria 2159
103 Ga0068861_100001560 3300005719 Bacteria 14572
104 Ga0068861_100157582 3300005719 Bacteria 1869
105 Ga0068861_100260967 3300005719 Bacteria 1483
106 Ga0068863_100001346 3300005841 Bacteria 24433
107 Ga0068863_100007330 3300005841 Bacteria 10798
108 Ga0068863_100059644 3300005841 Bacteria 3610
109 Ga0068863_100134869 3300005841 Bacteria 2359
110 Ga0068858_100003458 3300005842 Bacteria 15667
111 Ga0068858_100446852 3300005842 Bacteria 1245
112 Ga0068858_100495156 3300005842 Bacteria 1180
113 Ga0068860_100000099 3300005843 Bacteria 145436
114 Ga0068860_100000971 3300005843 Bacteria 31764
115 Ga0068860_100119478 3300005843 Bacteria 2523
116 Ga0068862_100000086 3300005844 Bacteria 110489
117 Ga0068862_100006044 3300005844 Bacteria 10080
118 Ga0068862_100185425 3300005844 Bacteria 1869
119 Ga0081455_10038937 3300005937 Bacteria 4206
120 Ga0081538_10066974 3300005981 Bacteria 2008
121 Ga0070717_10261911 3300006028 Bacteria 1530
122 Ga0075365_10023895 3300006038 Bacteria 3850
123 Ga0075365_10047190 3300006038 Bacteria 2830
124 Ga0075365_10110047 3300006038 Bacteria 1893
125 Ga0075363_100000092 3300006048 Bacteria 19660
126 Ga0075363_100006312 3300006048 Bacteria 5371
127 Ga0075363_100019432 3300006048 Bacteria 3398
128 Ga0075363_100097136 3300006048 Bacteria 1627
129 Ga0075363_100101914 3300006048 Bacteria 1589
130 Ga0075363_100210492 3300006048 Bacteria 1113
131 Ga0075363_100253855 3300006048 Bacteria 1013
132 Ga0075364_10000628 3300006051 Bacteria 18192
133 Ga0075364_10002372 3300006051 Bacteria 10569
134 Ga0075364_10007671 3300006051 Bacteria 6418
135 Ga0075364_10008061 3300006051 Bacteria 6280
136 Ga0075364_10480315 3300006051 Bacteria 849
137 Ga0070715_10004747 3300006163 Bacteria 4492
138 Ga0070715_10177847 3300006163 Bacteria 1065
139 Ga0070716_100001458 3300006173 Bacteria 10532
140 Ga0070716_100116837 3300006173 Bacteria 1663
141 Ga0070716_100442987 3300006173 Bacteria 945
142 Ga0070712_100000607 3300006175 Bacteria 21017
143 Ga0070712_100027836 3300006175 Bacteria 3777
144 Ga0070712_100044230 3300006175 Bacteria 3070
145 Ga0070712_100529341 3300006175 Bacteria 991
146 Ga0075362_10069694 3300006177 Bacteria 1604
147 Ga0075367_10010088 3300006178 Bacteria 4954
148 Ga0075367_10056712 3300006178 Bacteria 2328
149 Ga0075367_10209963 3300006178 Bacteria 1217
150 Ga0075367_10282754 3300006178 Bacteria 1043
151 Ga0075369_10002372 3300006186 Bacteria 6714
152 Ga0075369_10014693 3300006186 Bacteria 3132
153 Ga0075369_10050856 3300006186 Bacteria 1793
154 Ga0075369_10104945 3300006186 Bacteria 1270
155 Ga0075369_10250351 3300006186 Bacteria 823
156 Ga0097621_100369637 3300006237 Bacteria 1279
157 Ga0075370_10054724 3300006353 Bacteria 2266
158 Ga0075370_10085933 3300006353 Bacteria 1811
159 Ga0075370_10092346 3300006353 Bacteria 1747
160 Ga0075370_10201937 3300006353 Bacteria 1173
161 Ga0075370_10268511 3300006353 Bacteria 1012
162 Ga0075370_10342781 3300006353 Bacteria 892
163 Ga0068871_100143544 3300006358 Bacteria 2031
164 Ga0068871_100627753 3300006358 Bacteria 979
165 Ga0075428_100001179 3300006844 Bacteria 27960
166 Ga0075430_100092657 3300006846 Bacteria 2526
167 Ga0075430_100176930 3300006846 Bacteria 1775
168 Ga0075431_100009007 3300006847 Bacteria 10005
169 Ga0075434_100862359 3300006871 Bacteria 921
170 Ga0075429_100197257 3300006880 Bacteria 1763
171 Ga0068865_100001324 3300006881 Bacteria 14443
172 Ga0068865_100102934 3300006881 Bacteria 2093
173 Ga0097620_100003815 3300006931 Bacteria 15385
174 Ga0097620_100005865 3300006931 Bacteria 12467
175 Ga0097620_100275605 3300006931 Bacteria 1774
176 Ga0097620_100389447 3300006931 Bacteria 1489
177 Ga0099795_10013911 3300007788 Bacteria 2482
178 Ga0105250_10121000 3300009092 Bacteria 1076
179 Ga0105240_11128359 3300009093 Bacteria 833
180 Ga0111539_10733351 3300009094 Bacteria 1150
181 Ga0111539_11465352 3300009094 Bacteria 792
182 Ga0105245_10000678 3300009098 Bacteria 30775
183 Ga0105247_10000051 3300009101 Bacteria 145981
184 Ga0105247_10001857 3300009101 Bacteria 14779
185 Ga0105247_10129897 3300009101 Bacteria 1641
186 Ga0114129_10024772 3300009147 Bacteria 8506
187 Ga0105243_10000534 3300009148 Bacteria 38657
188 Ga0105243_10203784 3300009148 Bacteria 1737
189 Ga0105241_10020235 3300009174 Bacteria 4916
190 Ga0105241_10596646 3300009174 Bacteria 997
191 Ga0105242_10000328 3300009176 Bacteria 38119
192 Ga0105242_10255947 3300009176 Bacteria 1579
193 Ga0105242_10441811 3300009176 Bacteria 1224
194 Ga0105242_11225223 3300009176 Bacteria 771
195 Ga0105248_10000339 3300009177 Bacteria 55050
196 Ga0105248_10000842 3300009177 Bacteria 34503
197 Ga0105248_10415985 3300009177 Bacteria 1514
198 Ga0105248_10617038 3300009177 Bacteria 1224
199 Ga0105237_10171491 3300009545 Bacteria 2170
200 Ga0105237_10297449 3300009545 Bacteria 1617
201 Ga0105238_10117110 3300009551 Bacteria 2644
202 Ga0105238_10599816 3300009551 Bacteria 1109
203 Ga0105249_10000020 3300009553 Bacteria 260634
204 Ga0105249_12653933 3300009553 Bacteria 573
205 Ga0099796_10012357 3300010159 Bacteria 2409
206 Ga0105239_10012440 3300010375 Bacteria 9479
207 Ga0105246_10036013 3300011119 Bacteria 3312
208 Ga0157371_10526855 3300013102 Bacteria 874
209 Ga0157369_11128941 3300013105 Bacteria 801
210 Ga0157374_10966538 3300013296 Bacteria 870
211 Ga0157374_11784822 3300013296 Bacteria 640
212 Ga0157378_10001491 3300013297 Bacteria 21150
213 Ga0163162_10337334 3300013306 Bacteria 1640
214 Ga0163162_10573343 3300013306 Bacteria 1256
215 Ga0157372_10052464 3300013307 Bacteria 4541
216 Ga0163163_10002474 3300014325 Bacteria 15621
217 Ga0163163_10009758 3300014325 Bacteria 8597
218 Ga0157380_10003919 3300014326 Bacteria 10266
219 Ga0157377_10235151 3300014745 Bacteria 1180
220 Ga0157379_10004006 3300014968 Bacteria 12555
221 Ga0157379_10798237 3300014968 Bacteria 891
222 Ga0157376_10084506 3300014969 Bacteria 2733
223 Ga0163161_10001669 3300017792 Bacteria 16273
224 Ga0163161_10012322 3300017792 Bacteria 5934
225 Ga0213876_10168431 3300021384 Bacteria 1165
226 Ga0213875_10035194 3300021388 Bacteria 2363
227 Ga0213875_10132752 3300021388 Bacteria 1164
228 Ga0209051_1000021 3300025303 Bacteria 507633
229 Ga0207692_10009243 3300025898 Bacteria 4107
230 Ga0207642_10000241 3300025899 Bacteria 16282
231 Ga0207642_10016135 3300025899 Bacteria 2805
232 Ga0207710_10000010 3300025900 Bacteria 482087
233 Ga0207710_10007136 3300025900 Bacteria 4739
234 Ga0207710_10429077 3300025900 Bacteria 681
235 Ga0207688_10000427 3300025901 Bacteria 19816
236 Ga0207688_10001234 3300025901 Bacteria 13252
237 Ga0207680_10213389 3300025903 Bacteria 1320
238 Ga0207647_10116939 3300025904 Bacteria 1574
239 Ga0207685_10011792 3300025905 Bacteria 2643
240 Ga0207685_10045983 3300025905 Bacteria 1659
241 Ga0207699_10011688 3300025906 Bacteria 4443
242 Ga0207699_10012233 3300025906 Bacteria 4361
243 Ga0207645_10071186 3300025907 Bacteria 2225
244 Ga0207643_10174110 3300025908 Bacteria 1300
245 Ga0207654_10055015 3300025911 Bacteria 2302
246 Ga0207695_10834189 3300025913 Bacteria 802
247 Ga0207671_10127158 3300025914 Bacteria 1953
248 Ga0207693_10001162 3300025915 Bacteria 23484
249 Ga0207693_10002211 3300025915 Bacteria 16958
250 Ga0207663_10000264 3300025916 Bacteria 22813
251 Ga0207663_10006459 3300025916 Bacteria 5998
252 Ga0207663_10410249 3300025916 Bacteria 1038
253 Ga0207660_10206788 3300025917 Bacteria 1535
254 Ga0207657_10088328 3300025919 Bacteria 2591
255 Ga0207681_10002097 3300025923 Bacteria 12770
256 Ga0207681_10060089 3300025923 Bacteria 2608
257 Ga0207694_10652284 3300025924 Bacteria 887
258 Ga0207650_10464444 3300025925 Bacteria 1055
259 Ga0207659_10143551 3300025926 Bacteria 1856
260 Ga0207687_10001116 3300025927 Bacteria 18250
261 Ga0207687_10047008 3300025927 Bacteria 2990
262 Ga0207700_10391942 3300025928 Bacteria 1216
263 Ga0207664_10201017 3300025929 Bacteria 1720
264 Ga0207644_10004614 3300025931 Bacteria 8962
265 Ga0207644_10176599 3300025931 Bacteria 1671
266 Ga0207706_10012871 3300025933 Bacteria 7615
267 Ga0207706_10174203 3300025933 Bacteria 1890
268 Ga0207686_10005970 3300025934 Bacteria 6536
269 Ga0207686_10026557 3300025934 Bacteria 3379
270 Ga0207709_10014636 3300025935 Bacteria 4335
271 Ga0207709_10307948 3300025935 Bacteria 1180
272 Ga0207709_10597074 3300025935 Bacteria 874
273 Ga0207709_11444106 3300025935 Bacteria 570
