F471474

General Info

Members Datasets Scaffolds Average Seq Length
637 288 627 316

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_6028_c1|nmdc:mga09592_6028_c1_6047_7114
Length 355
Sequence MLPARHWQAGGIIEYQKKILKNKLKKSKIEVKFFIIINLYTMSRLKFMIALLTVITSYKQLHCQQVQITKEQLIALTPLWTGDRFPDGRPKVPDDIMKRMKSVSVEEAWAVMKNAGYGYQIAEGWQVINPDSVLVGRAVTATFMPGRPDVWKAIDSAGKKQGKRGQNTWAVDLLVKGDVYVADQFGAHRNGPTIGDNVGNAIYARSGNGIVYDGALRDVEGLKEIDGFTAFYSSYDPSYHNPTGDLTTMIVGINQPTRIRTVTVMPGDVVLGKLGIVVFIPPHLAERVVTTSEIVRLRDMFGHQRLREGKYTAGQIDTRWSDEIERDFSKWLNDHINELPVPKEQIQKYLKDRTW

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2818991444 Filimonas endophytica 3197 Isolate Unclassified
4 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
5 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
6 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
7 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
8 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
9 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
10 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
16 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
119 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
120 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
175 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
176 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
177 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
190 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
191 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
192 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
193 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
194 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
195 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
196 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
197 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
198 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
199 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
200 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
201 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
202 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
203 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
214 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
219 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
232 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
233 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
246 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
247 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
248 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
249 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
250 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
251 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
252 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
253 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
254 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
255 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
256 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
257 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
258 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
259 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
260 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
261 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
262 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
266 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
269 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
274 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
275 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
276 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
277 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
278 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
279 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
280 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
281 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
282 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
283 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
284 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
285 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
286 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
287 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
288 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.27
Metatranscriptomes 0
Isolates 1.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.85
Nodule 0
Rhizoplane 2.04
Rhizosphere 83.67
Stem 0
Stem Tuber 0
Unclassified 6.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010686 3300001979 Bacteria 3522
2 JGI24740J21852_10029148 3300001979 Unclassified 1816
3 JGI24739J22299_10000891 3300001989 Bacteria 11042
4 JGI24737J22298_10002359 3300001990 Bacteria 6728
5 JGI24735J21928_10000002 3300002067 Bacteria 624895
6 JGI24751J29686_10000589 3300002459 Bacteria 9743
7 JGI25154J39366_1000073 3300002738 Bacteria 92928
8 JGI25153J46596_10002735 3300003215 Bacteria 10050
9 rootH1_10002571 3300003316 Bacteria 6971
10 rootH1_10007094 3300003316 Bacteria 23342
11 rootH1_10135168 3300003316 Bacteria 1766
12 rootH1_10137532 3300003316 Bacteria 1866
13 rootH2_10126160 3300003320 Bacteria 6895
14 rootH2_10173791 3300003320 Unclassified 1830
15 rootH2_10175794 3300003320 Bacteria 3957
16 rootL2_10016899 3300003322 Bacteria 7006
17 rootL2_10076611 3300003322 Bacteria 15075
18 rootL2_10201290 3300003322 Bacteria 1204
19 rootL2_10278457 3300003322 Bacteria 3012
20 rootH1_10000759 3300003323 Bacteria 51501
21 rootH1_10004404 3300003323 Bacteria 27148
22 rootH1_10006645 3300003323 Bacteria 138273