274 Ga0207670_10128409 3300025936 Bacteria 1853
275 Ga0207670_10441742 3300025936 Bacteria 1047
276 Ga0207669_10003531 3300025937 Bacteria 6769
277 Ga0207669_10199713 3300025937 Bacteria 1450
278 Ga0207704_10000621 3300025938 Bacteria 15698
279 Ga0207665_10002223 3300025939 Bacteria 13090
280 Ga0207665_10003744 3300025939 Bacteria 10158
281 Ga0207665_10231394 3300025939 Bacteria 1358
282 Ga0207665_10244953 3300025939 Bacteria 1322
283 Ga0207665_10367720 3300025939 Bacteria 1089
284 Ga0207691_10134866 3300025940 Bacteria 2178
285 Ga0207711_10000301 3300025941 Bacteria 52993
286 Ga0207711_10011033 3300025941 Bacteria 7508
287 Ga0207711_11477164 3300025941 Bacteria 623
288 Ga0207689_10132614 3300025942 Bacteria 2051
289 Ga0207679_10262469 3300025945 Bacteria 1474
290 Ga0207667_10389193 3300025949 Bacteria 1420
291 Ga0207651_10568873 3300025960 Bacteria 987
292 Ga0207712_10000010 3300025961 Bacteria 455972
293 Ga0207712_10005160 3300025961 Bacteria 8262
294 Ga0207712_10012964 3300025961 Bacteria 5337
295 Ga0207712_10311836 3300025961 Bacteria 1295
296 Ga0207668_10001338 3300025972 Bacteria 14604
297 Ga0207668_10002603 3300025972 Bacteria 10548
298 Ga0207668_10087665 3300025972 Bacteria 2277
299 Ga0207640_10001865 3300025981 Bacteria 11303
300 Ga0207640_10665501 3300025981 Bacteria 889
301 Ga0207640_10885200 3300025981 Bacteria 779
302 Ga0207658_10000138 3300025986 Bacteria 77096
303 Ga0207658_10011329 3300025986 Bacteria 6070
304 Ga0207658_10149779 3300025986 Bacteria 1899
305 Ga0207658_10320711 3300025986 Bacteria 1341
306 Ga0207658_10364748 3300025986 Bacteria 1261
307 Ga0207658_10800937 3300025986 Bacteria 855
308 Ga0207677_10001437 3300026023 Bacteria 12665
309 Ga0207677_10200329 3300026023 Bacteria 1586
310 Ga0207703_11238811 3300026035 Bacteria 717
311 Ga0207639_10040020 3300026041 Bacteria 3496
312 Ga0207639_10171812 3300026041 Bacteria 1836
313 Ga0207639_10946749 3300026041 Bacteria 806
314 Ga0207678_10009628 3300026067 Bacteria 8496
315 Ga0207678_10012044 3300026067 Bacteria 7596
316 Ga0207678_10021794 3300026067 Bacteria 5619
317 Ga0207708_10016016 3300026075 Bacteria 5630
318 Ga0207708_10052297 3300026075 Bacteria 3111
319 Ga0207708_10407303 3300026075 Bacteria 1126
320 Ga0207641_10001050 3300026088 Bacteria 27871
321 Ga0207641_10213098 3300026088 Bacteria 1787
322 Ga0207641_10902839 3300026088 Bacteria 877
323 Ga0207648_10000085 3300026089 Bacteria 88563
324 Ga0207648_10026164 3300026089 Bacteria 5187
325 Ga0207676_10070562 3300026095 Bacteria 2802
326 Ga0207676_10074733 3300026095 Bacteria 2732
327 Ga0207676_10078661 3300026095 Bacteria 2672
328 Ga0207676_10379107 3300026095 Bacteria 1316
329 Ga0207676_10792313 3300026095 Bacteria 924
330 Ga0207675_100010626 3300026118 Bacteria 8623
331 Ga0207675_100217198 3300026118 Bacteria 1841
332 Ga0207675_100338192 3300026118 Bacteria 1473
333 Ga0207675_100601417 3300026118 Bacteria 1103
334 Ga0207683_10000040 3300026121 Bacteria 95127
335 Ga0207683_10053379 3300026121 Bacteria 3544
336 Ga0207698_10219016 3300026142 Bacteria 1718
337 Ga0207698_10987316 3300026142 Bacteria 852
338 Ga0209179_1011560 3300027512 Bacteria 1566
339 Ga0209813_10086999 3300027866 Bacteria 1042
340 Ga0268266_10016548 3300028379 Bacteria 6304
341 Ga0268266_10072868 3300028379 Bacteria 2979
342 Ga0268266_10205587 3300028379 Bacteria 1804
343 Ga0268266_10291797 3300028379 Bacteria 1519
344 Ga0268266_10382682 3300028379 Bacteria 1327
345 Ga0268265_10000014 3300028380 Bacteria 330186
346 Ga0268265_10020473 3300028380 Bacteria 4616
347 Ga0268264_10000137 3300028381 Bacteria 176081
348 Ga0268264_10000983 3300028381 Bacteria 29174
349 Ga0268264_10249385 3300028381 Bacteria 1648
350 Ga0268264_10965613 3300028381 Bacteria 858
351 Ga0316576_10514226 3300031727 Bacteria 880
352 Ga0307405_10173113 3300031731 Bacteria 1542
353 Ga0307413_10181182 3300031824 Bacteria 1502
354 Ga0307413_10573391 3300031824 Bacteria 919
355 Ga0307410_10062066 3300031852 Bacteria 2559
356 Ga0307410_10390390 3300031852 Bacteria 1122
357 Ga0307410_10501750 3300031852 Bacteria 998
358 Ga0326468_10001010 3300031889 Bacteria 2681
359 Ga0307407_10299614 3300031903 Bacteria 1120
360 Ga0307412_11369526 3300031911 Bacteria 639
361 Ga0307409_100166827 3300031995 Bacteria 1933
362 Ga0307409_100959164 3300031995 Bacteria 871
363 Ga0307416_100669382 3300032002 Bacteria 1124
364 Ga0307414_10564690 3300032004 Bacteria 1016
365 Ga0307411_10411288 3300032005 Bacteria 1121
366 Ga0307415_100235662 3300032126 Bacteria 1477
367 Ga0316583_10217576 3300032133 Bacteria 662
368 Ga0373948_0036634 3300034817 Bacteria 1011
369 Ga0373940_0221083 3300035088 Bacteria 629
370 Ga0373951_0044105 3300035091 Bacteria 1082
371 Ga0373952_0148817 3300035092 Bacteria 655
372 Ga0373960_0016686 3300035121 Bacteria 1893
373 Ga0373960_0088793 3300035121 Bacteria 985
374 Ga0373962_0067657 3300035242 Bacteria 1061
375 Ga0316574_0275339 3300035398 Bacteria 1073
376 Ga0373931_0023608 3300035691 Bacteria 3107
377 Ga0373931_0031990 3300035691 Bacteria 2719
378 Ga0373935_0686182 3300035692 Bacteria 753
379 Ga0373937_0880327 3300036401 Bacteria 844
380 Ga0316582_0411255 3300036647 Bacteria 932
381 Ga0316584_0015038 3300036712 Bacteria 5528
382 Ga0395900_0942841 3300037418 Bacteria 785
383 Ga0395898_1819952 3300037466 Bacteria 530
384 Ga0436364_0459520 3300037853 Bacteria 1896
385 Ga0436364_0725072 3300037853 Bacteria 620
386 Ga0436365_0607166 3300039437 Bacteria 1240
387 Ga0436365_1177168 3300039437 Bacteria 16605
388 Ga0436365_1640827 3300039437 Bacteria 22352
389 Ga0436363_0182495 3300039450 Bacteria 661
390 Ga0436363_0656406 3300039450 Bacteria 3762
391 Ga0439461_0001144 3300041410 Bacteria 4031
392 Ga0439466_0028779 3300041411 Bacteria 1915
393 Ga0439466_0105135 3300041411 Bacteria 878
394 Ga0439466_0120704 3300041411 Bacteria 809
395 Ga0439465_0005453 3300041413 Bacteria 4060
396 Ga0439465_0022979 3300041413 Bacteria 1960
397 Ga0451802_1940043 3300041460 Bacteria 1213
398 Ga0451843_0613428 3300041509 Bacteria 653
399 Ga0451853_4104438 3300041512 Bacteria 1257
400 Ga0439450_183732 3300042008 Bacteria 556
401 Ga0439434_0011814 3300042435 Bacteria 2582
402 Ga0439464_0087681 3300042439 Bacteria 935
403 Ga0466969_0081797 3300044656 Bacteria 1540
404 Ga0466969_0260317 3300044656 Bacteria 786
405 Ga0466972_0003083 3300044658 Bacteria 8256
406 Ga0466972_0006973 3300044658 Bacteria 5666
407 Ga0466972_0016656 3300044658 Bacteria 3675
408 Ga0466972_0101775 3300044658 Bacteria 1359
409 Ga0466965_0000201 3300044683 Bacteria 18636
410 Ga0466965_0008833 3300044683 Bacteria 4673
411 Ga0466965_0017396 3300044683 Bacteria 3436
412 Ga0466965_0036885 3300044683 Bacteria 2399
413 Ga0466966_0017019 3300044684 Bacteria 4806
414 Ga0466966_0298785 3300044684 Bacteria 968
415 Ga0466961_0011981 3300044693 Bacteria 5542
416 Ga0466961_0024792 3300044693 Bacteria 3858
417 Ga0466963_0283596 3300044694 Bacteria 1164
418 Ga0466963_0708948 3300044694 Bacteria 710
419 Ga0466964_0499576 3300044706 Bacteria 653
420 Ga0466971_0087821 3300044719 Bacteria 1422
421 Ga0466971_0106129 3300044719 Bacteria 1294
422 Ga0466971_0318525 3300044719 Bacteria 749
423 Ga0466968_0020280 3300044735 Bacteria 2682
424 Ga0466968_0038061 3300044735 Bacteria 2020
425 Ga0466970_0001116 3300044765 Bacteria 13006
426 Ga0466970_0014404 3300044765 Bacteria 4060
427 Ga0466970_0052593 3300044765 Bacteria 2174
428 Ga0466970_0076218 3300044765 Bacteria 1806
429 Ga0466970_0444498 3300044765 Bacteria 743
430 Ga0466970_0625815 3300044765 Bacteria 625
431 Ga0466957_0295316 3300044842 Bacteria 1087
432 Ga0466957_0657629 3300044842 Bacteria 737
433 Ga0466960_0000223 3300044901 Bacteria 19745
434 Ga0466960_0016320 3300044901 Bacteria 3218
435 Ga0466960_0093886 3300044901 Bacteria 1534
436 Ga0466959_0012525 3300045049 Bacteria 6130
437 Ga0466959_0024644 3300045049 Bacteria 4457
438 Ga0466959_0034727 3300045049 Bacteria 3730
439 Ga0466959_0194331 3300045049 Bacteria 1415
440 Ga0466958_0006271 3300045836 Bacteria 6459
441 Ga0466958_0457874 3300045836 Bacteria 826
442 Ga0466967_0049434 3300045976 Bacteria 3677
443 Ga0466967_0125293 3300045976 Bacteria 2379
444 Ga0466967_0191213 3300045976 Bacteria 1934
445 Ga0466967_0827053 3300045976 Bacteria 920
446 Ga0495592_0775188 3300046454 Bacteria 571
447 Ga0495638_0033042 3300046460 Bacteria 3310
448 Ga0495582_0022796 3300046473 Bacteria 3425
449 Ga0495662_0144308 3300046476 Bacteria 1172
450 Ga0495583_0292731 3300046506 Bacteria 648
451 Ga0495616_0170941 3300046513 Bacteria 972
452 Ga0495648_0113201 3300046524 Bacteria 1472
453 Ga0495652_0307998 3300046529 Bacteria 1149
454 Ga0495652_1063769 3300046529 Bacteria 527
455 Ga0495665_0154961 3300046531 Bacteria 1195
456 Ga0495640_0055584 3300046533 Bacteria 2708
457 Ga0495635_0266893 3300046663 Bacteria 1152
458 Ga0495658_0034547 3300046683 Bacteria 2775
459 Ga0495649_0143517 3300046694 Bacteria 1256
460 Ga0495581_0040799 3300047315 Bacteria 2685
461 Ga0495674_0056183 3300047319 Bacteria 3449
462 Ga0495672_0107481 3300047320 Bacteria 1503
463 Ga0495672_0173434 3300047320 Bacteria 1098
464 Ga0495672_0249832 3300047320 Bacteria 861
465 Ga0495676_0136027 3300047321 Bacteria 1767
466 Ga0495602_0686450 3300048088 Bacteria 696
467 Ga0495614_0223423 3300048089 Bacteria 856
468 Ga0496100_0001224 3300048903 Bacteria 12472
469 Ga0496100_0041233 3300048903 Bacteria 2942
470 Ga0496100_0048881 3300048903 Bacteria 2732
471 Ga0496101_0001744 3300048904 Bacteria 13025
472 Ga0496101_0001844 3300048904 Bacteria 12776
473 Ga0496101_0007711 3300048904 Bacteria 6992
474 Ga0496101_0009820 3300048904 Bacteria 6304
475 Ga0496101_0594179 3300048904 Bacteria 875
476 Ga0496102_0000118 3300048905 Bacteria 113499
477 Ga0496102_0004227 3300048905 Bacteria 12139
478 Ga0496102_0005536 3300048905 Bacteria 10727
479 Ga0496102_0089231 3300048905 Bacteria 2852
480 Ga0496102_0120445 3300048905 Bacteria 2450
481 Ga0496102_0231650 3300048905 Bacteria 1741
482 Ga0496102_0249032 3300048905 Bacteria 1675
483 Ga0496102_0343136 3300048905 Bacteria 1406
484 Ga0496103_0000129 3300048906 Bacteria 81081
485 Ga0496103_0061224 3300048906 Bacteria 2340
486 Ga0496103_0092004 3300048906 Bacteria 1914
487 Ga0496103_0199000 3300048906 Bacteria 1288
488 Ga0496103_0205468 3300048906 Bacteria 1267
489 Ga0496103_0619317 3300048906 Bacteria 689
490 Ga0496104_0007843 3300048907 Bacteria 9462
491 Ga0496104_0013061 3300048907 Bacteria 7480
492 Ga0496104_0277844 3300048907 Bacteria 1588
493 Ga0496105_0019113 3300048908 Bacteria 5522
494 Ga0496105_0185865 3300048908 Bacteria 1701
495 Ga0496105_0381037 3300048908 Bacteria 1122
496 Ga0496105_0401635 3300048908 Bacteria 1088
497 Ga0496105_0865117 3300048908 Bacteria 683
498 Ga0496105_0878267 3300048908 Bacteria 677
499 Ga0496106_0001227 3300048909 Bacteria 19204
500 Ga0496106_0002950 3300048909 Bacteria 12662
501 Ga0496106_0063575 3300048909 Bacteria 2805
502 Ga0496106_0343844 3300048909 Bacteria 1198
503 Ga0496107_0001410 3300048910 Bacteria 14818
504 Ga0496107_0002601 3300048910 Bacteria 11772
505 Ga0496107_0016066 3300048910 Bacteria 5254
506 Ga0496107_0106849 3300048910 Bacteria 2056
507 Ga0496107_0343306 3300048910 Bacteria 1111
508 Ga0496108_0005964 3300048911 Bacteria 9870
509 Ga0496108_0048811 3300048911 Bacteria 3540
510 Ga0496108_0063232 3300048911 Bacteria 3117
511 Ga0496108_0134748 3300048911 Bacteria 2124
512 Ga0496109_0067894 3300048912 Bacteria 3267
513 Ga0496109_0083715 3300048912 Bacteria 2942
514 Ga0496109_0257093 3300048912 Bacteria 1645
515 Ga0496110_0034275 3300048913 Bacteria 4397
516 Ga0496110_0034536 3300048913 Bacteria 4381
517 Ga0496110_0306324 3300048913 Bacteria 1447
518 Ga0496110_1440542 3300048913 Bacteria 598
519 Ga0496111_0210148 3300048914 Bacteria 1446
520 Ga0496111_0233083 3300048914 Bacteria 1367
521 Ga0496111_0267080 3300048914 Bacteria 1269
522 Ga0496112_0007818 3300048915 Bacteria 9516
523 Ga0496112_0011611 3300048915 Bacteria 8056
524 Ga0496112_0066915 3300048915 Bacteria 3545
525 Ga0496112_0086353 3300048915 Bacteria 3104
526 Ga0496113_0036482 3300048916 Bacteria 3602
527 Ga0496113_0041631 3300048916 Bacteria 3391
528 Ga0496113_0078719 3300048916 Bacteria 2522
529 Ga0496113_0217941 3300048916 Bacteria 1521
530 Ga0496113_0654535 3300048916 Bacteria 840
531 Ga0496114_0003799 3300048917 Bacteria 11644
532 Ga0496114_0003967 3300048917 Bacteria 11426
533 Ga0496114_0176568 3300048917 Bacteria 1864
534 Ga0496114_0218137 3300048917 Bacteria 1674
535 Ga0496114_0305118 3300048917 Bacteria 1406
536 Ga0496114_0306663 3300048917 Bacteria 1402
537 Ga0496114_0346724 3300048917 Bacteria 1313
538 Ga0496114_0538537 3300048917 Bacteria 1032
539 Ga0496115_0004528 3300048918 Bacteria 10051
540 Ga0496115_0007150 3300048918 Bacteria 8198
541 Ga0496115_0084499 3300048918 Bacteria 2588
542 Ga0496115_0420218 3300048918 Bacteria 1083
543 Ga0496116_0072685 3300048919 Bacteria 2172
544 Ga0496117_0000304 3300048920 Bacteria 85823
545 Ga0496118_0000341 3300048921 Bacteria 79469
546 Ga0496118_0001559 3300048921 Bacteria 34060
547 Ga0496119_0004722 3300048922 Bacteria 13387
548 Ga0496120_0078678 3300048923 Bacteria 1791
549 Ga0496120_0125389 3300048923 Bacteria 1322
550 Ga0496121_0036684 3300048924 Bacteria 4364
551 Ga0496123_0012228 3300048926 Bacteria 7341
552 Ga0496124_0345328 3300048927 Bacteria 1055
553 Ga0496125_0024308 3300048928 Bacteria 5574
554 Ga0496125_0190367 3300048928 Bacteria 1355
555 Ga0496125_0221224 3300048928 Bacteria 1220
556 Ga0496126_0003099 3300048929 Bacteria 21487
557 Ga0496126_0016764 3300048929 Bacteria 7317
558 Ga0496126_0019824 3300048929 Bacteria 6614
559 Ga0496126_0057958 3300048929 Bacteria 3493
560 Ga0496126_0488989 3300048929 Bacteria 985
561 Ga0501032_0001735 3300049569 Bacteria 17236
562 Ga0501033_0090630 3300049570 Bacteria 2237
563 Ga0501034_0016890 3300049571 Bacteria 7482
564 Ga0501034_0095168 3300049571 Bacteria 2975
565 Ga0501036_0009059 3300049572 Bacteria 8186
566 Ga0501037_0000434 3300049573 Bacteria 34407
567 Ga0501037_0594270 3300049573 Bacteria 744
568 Ga0501038_0003103 3300049574 Bacteria 15496
569 Ga0501039_0001870 3300049575 Bacteria 15557
570 Ga0501040_0503770 3300049576 Bacteria 873
571 Ga0501043_0002065 3300049579 Bacteria 17125
572 Ga0501047_0015226 3300049581 Bacteria 7325
573 Ga0501047_0417136 3300049581 Bacteria 1174
574 Ga0501068_0069412 3300049584 Bacteria 2149
575 Ga0501070_0000764 3300049586 Bacteria 29355
576 Ga0501070_0139895 3300049586 Bacteria 1999
577 Ga0501073_0022196 3300049589 Bacteria 4574
578 Ga0501080_0877617 3300049742 Bacteria 783
579 Ga0501035_0276189 3300049822 Bacteria 1421
580 Ga0501044_0025213 3300049823 Bacteria 6305
581 Ga0501044_0287611 3300049823 Bacteria 1576
582 Ga0501045_1121087 3300049824 Bacteria 575
583 nmdc:mga03683_45385_c1 3300050489 Bacteria 1818
584 nmdc:mga03n38_128167_c1 3300050490 Bacteria 1255
585 nmdc:mga03n38_145986_c1 3300050490 Bacteria 1186
586 nmdc:mga03n38_146469_c1 3300050490 Bacteria 1184
587 nmdc:mga03n38_213511_c1 3300050490 Bacteria 1004
588 nmdc:mga03n38_3021_c1 3300050490 Bacteria 5330
589 nmdc:mga03n38_31418_c1 3300050490 Bacteria 2241
590 nmdc:mga03n38_498_c1 3300050490 Bacteria 9885
591 nmdc:mga00v17_4797_c1 3300050491 Bacteria 7077
592 nmdc:mga00v17_4944_c1 3300050491 Bacteria 6991
593 nmdc:mga00v17_61367_c1 3300050491 Bacteria 2311
594 nmdc:mga00v17_6288_c1 3300050491 Bacteria 6297
595 nmdc:mga0yw44_14790_c1 3300050492 Bacteria 4156
596 nmdc:mga0yw44_151511_c1 3300050492 Bacteria 1513
597 nmdc:mga0yw44_801924_c1 3300050492 Bacteria 639
598 nmdc:mga06z11_114290_c1 3300050494 Bacteria 1498
599 nmdc:mga06z11_190771_c1 3300050494 Bacteria 1186
600 nmdc:mga07m45_10512_c1 3300050496 Bacteria 4836
601 nmdc:mga07m45_127118_c1 3300050496 Bacteria 1474
602 nmdc:mga07m45_273574_c1 3300050496 Bacteria 982
603 nmdc:mga07m45_3531_c1 3300050496 Bacteria 7550
604 nmdc:mga05p37_723596_c1 3300050507 Bacteria 1102
605 nmdc:mga09592_711915_c1 3300050508 Bacteria 854
606 nmdc:mga0qj67_245454_c1 3300050509 Bacteria 1453
607 nmdc:mga0qj67_98568_c1 3300050509 Bacteria 2354
608 nmdc:mga08y16_1622875_c1 3300050511 Bacteria 604
609 nmdc:mga0n895_757912_c1 3300050512 Bacteria 963
610 nmdc:mga0sz30_14668_c1 3300050516 Bacteria 3088
611 nmdc:mga0sz30_14998_c1 3300050516 Bacteria 3058
612 nmdc:mga0sz30_2809_c1 3300050516 Bacteria 6219
613 nmdc:mga0sz30_322_c1 3300050516 Bacteria 18342
614 Ga0500635_0082410 3300053080 Bacteria 1158
615 Ga0500578_0180790 3300053086 Bacteria 1300
616 Ga0500641_0309353 3300053096 Bacteria 646
617 Ga0500650_0070832 3300053098 Bacteria 1630
618 Ga0500556_0003368 3300053104 Bacteria 4717
619 Ga0500556_0041733 3300053104 Bacteria 1619
620 Ga0500652_015433 3300053131 Bacteria 2756
621 Ga0500652_063258 3300053131 Bacteria 1527
622 Ga0500559_0105764 3300053136 Bacteria 1300
623 Ga0500564_178160 3300053138 Bacteria 888
624 Ga0500577_0012053 3300053142 Bacteria 2602
625 Ga0500588_0176554 3300053146 Bacteria 784
626 Ga0500616_0006360 3300053153 Bacteria 7752
627 Ga0500616_0036902 3300053153 Bacteria 2649
628 Ga0500627_0045410 3300053158 Bacteria 1901
629 Ga0500645_000112 3300053730 Bacteria 64943
630 Ga0500645_058790 3300053730 Bacteria 1113
631 Ga0466962_0064051 3300061719 Bacteria 1755
632 Ga0466962_0070005 3300061719 Bacteria 1675
633 Ga0466962_0417171 3300061719 Bacteria 673

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042439 Ga0439464_0087681 Ga0439464_0087681_33_524 125
2 3300031889 Ga0326468_10001010 Ga0326468_100010102 133
3 3300044658 Ga0466972_0016656 Ga0466972_0016656_1538_2029 146
4 3300044901 Ga0466960_0000223 Ga0466960_0000223_14053_14544 146
5 3300005455 Ga0070663_100756418 Ga0070663_1007564181 147
6 3300048929 Ga0496126_0057958 Ga0496126_0057958_2665_3153 147
7 3300053730 Ga0500645_000112 Ga0500645_000112_39928_40416 147
8 3300031852 Ga0307410_10501750 Ga0307410_105017502 148
9 3300048918 Ga0496115_0420218 Ga0496115_0420218_395_883 148
10 3300049569 Ga0501032_0001735 Ga0501032_0001735_1168_1653 148
11 3300049571 Ga0501034_0016890 Ga0501034_0016890_4565_5050 148
12 3300049572 Ga0501036_0009059 Ga0501036_0009059_3176_3661 148
13 3300049573 Ga0501037_0000434 Ga0501037_0000434_820_1305 148
14 3300049574 Ga0501038_0003103 Ga0501038_0003103_13076_13561 148
15 3300049575 Ga0501039_0001870 Ga0501039_0001870_1098_1583 148
16 3300049576 Ga0501040_0503770 Ga0501040_0503770_13_498 148
17 3300049579 Ga0501043_0002065 Ga0501043_0002065_11535_12020 148
18 3300049584 Ga0501068_0069412 Ga0501068_0069412_725_1210 148
19 3300049586 Ga0501070_0000764 Ga0501070_0000764_15220_15705 148
20 3300049589 Ga0501073_0022196 Ga0501073_0022196_384_869 148
21 3300049823 Ga0501044_0025213 Ga0501044_0025213_1816_2301 148
22 3300049824 Ga0501045_1121087 Ga0501045_1121087_50_535 148
23 3300009176 Ga0105242_10255947 Ga0105242_102559472 151
24 3300009545 Ga0105237_10171491 Ga0105237_101714913 151
25 3300009551 Ga0105238_10599816 Ga0105238_105998162 151
26 3300011119 Ga0105246_10036013 Ga0105246_100360136 151
27 3300013102 Ga0157371_10526855 Ga0157371_105268551 151
28 3300034817 Ga0373948_0036634 Ga0373948_0036634_461_916 151
29 3300035092 Ga0373952_0148817 Ga0373952_0148817_134_589 151
30 3300035121 Ga0373960_0016686 Ga0373960_0016686_871_1326 151
31 3300035242 Ga0373962_0067657 Ga0373962_0067657_512_967 151
32 3300035691 Ga0373931_0023608 Ga0373931_0023608_1851_2306 151
33 3300044658 Ga0466972_0101775 Ga0466972_0101775_882_1337 151
34 3300044765 Ga0466970_0625815 Ga0466970_0625815_156_611 151
35 3300045049 Ga0466959_0194331 Ga0466959_0194331_642_1097 151
36 3300048903 Ga0496100_0048881 Ga0496100_0048881_1623_2078 151
37 3300048905 Ga0496102_0231650 Ga0496102_0231650_973_1428 151
38 3300048906 Ga0496103_0199000 Ga0496103_0199000_457_912 151
39 3300048908 Ga0496105_0865117 Ga0496105_0865117_42_533 151
40 3300048908 Ga0496105_0878267 Ga0496105_0878267_169_624 151
41 3300048909 Ga0496106_0063575 Ga0496106_0063575_1122_1577 151
42 3300048910 Ga0496107_0106849 Ga0496107_0106849_614_1069 151
43 3300048911 Ga0496108_0005964 Ga0496108_0005964_8455_8910 151
44 3300048912 Ga0496109_0083715 Ga0496109_0083715_439_894 151
45 3300048915 Ga0496112_0011611 Ga0496112_0011611_6582_7037 151
46 3300048915 Ga0496112_0086353 Ga0496112_0086353_1769_2260 151
47 3300048916 Ga0496113_0036482 Ga0496113_0036482_423_914 151
48 3300048916 Ga0496113_0041631 Ga0496113_0041631_1364_1819 151
49 3300048917 Ga0496114_0306663 Ga0496114_0306663_802_1257 151
50 3300048918 Ga0496115_0084499 Ga0496115_0084499_601_1056 151
51 3300048923 Ga0496120_0125389 Ga0496120_0125389_64_555 151
52 3300048926 Ga0496123_0012228 Ga0496123_0012228_5061_5552 151
53 3300048927 Ga0496124_0345328 Ga0496124_0345328_25_516 151
54 3300048928 Ga0496125_0221224 Ga0496125_0221224_55_546 151
55 3300048929 Ga0496126_0019824 Ga0496126_0019824_3508_3999 151
56 3300006175 Ga0070712_100044230 Ga0070712_1000442302 152
57 3300035692 Ga0373935_0686182 Ga0373935_0686182_33_491 152
58 3300036401 Ga0373937_0880327 Ga0373937_0880327_41_499 152
59 3300036647 Ga0316582_0411255 Ga0316582_0411255_184_645 152
60 3300041413 Ga0439465_0005453 Ga0439465_0005453_3568_4026 152
61 3300044683 Ga0466965_0000201 Ga0466965_0000201_3640_4131 152
62 3300046454 Ga0495592_0775188 Ga0495592_0775188_33_491 152
63 3300046473 Ga0495582_0022796 Ga0495582_0022796_1453_1911 152
64 3300046476 Ga0495662_0144308 Ga0495662_0144308_147_605 152
65 3300046529 Ga0495652_0307998 Ga0495652_0307998_259_717 152
66 3300046531 Ga0495665_0154961 Ga0495665_0154961_626_1084 152
67 3300046533 Ga0495640_0055584 Ga0495640_0055584_1476_1934 152
68 3300046663 Ga0495635_0266893 Ga0495635_0266893_157_615 152
69 3300046683 Ga0495658_0034547 Ga0495658_0034547_1894_2352 152
70 3300047315 Ga0495581_0040799 Ga0495581_0040799_1699_2157 152
71 3300047319 Ga0495674_0056183 Ga0495674_0056183_2835_3293 152
72 3300047321 Ga0495676_0136027 Ga0495676_0136027_1060_1518 152
73 3300048089 Ga0495614_0223423 Ga0495614_0223423_366_824 152
74 3300048917 Ga0496114_0538537 Ga0496114_0538537_526_987 152
75 3300006038 Ga0075365_10023895 Ga0075365_100238953 153
76 3300006038 Ga0075365_10110047 Ga0075365_101100472 153
77 3300021388 Ga0213875_10132752 Ga0213875_101327522 153
78 3300037853 Ga0436364_0459520 Ga0436364_0459520_433_948 153
79 3300039450 Ga0436363_0656406 Ga0436363_0656406_1520_2071 153
80 3300046529 Ga0495652_1063769 Ga0495652_1063769_33_503 153
81 3300050492 nmdc:mga0yw44_14790_c1 nmdc:mga0yw44_14790_c1_1116_1634 153
82 3300053086 Ga0500578_0180790 Ga0500578_0180790_624_1124 153
83 3300005548 Ga0070665_100158524 Ga0070665_1001585243 154
84 3300005718 Ga0068866_10047802 Ga0068866_100478022 154
85 3300005719 Ga0068861_100260967 Ga0068861_1002609672 154
86 3300006186 Ga0075369_10104945 Ga0075369_101049452 154
87 3300006353 Ga0075370_10092346 Ga0075370_100923462 154
88 3300006353 Ga0075370_10201937 Ga0075370_102019372 154
89 3300006358 Ga0068871_100627753 Ga0068871_1006277532 154
90 3300009094 Ga0111539_11465352 Ga0111539_114653522 154
91 3300009101 Ga0105247_10129897 Ga0105247_101298972 154
92 3300009148 Ga0105243_10203784 Ga0105243_102037842 154
93 3300009176 Ga0105242_10441811 Ga0105242_104418111 154
94 3300009177 Ga0105248_10617038 Ga0105248_106170382 154
95 3300009553 Ga0105249_10000020 Ga0105249_1000002048 154
96 3300014325 Ga0163163_10009758 Ga0163163_100097588 154
97 3300014968 Ga0157379_10798237 Ga0157379_107982371 154
98 3300025935 Ga0207709_10307948 Ga0207709_103079482 154
99 3300025961 Ga0207712_10000010 Ga0207712_10000010216 154
100 3300025986 Ga0207658_10320711 Ga0207658_103207112 154
101 3300026035 Ga0207703_11238811 Ga0207703_112388111 154
102 3300026118 Ga0207675_100601417 Ga0207675_1006014172 154
103 3300031727 Ga0316576_10514226 Ga0316576_105142262 154
104 3300032133 Ga0316583_10217576 Ga0316583_102175761 154
105 3300035398 Ga0316574_0275339 Ga0316574_0275339_292_798 154
106 3300036712 Ga0316584_0015038 Ga0316584_0015038_4196_4702 154
107 3300042008 Ga0439450_183732 Ga0439450_183732_38_505 154
108 3300046524 Ga0495648_0113201 Ga0495648_0113201_174_683 154
109 3300048903 Ga0496100_0001224 Ga0496100_0001224_6977_7480 154
110 3300048904 Ga0496101_0001744 Ga0496101_0001744_5648_6151 154
111 3300048905 Ga0496102_0120445 Ga0496102_0120445_1436_1939 154
112 3300048907 Ga0496104_0013061 Ga0496104_0013061_2201_2704 154
113 3300048908 Ga0496105_0019113 Ga0496105_0019113_1489_1992 154
114 3300048909 Ga0496106_0002950 Ga0496106_0002950_3495_3998 154
115 3300048910 Ga0496107_0002601 Ga0496107_0002601_3264_3767 154
116 3300048917 Ga0496114_0003799 Ga0496114_0003799_6775_7278 154
117 3300048917 Ga0496114_0176568 Ga0496114_0176568_1302_1817 154
118 3300048918 Ga0496115_0007150 Ga0496115_0007150_6434_6937 154
119 3300048928 Ga0496125_0024308 Ga0496125_0024308_2372_2881 154
120 3300050491 nmdc:mga00v17_61367_c1 nmdc:mga00v17_61367_c1_1512_1979 154
121 3300050492 nmdc:mga0yw44_151511_c1 nmdc:mga0yw44_151511_c1_880_1347 154
122 3300050492 nmdc:mga0yw44_801924_c1 nmdc:mga0yw44_801924_c1_132_599 154
123 3300050496 nmdc:mga07m45_127118_c1 nmdc:mga07m45_127118_c1_92_595 154
124 3300050511 nmdc:mga08y16_1622875_c1 nmdc:mga08y16_1622875_c1_63_530 154
125 3300053096 Ga0500641_0309353 Ga0500641_0309353_95_565 154
126 3300053131 Ga0500652_015433 Ga0500652_015433_227_730 154
127 3300009174 Ga0105241_10596646 Ga0105241_105966461 155
128 3300009545 Ga0105237_10297449 Ga0105237_102974493 155
129 3300009551 Ga0105238_10117110 Ga0105238_101171101 155
130 3300013105 Ga0157369_11128941 Ga0157369_111289412 155
131 3300013296 Ga0157374_11784822 Ga0157374_117848222 155
132 3300021388 Ga0213875_10035194 Ga0213875_100351942 155
133 3300041460 Ga0451802_1940043 Ga0451802_1940043_31_504 155
134 3300041512 Ga0451853_4104438 Ga0451853_4104438_330_803 155
135 3300044656 Ga0466969_0081797 Ga0466969_0081797_577_1050 155
136 3300044684 Ga0466966_0017019 Ga0466966_0017019_3591_4064 155
137 3300044694 Ga0466963_0283596 Ga0466963_0283596_293_766 155
138 3300044719 Ga0466971_0318525 Ga0466971_0318525_166_639 155
139 3300044735 Ga0466968_0020280 Ga0466968_0020280_1746_2219 155
140 3300044765 Ga0466970_0014404 Ga0466970_0014404_562_1035 155
141 3300044765 Ga0466970_0444498 Ga0466970_0444498_118_591 155
142 3300044842 Ga0466957_0657629 Ga0466957_0657629_238_711 155
143 3300045836 Ga0466958_0006271 Ga0466958_0006271_303_776 155
144 3300048908 Ga0496105_0401635 Ga0496105_0401635_462_935 155
145 3300048911 Ga0496108_0048811 Ga0496108_0048811_1932_2405 155
146 3300048913 Ga0496110_0034536 Ga0496110_0034536_2960_3433 155
147 3300048915 Ga0496112_0007818 Ga0496112_0007818_2225_2698 155
148 3300050490 nmdc:mga03n38_3021_c1 nmdc:mga03n38_3021_c1_426_899 155
149 3300050516 nmdc:mga0sz30_322_c1 nmdc:mga0sz30_322_c1_8286_8759 155
150 3300053080 Ga0500635_0082410 Ga0500635_0082410_508_1035 155
151 3300053136 Ga0500559_0105764 Ga0500559_0105764_337_864 155
152 3300053153 Ga0500616_0036902 Ga0500616_0036902_551_1057 155
153 3300053158 Ga0500627_0045410 Ga0500627_0045410_799_1314 155
154 3300006048 Ga0075363_100000092 Ga0075363_10000009210 156
155 3300006051 Ga0075364_10007671 Ga0075364_100076717 156
156 3300006173 Ga0070716_100442987 Ga0070716_1004429871 156
157 3300006178 Ga0075367_10282754 Ga0075367_102827542 156
158 3300006353 Ga0075370_10054724 Ga0075370_100547242 156
159 3300009176 Ga0105242_11225223 Ga0105242_112252231 156
160 3300009177 Ga0105248_10415985 Ga0105248_104159852 156
161 3300025939 Ga0207665_10367720 Ga0207665_103677201 156
162 3300026075 Ga0207708_10407303 Ga0207708_104073032 156
163 3300031824 Ga0307413_10573391 Ga0307413_105733912 156
164 3300031852 Ga0307410_10390390 Ga0307410_103903902 156
165 3300031995 Ga0307409_100959164 Ga0307409_1009591641 156
166 3300044656 Ga0466969_0260317 Ga0466969_0260317_53_556 156
167 3300044658 Ga0466972_0006973 Ga0466972_0006973_2575_3078 156
168 3300044683 Ga0466965_0017396 Ga0466965_0017396_2167_2670 156
169 3300044693 Ga0466961_0024792 Ga0466961_0024792_712_1215 156
170 3300044706 Ga0466964_0499576 Ga0466964_0499576_59_535 156
171 3300044719 Ga0466971_0106129 Ga0466971_0106129_272_775 156
172 3300044765 Ga0466970_0001116 Ga0466970_0001116_11962_12465 156
173 3300044765 Ga0466970_0052593 Ga0466970_0052593_716_1198 156
174 3300045049 Ga0466959_0012525 Ga0466959_0012525_238_741 156
175 3300048913 Ga0496110_1440542 Ga0496110_1440542_71_547 156
176 3300048929 Ga0496126_0016764 Ga0496126_0016764_2043_2525 156
177 3300050490 nmdc:mga03n38_498_c1 nmdc:mga03n38_498_c1_7915_8421 156
178 3300050491 nmdc:mga00v17_6288_c1 nmdc:mga00v17_6288_c1_2236_2742 156
179 3300050494 nmdc:mga06z11_190771_c1 nmdc:mga06z11_190771_c1_642_1148 156
180 3300050496 nmdc:mga07m45_10512_c1 nmdc:mga07m45_10512_c1_2092_2598 156
181 3300050516 nmdc:mga0sz30_14668_c1 nmdc:mga0sz30_14668_c1_207_713 156
182 3300061719 Ga0466962_0064051 Ga0466962_0064051_12_515 156
183 iso_pu_bacteria 2738541274 2738704438 156
184 iso_pu_bacteria 2738543028 2739331079 156
185 3300005367 Ga0070667_100000190 Ga0070667_10000019013 157
186 3300005548 Ga0070665_100054494 Ga0070665_1000544944 157
187 3300005617 Ga0068859_100005865 Ga0068859_1000058652 157
188 3300005618 Ga0068864_100091698 Ga0068864_1000916982 157
189 3300005841 Ga0068863_100001346 Ga0068863_10000134612 157
190 3300005842 Ga0068858_100446852 Ga0068858_1004468522 157
191 3300005843 Ga0068860_100000099 Ga0068860_10000009993 157
192 3300005844 Ga0068862_100000086 Ga0068862_10000008694 157
193 3300006931 Ga0097620_100005865 Ga0097620_10000586513 157
194 3300009101 Ga0105247_10000051 Ga0105247_1000005189 157
195 3300009177 Ga0105248_10000339 Ga0105248_100003392 157
196 3300025900 Ga0207710_10000010 Ga0207710_10000010178 157
197 3300025923 Ga0207681_10002097 Ga0207681_100020976 157
198 3300025941 Ga0207711_10000301 Ga0207711_100003012 157
199 3300025986 Ga0207658_10000138 Ga0207658_1000013843 157
200 3300026088 Ga0207641_10001050 Ga0207641_1000105013 157
201 3300026095 Ga0207676_10074733 Ga0207676_100747332 157
202 3300028379 Ga0268266_10072868 Ga0268266_100728682 157
203 3300028380 Ga0268265_10000014 Ga0268265_10000014226 157
204 3300028381 Ga0268264_10000137 Ga0268264_1000013774 157
205 3300048903 Ga0496100_0041233 Ga0496100_0041233_928_1437 157
206 3300048904 Ga0496101_0009820 Ga0496101_0009820_728_1237 157
207 3300048905 Ga0496102_0000118 Ga0496102_0000118_22316_22825 157
208 3300048906 Ga0496103_0000129 Ga0496103_0000129_46135_46644 157
209 3300048910 Ga0496107_0016066 Ga0496107_0016066_235_744 157
210 3300048912 Ga0496109_0257093 Ga0496109_0257093_752_1261 157
211 3300048914 Ga0496111_0210148 Ga0496111_0210148_736_1245 157
212 3300048917 Ga0496114_0218137 Ga0496114_0218137_729_1238 157
213 3300048919 Ga0496116_0072685 Ga0496116_0072685_886_1395 157
214 3300048920 Ga0496117_0000304 Ga0496117_0000304_83737_84246 157
215 3300048921 Ga0496118_0001559 Ga0496118_0001559_25012_25521 157
216 3300048922 Ga0496119_0004722 Ga0496119_0004722_11875_12384 157
217 3300048923 Ga0496120_0078678 Ga0496120_0078678_863_1372 157
218 3300048924 Ga0496121_0036684 Ga0496121_0036684_532_1041 157
219 3300048929 Ga0496126_0003099 Ga0496126_0003099_3147_3656 157
220 3300021384 Ga0213876_10168431 Ga0213876_101684312 158
221 3300039437 Ga0436365_1640827 Ga0436365_1640827_9684_10190 158
222 3300049573 Ga0501037_0594270 Ga0501037_0594270_242_727 158
223 3300049581 Ga0501047_0015226 Ga0501047_0015226_3205_3690 158
224 3300049586 Ga0501070_0139895 Ga0501070_0139895_1380_1865 158
225 3300009553 Ga0105249_12653933 Ga0105249_126539331 159
226 3300048905 Ga0496102_0089231 Ga0496102_0089231_1478_1963 159
227 3300048906 Ga0496103_0205468 Ga0496103_0205468_320_805 159
228 3300048908 Ga0496105_0185865 Ga0496105_0185865_666_1151 159
229 3300048909 Ga0496106_0343844 Ga0496106_0343844_20_505 159
230 3300048917 Ga0496114_0346724 Ga0496114_0346724_642_1127 159
231 3300005347 Ga0070668_100008930 Ga0070668_1000089304 160
232 3300009092 Ga0105250_10121000 Ga0105250_101210002 160
233 3300025972 Ga0207668_10002603 Ga0207668_1000260310 160
234 3300046460 Ga0495638_0033042 Ga0495638_0033042_2482_2988 160
235 3300053104 Ga0500556_0003368 Ga0500556_0003368_3856_4362 160
236 3300053131 Ga0500652_063258 Ga0500652_063258_477_983 160
237 3300053142 Ga0500577_0012053 Ga0500577_0012053_1151_1657 160
238 3300053146 Ga0500588_0176554 Ga0500588_0176554_153_659 160
239 3300041509 Ga0451843_0613428 Ga0451843_0613428_120_638 161
240 3300044658 Ga0466972_0003083 Ga0466972_0003083_716_1204 161
241 3300044683 Ga0466965_0008833 Ga0466965_0008833_1577_2065 161
242 3300044684 Ga0466966_0298785 Ga0466966_0298785_375_863 161
243 3300044694 Ga0466963_0708948 Ga0466963_0708948_206_694 161
244 3300044719 Ga0466971_0087821 Ga0466971_0087821_554_1042 161
245 3300044735 Ga0466968_0038061 Ga0466968_0038061_536_1024 161
246 3300044765 Ga0466970_0076218 Ga0466970_0076218_603_1091 161
247 3300044842 Ga0466957_0295316 Ga0466957_0295316_478_966 161
248 3300044901 Ga0466960_0016320 Ga0466960_0016320_2001_2489 161
249 3300045049 Ga0466959_0024644 Ga0466959_0024644_3219_3707 161
250 3300045976 Ga0466967_0191213 Ga0466967_0191213_73_561 161
251 3300061719 Ga0466962_0417171 Ga0466962_0417171_117_605 161
252 iso_pu_bacteria 2939582691 2939589166 162
253 3300053153 Ga0500616_0006360 Ga0500616_0006360_1803_2309 163
254 3300005435 Ga0070714_100037899 Ga0070714_1000378995 164
255 3300005436 Ga0070713_100020391 Ga0070713_1000203912 164
256 3300005437 Ga0070710_10007995 Ga0070710_100079953 164
257 3300006028 Ga0070717_10261911 Ga0070717_102619112 164
258 3300006173 Ga0070716_100116837 Ga0070716_1001168372 164
259 3300006175 Ga0070712_100529341 Ga0070712_1005293411 164
260 3300025916 Ga0207663_10410249 Ga0207663_104102492 164
261 3300025939 Ga0207665_10231394 Ga0207665_102313942 164
262 3300044693 Ga0466961_0011981 Ga0466961_0011981_1004_1504 164
263 3300045049 Ga0466959_0034727 Ga0466959_0034727_1977_2477 164
264 3300047320 Ga0495672_0249832 Ga0495672_0249832_181_681 164
265 3300048928 Ga0496125_0190367 Ga0496125_0190367_129_629 164
266 3300053098 Ga0500650_0070832 Ga0500650_0070832_775_1275 164
267 3300053730 Ga0500645_058790 Ga0500645_058790_259_759 164
268 3300005435 Ga0070714_100421264 Ga0070714_1004212641 165
269 3300037853 Ga0436364_0725072 Ga0436364_0725072_33_539 165
270 3300049823 Ga0501044_0287611 Ga0501044_0287611_726_1229 165
271 3300053104 Ga0500556_0041733 Ga0500556_0041733_1093_1599 165
272 3300002070 JGI24750J21931_1033091 JGI24750J21931_10330911 166
273 3300002074 JGI24748J21848_1009575 JGI24748J21848_10095752 166
274 3300002076 JGI24749J21850_1021094 JGI24749J21850_10210942 166
275 3300002077 JGI24744J21845_10000463 JGI24744J21845_100004639 166
276 3300002239 JGI24034J26672_10013638 JGI24034J26672_100136382 166
277 3300002239 JGI24034J26672_10025056 JGI24034J26672_100250562 166
278 3300002459 JGI24751J29686_10027693 JGI24751J29686_100276931 166
279 3300005329 Ga0070683_100434795 Ga0070683_1004347952 166
280 3300005330 Ga0070690_100007309 Ga0070690_1000073092 166
281 3300005331 Ga0070670_100031486 Ga0070670_1000314863 166
282 3300005334 Ga0068869_100031587 Ga0068869_1000315875 166
283 3300005334 Ga0068869_100091634 Ga0068869_1000916343 166
284 3300005335 Ga0070666_10026947 Ga0070666_100269474 166
285 3300005336 Ga0070680_100205289 Ga0070680_1002052892 166
286 3300005337 Ga0070682_100010070 Ga0070682_1000100709 166
287 3300005337 Ga0070682_100010372 Ga0070682_1000103724 166
288 3300005337 Ga0070682_100065893 Ga0070682_1000658934 166
289 3300005337 Ga0070682_100371301 Ga0070682_1003713012 166
290 3300005338 Ga0068868_100000227 Ga0068868_10000022719 166
291 3300005339 Ga0070660_100169774 Ga0070660_1001697742 166
292 3300005340 Ga0070689_100080916 Ga0070689_1000809162 166
293 3300005341 Ga0070691_10012681 Ga0070691_100126814 166
294 3300005341 Ga0070691_10020911 Ga0070691_100209112 166
295 3300005345 Ga0070692_10137121 Ga0070692_101371211 166
296 3300005347 Ga0070668_100004054 Ga0070668_1000040545 166
297 3300005347 Ga0070668_100100583 Ga0070668_1001005833 166
298 3300005347 Ga0070668_100715813 Ga0070668_1007158132 166
299 3300005353 Ga0070669_100063130 Ga0070669_1000631304 166
300 3300005355 Ga0070671_100007716 Ga0070671_1000077162 166
301 3300005355 Ga0070671_100043898 Ga0070671_1000438985 166
302 3300005356 Ga0070674_100000223 Ga0070674_10000022328 166
303 3300005356 Ga0070674_100760108 Ga0070674_1007601082 166
304 3300005365 Ga0070688_100018740 Ga0070688_1000187402 166
305 3300005366 Ga0070659_100171375 Ga0070659_1001713752 166
306 3300005367 Ga0070667_100014397 Ga0070667_1000143973 166
307 3300005367 Ga0070667_100153415 Ga0070667_1001534153 166
308 3300005367 Ga0070667_100618509 Ga0070667_1006185092 166
309 3300005434 Ga0070709_10051067 Ga0070709_100510675 166
310 3300005435 Ga0070714_100106423 Ga0070714_1001064232 166
311 3300005437 Ga0070710_10001219 Ga0070710_100012196 166
312 3300005437 Ga0070710_10005585 Ga0070710_100055854 166
313 3300005438 Ga0070701_10000228 Ga0070701_1000022824 166
314 3300005439 Ga0070711_100000141 Ga0070711_10000014139 166
315 3300005439 Ga0070711_100003908 Ga0070711_1000039083 166
316 3300005440 Ga0070705_100194688 Ga0070705_1001946882 166
317 3300005441 Ga0070700_100017490 Ga0070700_1000174903 166
318 3300005441 Ga0070700_100063552 Ga0070700_1000635524 166
319 3300005444 Ga0070694_100006459 Ga0070694_1000064598 166
320 3300005455 Ga0070663_100005376 Ga0070663_1000053764 166
321 3300005455 Ga0070663_100011553 Ga0070663_1000115537 166
322 3300005455 Ga0070663_100368779 Ga0070663_1003687791 166
323 3300005456 Ga0070678_100001400 Ga0070678_10000140010 166
324 3300005456 Ga0070678_100033449 Ga0070678_1000334492 166
325 3300005456 Ga0070678_100143105 Ga0070678_1001431052 166
326 3300005457 Ga0070662_100010632 Ga0070662_1000106329 166
327 3300005457 Ga0070662_100473987 Ga0070662_1004739872 166
328 3300005457 Ga0070662_100477121 Ga0070662_1004771211 166
329 3300005459 Ga0068867_100003180 Ga0068867_1000031808 166
330 3300005466 Ga0070685_10198667 Ga0070685_101986672 166
331 3300005536 Ga0070697_100857464 Ga0070697_1008574642 166
332 3300005539 Ga0068853_100005781 Ga0068853_1000057812 166
333 3300005539 Ga0068853_100160522 Ga0068853_1001605222 166
334 3300005543 Ga0070672_100098442 Ga0070672_1000984422 166
335 3300005544 Ga0070686_100113787 Ga0070686_1001137873 166
336 3300005545 Ga0070695_100296411 Ga0070695_1002964112 166
337 3300005546 Ga0070696_100175599 Ga0070696_1001755992 166
338 3300005547 Ga0070693_100012047 Ga0070693_1000120475 166
339 3300005547 Ga0070693_100781726 Ga0070693_1007817261 166
340 3300005548 Ga0070665_100013464 Ga0070665_1000134649 166
341 3300005548 Ga0070665_100014376 Ga0070665_1000143768 166
342 3300005548 Ga0070665_100300849 Ga0070665_1003008492 166
343 3300005549 Ga0070704_100000712 Ga0070704_10000071214 166
344 3300005549 Ga0070704_100189676 Ga0070704_1001896762 166
345 3300005563 Ga0068855_100043985 Ga0068855_1000439857 166
346 3300005564 Ga0070664_100238794 Ga0070664_1002387942 166
347 3300005578 Ga0068854_100000492 Ga0068854_10000049218 166
348 3300005578 Ga0068854_100077794 Ga0068854_1000777942 166
349 3300005578 Ga0068854_101435636 Ga0068854_1014356361 166
350 3300005614 Ga0068856_100539368 Ga0068856_1005393682 166
351 3300005615 Ga0070702_100001938 Ga0070702_1000019388 166
352 3300005615 Ga0070702_100687643 Ga0070702_1006876431 166
353 3300005616 Ga0068852_100104127 Ga0068852_1001041273 166
354 3300005617 Ga0068859_100003815 Ga0068859_1000038152 166
355 3300005617 Ga0068859_100275604 Ga0068859_1002756044 166
356 3300005617 Ga0068859_100389408 Ga0068859_1003894083 166
357 3300005618 Ga0068864_100065577 Ga0068864_1000655772 166
358 3300005618 Ga0068864_100457140 Ga0068864_1004571402 166
359 3300005618 Ga0068864_101167259 Ga0068864_1011672591 166
360 3300005718 Ga0068866_10000345 Ga0068866_1000034514 166
361 3300005718 Ga0068866_10041768 Ga0068866_100417682 166
362 3300005719 Ga0068861_100001560 Ga0068861_10000156019 166
363 3300005719 Ga0068861_100157582 Ga0068861_1001575822 166
364 3300005841 Ga0068863_100007330 Ga0068863_1000073309 166
365 3300005841 Ga0068863_100059644 Ga0068863_1000596442 166
366 3300005841 Ga0068863_100134869 Ga0068863_1001348693 166
367 3300005842 Ga0068858_100003458 Ga0068858_10000345825 166
368 3300005842 Ga0068858_100495156 Ga0068858_1004951562 166
369 3300005843 Ga0068860_100000971 Ga0068860_10000097130 166
370 3300005843 Ga0068860_100119478 Ga0068860_1001194783 166
371 3300005844 Ga0068862_100006044 Ga0068862_1000060442 166
372 3300005844 Ga0068862_100185425 Ga0068862_1001854252 166
373 3300005937 Ga0081455_10038937 Ga0081455_100389374 166
374 3300005981 Ga0081538_10066974 Ga0081538_100669743 166
375 3300006038 Ga0075365_10047190 Ga0075365_100471904 166
376 3300006048 Ga0075363_100006312 Ga0075363_1000063122 166
377 3300006048 Ga0075363_100019432 Ga0075363_1000194325 166
378 3300006048 Ga0075363_100097136 Ga0075363_1000971362 166
379 3300006048 Ga0075363_100101914 Ga0075363_1001019142 166
380 3300006048 Ga0075363_100210492 Ga0075363_1002104922 166
381 3300006048 Ga0075363_100253855 Ga0075363_1002538552 166
382 3300006051 Ga0075364_10000628 Ga0075364_1000062810 166
383 3300006051 Ga0075364_10002372 Ga0075364_1000237210 166
384 3300006051 Ga0075364_10008061 Ga0075364_100080617 166
385 3300006051 Ga0075364_10480315 Ga0075364_104803151 166
386 3300006163 Ga0070715_10004747 Ga0070715_100047475 166
387 3300006163 Ga0070715_10177847 Ga0070715_101778472 166
388 3300006173 Ga0070716_100001458 Ga0070716_1000014583 166
389 3300006175 Ga0070712_100000607 Ga0070712_10000060714 166
390 3300006175 Ga0070712_100027836 Ga0070712_1000278366 166
391 3300006177 Ga0075362_10069694 Ga0075362_100696943 166
392 3300006178 Ga0075367_10010088 Ga0075367_100100882 166
393 3300006178 Ga0075367_10056712 Ga0075367_100567123 166
394 3300006178 Ga0075367_10209963 Ga0075367_102099632 166
395 3300006186 Ga0075369_10002372 Ga0075369_100023727 166
396 3300006186 Ga0075369_10014693 Ga0075369_100146934 166
397 3300006186 Ga0075369_10050856 Ga0075369_100508562 166
398 3300006186 Ga0075369_10250351 Ga0075369_102503511 166
399 3300006237 Ga0097621_100369637 Ga0097621_1003696372 166
400 3300006353 Ga0075370_10085933 Ga0075370_100859332 166
401 3300006353 Ga0075370_10268511 Ga0075370_102685112 166
402 3300006353 Ga0075370_10342781 Ga0075370_103427811 166
403 3300006358 Ga0068871_100143544 Ga0068871_1001435442 166
404 3300006844 Ga0075428_100001179 Ga0075428_1000011798 166
405 3300006846 Ga0075430_100092657 Ga0075430_1000926573 166
406 3300006846 Ga0075430_100176930 Ga0075430_1001769302 166
407 3300006847 Ga0075431_100009007 Ga0075431_10000900713 166
408 3300006871 Ga0075434_100862359 Ga0075434_1008623592 166
409 3300006880 Ga0075429_100197257 Ga0075429_1001972571 166
410 3300006881 Ga0068865_100001324 Ga0068865_10000132411 166
411 3300006881 Ga0068865_100102934 Ga0068865_1001029343 166
412 3300006931 Ga0097620_100003815 Ga0097620_1000038152 166
413 3300006931 Ga0097620_100275605 Ga0097620_1002756052 166
414 3300006931 Ga0097620_100389447 Ga0097620_1003894473 166
415 3300007788 Ga0099795_10013911 Ga0099795_100139113 166
416 3300009093 Ga0105240_11128359 Ga0105240_111283592 166
417 3300009094 Ga0111539_10733351 Ga0111539_107333511 166
418 3300009098 Ga0105245_10000678 Ga0105245_1000067827 166
419 3300009101 Ga0105247_10001857 Ga0105247_100018572 166
420 3300009147 Ga0114129_10024772 Ga0114129_100247724 166
421 3300009148 Ga0105243_10000534 Ga0105243_1000053417 166
422 3300009174 Ga0105241_10020235 Ga0105241_100202355 166
423 3300009176 Ga0105242_10000328 Ga0105242_100003282 166
424 3300009177 Ga0105248_10000842 Ga0105248_1000084221 166
425 3300010159 Ga0099796_10012357 Ga0099796_100123572 166
426 3300010375 Ga0105239_10012440 Ga0105239_100124409 166
427 3300013296 Ga0157374_10966538 Ga0157374_109665382 166
428 3300013297 Ga0157378_10001491 Ga0157378_1000149111 166
429 3300013306 Ga0163162_10337334 Ga0163162_103373342 166
430 3300013306 Ga0163162_10573343 Ga0163162_105733432 166
431 3300013307 Ga0157372_10052464 Ga0157372_100524642 166
432 3300014325 Ga0163163_10002474 Ga0163163_1000247419 166
433 3300014326 Ga0157380_10003919 Ga0157380_100039197 166
434 3300014745 Ga0157377_10235151 Ga0157377_102351512 166
435 3300014968 Ga0157379_10004006 Ga0157379_100040069 166
436 3300014969 Ga0157376_10084506 Ga0157376_100845062 166
437 3300017792 Ga0163161_10001669 Ga0163161_100016699 166
438 3300017792 Ga0163161_10012322 Ga0163161_100123222 166
439 3300025303 Ga0209051_1000021 Ga0209051_1000021139 166
440 3300025898 Ga0207692_10009243 Ga0207692_100092435 166
441 3300025899 Ga0207642_10000241 Ga0207642_1000024114 166
442 3300025899 Ga0207642_10016135 Ga0207642_100161352 166
443 3300025900 Ga0207710_10007136 Ga0207710_100071362 166
444 3300025900 Ga0207710_10429077 Ga0207710_104290772 166
445 3300025901 Ga0207688_10000427 Ga0207688_1000042713 166
446 3300025901 Ga0207688_10001234 Ga0207688_100012342 166
447 3300025903 Ga0207680_10213389 Ga0207680_102133892 166
448 3300025904 Ga0207647_10116939 Ga0207647_101169392 166
449 3300025905 Ga0207685_10011792 Ga0207685_100117924 166
450 3300025905 Ga0207685_10045983 Ga0207685_100459831 166
451 3300025906 Ga0207699_10011688 Ga0207699_100116884 166
452 3300025906 Ga0207699_10012233 Ga0207699_100122336 166
453 3300025907 Ga0207645_10071186 Ga0207645_100711862 166
454 3300025908 Ga0207643_10174110 Ga0207643_101741102 166
455 3300025911 Ga0207654_10055015 Ga0207654_100550154 166
456 3300025913 Ga0207695_10834189 Ga0207695_108341891 166
457 3300025914 Ga0207671_10127158 Ga0207671_101271583 166
458 3300025915 Ga0207693_10001162 Ga0207693_1000116217 166
459 3300025915 Ga0207693_10002211 Ga0207693_100022116 166
460 3300025916 Ga0207663_10000264 Ga0207663_1000026418 166
461 3300025916 Ga0207663_10006459 Ga0207663_100064596 166
462 3300025917 Ga0207660_10206788 Ga0207660_102067882 166
463 3300025919 Ga0207657_10088328 Ga0207657_100883283 166
464 3300025923 Ga0207681_10060089 Ga0207681_100600892 166
465 3300025924 Ga0207694_10652284 Ga0207694_106522841 166
466 3300025925 Ga0207650_10464444 Ga0207650_104644442 166
467 3300025926 Ga0207659_10143551 Ga0207659_101435512 166
468 3300025927 Ga0207687_10001116 Ga0207687_1000111610 166
469 3300025927 Ga0207687_10047008 Ga0207687_100470082 166
470 3300025928 Ga0207700_10391942 Ga0207700_103919422 166
471 3300025929 Ga0207664_10201017 Ga0207664_102010172 166
472 3300025931 Ga0207644_10004614 Ga0207644_1000461411 166
473 3300025931 Ga0207644_10176599 Ga0207644_101765992 166
474 3300025933 Ga0207706_10012871 Ga0207706_100128719 166
475 3300025933 Ga0207706_10174203 Ga0207706_101742033 166
476 3300025934 Ga0207686_10005970 Ga0207686_100059702 166
477 3300025934 Ga0207686_10026557 Ga0207686_100265574 166
478 3300025935 Ga0207709_10014636 Ga0207709_100146364 166
479 3300025935 Ga0207709_10597074 Ga0207709_105970741 166
480 3300025935 Ga0207709_11444106 Ga0207709_114441061 166
481 3300025936 Ga0207670_10128409 Ga0207670_101284092 166
482 3300025936 Ga0207670_10441742 Ga0207670_104417422 166
483 3300025937 Ga0207669_10003531 Ga0207669_1000353110 166
484 3300025937 Ga0207669_10199713 Ga0207669_101997131 166
485 3300025938 Ga0207704_10000621 Ga0207704_1000062113 166
486 3300025939 Ga0207665_10002223 Ga0207665_100022232 166
487 3300025939 Ga0207665_10003744 Ga0207665_100037447 166
488 3300025939 Ga0207665_10244953 Ga0207665_102449532 166
489 3300025940 Ga0207691_10134866 Ga0207691_101348662 166
490 3300025941 Ga0207711_10011033 Ga0207711_1001103310 166
491 3300025941 Ga0207711_11477164 Ga0207711_114771641 166
492 3300025942 Ga0207689_10132614 Ga0207689_101326142 166
493 3300025945 Ga0207679_10262469 Ga0207679_102624692 166
494 3300025949 Ga0207667_10389193 Ga0207667_103891932 166
495 3300025960 Ga0207651_10568873 Ga0207651_105688731 166
496 3300025961 Ga0207712_10005160 Ga0207712_100051608 166
497 3300025961 Ga0207712_10012964 Ga0207712_100129642 166
498 3300025961 Ga0207712_10311836 Ga0207712_103118361 166
499 3300025972 Ga0207668_10001338 Ga0207668_1000133818 166
500 3300025972 Ga0207668_10087665 Ga0207668_100876654 166
501 3300025981 Ga0207640_10001865 Ga0207640_1000186517 166
502 3300025981 Ga0207640_10665501 Ga0207640_106655011 166
503 3300025981 Ga0207640_10885200 Ga0207640_108852002 166
504 3300025986 Ga0207658_10011329 Ga0207658_100113292 166
505 3300025986 Ga0207658_10149779 Ga0207658_101497792 166
506 3300025986 Ga0207658_10364748 Ga0207658_103647482 166
507 3300025986 Ga0207658_10800937 Ga0207658_108009372 166
508 3300026023 Ga0207677_10001437 Ga0207677_1000143713 166
509 3300026023 Ga0207677_10200329 Ga0207677_102003293 166
510 3300026041 Ga0207639_10040020 Ga0207639_100400204 166
511 3300026041 Ga0207639_10171812 Ga0207639_101718122 166
512 3300026041 Ga0207639_10946749 Ga0207639_109467492 166
513 3300026067 Ga0207678_10009628 Ga0207678_100096289 166
514 3300026067 Ga0207678_10012044 Ga0207678_100120444 166
515 3300026067 Ga0207678_10021794 Ga0207678_100217948 166
516 3300026075 Ga0207708_10016016 Ga0207708_100160164 166
517 3300026075 Ga0207708_10052297 Ga0207708_100522973 166
518 3300026088 Ga0207641_10213098 Ga0207641_102130983 166
519 3300026088 Ga0207641_10902839 Ga0207641_109028392 166
520 3300026089 Ga0207648_10000085 Ga0207648_1000008585 166
521 3300026089 Ga0207648_10026164 Ga0207648_100261646 166
522 3300026095 Ga0207676_10070562 Ga0207676_100705624 166
523 3300026095 Ga0207676_10078661 Ga0207676_100786612 166
524 3300026095 Ga0207676_10379107 Ga0207676_103791071 166
525 3300026095 Ga0207676_10792313 Ga0207676_107923131 166
526 3300026118 Ga0207675_100010626 Ga0207675_1000106262 166
527 3300026118 Ga0207675_100217198 Ga0207675_1002171983 166
528 3300026118 Ga0207675_100338192 Ga0207675_1003381921 166
529 3300026121 Ga0207683_10000040 Ga0207683_1000004015 166
530 3300026121 Ga0207683_10053379 Ga0207683_100533792 166
531 3300026142 Ga0207698_10219016 Ga0207698_102190162 166
532 3300026142 Ga0207698_10987316 Ga0207698_109873161 166
533 3300027512 Ga0209179_1011560 Ga0209179_10115602 166
534 3300027866 Ga0209813_10086999 Ga0209813_100869992 166
535 3300028379 Ga0268266_10016548 Ga0268266_100165487 166
536 3300028379 Ga0268266_10205587 Ga0268266_102055872 166
537 3300028379 Ga0268266_10291797 Ga0268266_102917971 166
538 3300028379 Ga0268266_10382682 Ga0268266_103826822 166
539 3300028380 Ga0268265_10020473 Ga0268265_100204735 166
540 3300028381 Ga0268264_10000983 Ga0268264_1000098328 166
541 3300028381 Ga0268264_10249385 Ga0268264_102493852 166
542 3300028381 Ga0268264_10965613 Ga0268264_109656132 166
543 3300031731 Ga0307405_10173113 Ga0307405_101731132 166
544 3300031824 Ga0307413_10181182 Ga0307413_101811822 166
545 3300031852 Ga0307410_10062066 Ga0307410_100620662 166
546 3300031903 Ga0307407_10299614 Ga0307407_102996142 166
547 3300031911 Ga0307412_11369526 Ga0307412_113695261 166
548 3300031995 Ga0307409_100166827 Ga0307409_1001668272 166
549 3300032002 Ga0307416_100669382 Ga0307416_1006693822 166
550 3300032004 Ga0307414_10564690 Ga0307414_105646901 166
551 3300032005 Ga0307411_10411288 Ga0307411_104112881 166
552 3300032126 Ga0307415_100235662 Ga0307415_1002356622 166
553 3300035088 Ga0373940_0221083 Ga0373940_0221083_61_564 166
554 3300035091 Ga0373951_0044105 Ga0373951_0044105_540_1043 166
555 3300035121 Ga0373960_0088793 Ga0373960_0088793_12_515 166
556 3300035691 Ga0373931_0031990 Ga0373931_0031990_468_971 166
557 3300037418 Ga0395900_0942841 Ga0395900_0942841_13_516 166
558 3300037466 Ga0395898_1819952 Ga0395898_1819952_13_516 166
559 3300039437 Ga0436365_0607166 Ga0436365_0607166_477_983 166
560 3300039437 Ga0436365_1177168 Ga0436365_1177168_4888_5397 166
561 3300039450 Ga0436363_0182495 Ga0436363_0182495_51_560 166
562 3300041410 Ga0439461_0001144 Ga0439461_0001144_763_1266 166
563 3300041411 Ga0439466_0028779 Ga0439466_0028779_1126_1629 166
564 3300041411 Ga0439466_0105135 Ga0439466_0105135_280_783 166
565 3300041411 Ga0439466_0120704 Ga0439466_0120704_225_728 166
566 3300041413 Ga0439465_0022979 Ga0439465_0022979_808_1311 166
567 3300042435 Ga0439434_0011814 Ga0439434_0011814_1981_2484 166
568 3300044683 Ga0466965_0036885 Ga0466965_0036885_1705_2241 166
569 3300044901 Ga0466960_0093886 Ga0466960_0093886_81_584 166
570 3300045836 Ga0466958_0457874 Ga0466958_0457874_104_613 166
571 3300045976 Ga0466967_0049434 Ga0466967_0049434_2006_2515 166
572 3300045976 Ga0466967_0125293 Ga0466967_0125293_216_722 166
573 3300045976 Ga0466967_0827053 Ga0466967_0827053_259_762 166
574 3300046506 Ga0495583_0292731 Ga0495583_0292731_10_513 166
575 3300046513 Ga0495616_0170941 Ga0495616_0170941_41_547 166
576 3300046694 Ga0495649_0143517 Ga0495649_0143517_726_1229 166
577 3300047320 Ga0495672_0107481 Ga0495672_0107481_400_903 166
578 3300047320 Ga0495672_0173434 Ga0495672_0173434_579_1082 166
579 3300048088 Ga0495602_0686450 Ga0495602_0686450_51_566 166
580 3300048904 Ga0496101_0001844 Ga0496101_0001844_9706_10209 166
581 3300048904 Ga0496101_0007711 Ga0496101_0007711_4206_4766 166
582 3300048904 Ga0496101_0594179 Ga0496101_0594179_247_750 166
583 3300048905 Ga0496102_0004227 Ga0496102_0004227_7174_7677 166
584 3300048905 Ga0496102_0005536 Ga0496102_0005536_6255_6815 166
585 3300048905 Ga0496102_0249032 Ga0496102_0249032_573_1079 166
586 3300048905 Ga0496102_0343136 Ga0496102_0343136_561_1067 166
587 3300048906 Ga0496103_0061224 Ga0496103_0061224_353_913 166
588 3300048906 Ga0496103_0092004 Ga0496103_0092004_957_1460 166
589 3300048906 Ga0496103_0619317 Ga0496103_0619317_19_522 166
590 3300048907 Ga0496104_0007843 Ga0496104_0007843_6598_7101 166
591 3300048907 Ga0496104_0277844 Ga0496104_0277844_1074_1574 166
592 3300048908 Ga0496105_0381037 Ga0496105_0381037_187_747 166
593 3300048909 Ga0496106_0001227 Ga0496106_0001227_6760_7263 166
594 3300048910 Ga0496107_0001410 Ga0496107_0001410_3116_3619 166
595 3300048910 Ga0496107_0343306 Ga0496107_0343306_158_718 166
596 3300048911 Ga0496108_0063232 Ga0496108_0063232_1594_2094 166
597 3300048911 Ga0496108_0134748 Ga0496108_0134748_537_1043 166
598 3300048912 Ga0496109_0067894 Ga0496109_0067894_1475_1975 166
599 3300048913 Ga0496110_0034275 Ga0496110_0034275_3118_3621 166
600 3300048913 Ga0496110_0306324 Ga0496110_0306324_168_668 166
601 3300048914 Ga0496111_0233083 Ga0496111_0233083_717_1277 166
602 3300048914 Ga0496111_0267080 Ga0496111_0267080_494_994 166
603 3300048915 Ga0496112_0066915 Ga0496112_0066915_1274_1774 166
604 3300048916 Ga0496113_0078719 Ga0496113_0078719_1689_2189 166
605 3300048916 Ga0496113_0217941 Ga0496113_0217941_570_1130 166
606 3300048916 Ga0496113_0654535 Ga0496113_0654535_48_551 166
607 3300048917 Ga0496114_0003967 Ga0496114_0003967_689_1192 166
608 3300048917 Ga0496114_0305118 Ga0496114_0305118_211_714 166
609 3300048918 Ga0496115_0004528 Ga0496115_0004528_3706_4209 166
610 3300048921 Ga0496118_0000341 Ga0496118_0000341_46380_46886 166
611 3300048929 Ga0496126_0488989 Ga0496126_0488989_76_582 166
612 3300049570 Ga0501033_0090630 Ga0501033_0090630_349_858 166
613 3300049571 Ga0501034_0095168 Ga0501034_0095168_2012_2515 166
614 3300049581 Ga0501047_0417136 Ga0501047_0417136_127_630 166
615 3300049742 Ga0501080_0877617 Ga0501080_0877617_148_651 166
616 3300049822 Ga0501035_0276189 Ga0501035_0276189_408_917 166
617 3300050489 nmdc:mga03683_45385_c1 nmdc:mga03683_45385_c1_901_1404 166
618 3300050490 nmdc:mga03n38_128167_c1 nmdc:mga03n38_128167_c1_297_800 166
619 3300050490 nmdc:mga03n38_145986_c1 nmdc:mga03n38_145986_c1_444_947 166
620 3300050490 nmdc:mga03n38_146469_c1 nmdc:mga03n38_146469_c1_386_889 166
621 3300050490 nmdc:mga03n38_213511_c1 nmdc:mga03n38_213511_c1_287_790 166
622 3300050490 nmdc:mga03n38_31418_c1 nmdc:mga03n38_31418_c1_601_1104 166
623 3300050491 nmdc:mga00v17_4797_c1 nmdc:mga00v17_4797_c1_3351_3854 166
624 3300050491 nmdc:mga00v17_4944_c1 nmdc:mga00v17_4944_c1_3480_3983 166
625 3300050494 nmdc:mga06z11_114290_c1 nmdc:mga06z11_114290_c1_284_787 166
626 3300050496 nmdc:mga07m45_273574_c1 nmdc:mga07m45_273574_c1_276_779 166
627 3300050496 nmdc:mga07m45_3531_c1 nmdc:mga07m45_3531_c1_6516_7019 166
628 3300050507 nmdc:mga05p37_723596_c1 nmdc:mga05p37_723596_c1_22_525 166
629 3300050508 nmdc:mga09592_711915_c1 nmdc:mga09592_711915_c1_297_800 166
630 3300050509 nmdc:mga0qj67_245454_c1 nmdc:mga0qj67_245454_c1_147_650 166
631 3300050509 nmdc:mga0qj67_98568_c1 nmdc:mga0qj67_98568_c1_191_694 166
632 3300050512 nmdc:mga0n895_757912_c1 nmdc:mga0n895_757912_c1_281_829 166
633 3300050516 nmdc:mga0sz30_14998_c1 nmdc:mga0sz30_14998_c1_2092_2595 166
634 3300050516 nmdc:mga0sz30_2809_c1 nmdc:mga0sz30_2809_c1_3869_4372 166
635 3300053138 Ga0500564_178160 Ga0500564_178160_19_555 166
636 3300061719 Ga0466962_0070005 Ga0466962_0070005_731_1240 166
637 iso_pu_bacteria 2738541264 2738665379 166
638 iso_pu_bacteria 2738541356 2739144513 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08534

Redoxin

Redoxin

21

142

0.86

PF00578

AhpC-TSA

AhpC/TSA family

23

132

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lu4-assembly1.cif.gz_A 1.1 angstrom resolution crystal structure of a secreted mycobacterium tuberculosis disulfide oxidoreductase homologous to e. coli dsbe: implications for functions 0.9867 32 164
1lu4-assembly1.cif.gz_A 1.1 angstrom resolution crystal structure of a secreted mycobacterium tuberculosis disulfide oxidoreductase homologous to e. coli dsbe: implications for functions 0.9722 32 164
3ios-assembly1.cif.gz_A structure of mtb dsbf in its mixed oxidized and reduced forms 0.9557 31 165
3ios-assembly1.cif.gz_A structure of mtb dsbf in its mixed oxidized and reduced forms 0.9488 31 165
2h1g-assembly1.cif.gz_A resa c74a/c77a 0.9222 37 165
ID Description Score Start End Superfamily
3iosA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9557 31 165 3.40.30.10
3iosA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9488 31 165 3.40.30.10
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9215 37 165 3.40.30.10
af_I6XYM2_34_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8965 23 164 3.40.30.10
af_O06392_67_205_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8742 39 164 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A060IMM9-F1-model_v4 Soluble secreted antigen 0.9996 35 164 GO:0016209
GO:0016491
AF-A0A2S8NGW2-F1-model_v4 deleted 0.9985 51 132
AF-A0A655AQT7-F1-model_v4 Soluble secreted antigen MPT53 0.9964 31 164 GO:0016209
GO:0016491
AF-A0A1X0IL61-F1-model_v4 Thiol:disulfide interchange protein 0.972 35 165 GO:0016209
GO:0016491
AF-A0A2S8NGW2-F1-model_v4 deleted 0.9633 51 132

Feature Viewer

pLDDT pTM Quality
88.53 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map