23 rootH1_10034661 3300003323 Bacteria 5822
24 rootH1_10073696 3300003316 Bacteria 1097
25 rootH1_10073696 3300003323 Bacteria 1604
26 rootH1_10165904 3300003323 Bacteria 1591
27 rootH1_10351761 3300003323 Bacteria 1854
28 JGI25160J50197_1001184 3300003354 Bacteria 13298
29 Ga0055526_1004984 3300003771 Bacteria 7790
30 Ga0055526_1018541 3300003771 Bacteria 2592
31 Ga0055528_1000072 3300003790 Bacteria 77661
32 Ga0055530_10001331 3300003791 Bacteria 18499
33 Ga0065165_1000038 3300005262 Bacteria 211664
34 Ga0065714_10078127 3300005288 Unclassified 2627
35 Ga0065704_10113937 3300005289 Bacteria 1893
36 Ga0065712_10002491 3300005290 Bacteria 5029
37 Ga0065712_10002820 3300005290 Bacteria 9435
38 Ga0065712_10019398 3300005290 Bacteria 2168
39 Ga0065712_10120171 3300005290 Bacteria 1682
40 Ga0065712_10137784 3300005290 Bacteria 1466
41 Ga0065712_10208330 3300005290 Bacteria 1075
42 Ga0065715_10000581 3300005293 Bacteria 14312
43 Ga0065715_10028810 3300005293 Bacteria 1352
44 Ga0065715_10166553 3300005293 Bacteria 1576
45 Ga0065707_10168424 3300005295 Bacteria 1503
46 Ga0065707_10280051 3300005295 Bacteria 1050
47 Ga0070658_10023521 3300005327 Bacteria 4943
48 Ga0070658_10075016 3300005327 Bacteria 2774
49 Ga0070676_10016892 3300005328 Bacteria 4034
50 Ga0070676_10017898 3300005328 Unclassified 3923
51 Ga0070676_10133554 3300005328 Unclassified 1572
52 Ga0070683_100026743 3300005329 Bacteria 5199
53 Ga0070690_100069209 3300005330 Bacteria 2290
54 Ga0070690_100172599 3300005330 Bacteria 1489
55 Ga0070670_100018750 3300005331 Bacteria 5933
56 Ga0070670_100041313 3300005331 Bacteria 3964
57 Ga0070670_100230303 3300005331 Unclassified 1612
58 Ga0070677_10124609 3300005333 Bacteria 1168
59 Ga0068869_100052661 3300005334 Bacteria 2956
60 Ga0068869_100107086 3300005334 Bacteria 2122
61 Ga0070666_10000052 3300005335 Bacteria 99095
62 Ga0070666_10008027 3300005335 Bacteria 6531
63 Ga0070666_10070536 3300005335 Bacteria 2377
64 Ga0070680_100022639 3300005336 Bacteria 5007
65 Ga0070682_100081222 3300005337 Bacteria 2098
66 Ga0068868_100028013 3300005338 Bacteria 4302
67 Ga0070689_100009434 3300005340 Bacteria 6918
68 Ga0070689_100130123 3300005340 Bacteria 2018
69 Ga0070661_100158993 3300005344 Bacteria 1711
70 Ga0070668_100056501 3300005347 Unclassified 3031
71 Ga0070669_100036766 3300005353 Bacteria 3550
72 Ga0070669_100067361 3300005353 Unclassified 2641
73 Ga0070669_100192080 3300005353 Bacteria 1602
74 Ga0070669_100234102 3300005353 Bacteria 1457
75 Ga0070669_100523397 3300005353 Bacteria 986
76 Ga0070675_100018111 3300005354 Bacteria 5606
77 Ga0070675_100056265 3300005354 Bacteria 3241
78 Ga0070675_100076665 3300005354 Bacteria 2781
79 Ga0070675_100078509 3300005354 Bacteria 2749
80 Ga0070674_100127552 3300005356 Bacteria 1892
81 Ga0070674_100178446 3300005356 Unclassified 1625
82 Ga0070674_100359602 3300005356 Bacteria 1178
83 Ga0070673_100048839 3300005364 Unclassified 3301
84 Ga0070673_100109089 3300005364 Bacteria 2293
85 Ga0070673_100142550 3300005364 Bacteria 2023
86 Ga0070673_100407186 3300005364 Bacteria 1217
87 Ga0070673_100437818 3300005364 Unclassified 1174
88 Ga0070688_100003773 3300005365 Bacteria 7849
89 Ga0070688_100009299 3300005365 Bacteria 5369
90 Ga0070688_100092013 3300005365 Bacteria 1983
91 Ga0070688_100111044 3300005365 Unclassified 1823
92 Ga0070688_100114381 3300005365 Bacteria 1799
93 Ga0070667_100062281 3300005367 Bacteria 3160
94 Ga0070667_100131448 3300005367 Bacteria 2185
95 Ga0070667_100190494 3300005367 Bacteria 1817
96 Ga0070713_100373412 3300005436 Bacteria 1327
97 Ga0070701_10094619 3300005438 Bacteria 1644
98 Ga0070678_100027719 3300005456 Bacteria 3850
99 Ga0070678_100089933 3300005456 Unclassified 2351
100 Ga0070678_100274743 3300005456 Bacteria 1422
101 Ga0070678_100375267 3300005456 Bacteria 1229
102 Ga0070662_100345941 3300005457 Bacteria 1217
103 Ga0070681_10257294 3300005458 Bacteria 1658
104 Ga0068867_100005513 3300005459 Bacteria 8955
105 Ga0068867_100259117 3300005459 Bacteria 1417
106 Ga0070685_10012719 3300005466 Bacteria 4427
107 Ga0070685_10017272 3300005466 Bacteria 3859
108 Ga0070685_10076802 3300005466 Unclassified 1993
109 Ga0070698_100001104 3300005471 Bacteria 29751
110 Ga0070698_100005455 3300005471 Bacteria 13891
111 Ga0070698_100009442 3300005471 Bacteria 10450
112 Ga0070698_100018854 3300005471 Bacteria 7259
113 Ga0070679_100184536 3300005530 Bacteria 2058
114 Ga0068853_100127766 3300005539 Bacteria 2272
115 Ga0068853_100192716 3300005539 Unclassified 1852
116 Ga0070672_100022568 3300005543 Bacteria 4625
117 Ga0070672_100137701 3300005543 Bacteria 2011
118 Ga0070672_100171855 3300005543 Bacteria 1803
119 Ga0070672_100231410 3300005543 Unclassified 1553
120 Ga0070672_100234686 3300005543 Bacteria 1542
121 Ga0070686_100028522 3300005544 Bacteria 3386
122 Ga0070665_100000006 3300005548 Bacteria 718034
123 Ga0070665_100024663 3300005548 Bacteria 6060
124 Ga0070665_100447422 3300005548 Unclassified 1301
125 Ga0068855_100024942 3300005563 Bacteria 7156
126 Ga0068855_100092304 3300005563 Unclassified 3492
127 Ga0068855_100113271 3300005563 Unclassified 3112
128 Ga0068855_100475284 3300005563 Bacteria 1361
129 Ga0070664_100035847 3300005564 Bacteria 4166
130 Ga0070664_100473570 3300005564 Bacteria 1152
131 Ga0068857_100070726 3300005577 Bacteria 3108
132 Ga0068856_100006063 3300005614 Bacteria 11881
133 Ga0068852_100397950 3300005616 Bacteria 1354
134 Ga0068852_100574397 3300005616 Bacteria 1130
135 Ga0068859_100000112 3300005617 Bacteria 77364
136 Ga0068859_100003332 3300005617 Bacteria 16330
137 Ga0068859_100003931 3300005617 Bacteria 15178
138 Ga0068859_100053843 3300005617 Unclassified 4046
139 Ga0068859_100095934 3300005617 Bacteria 3018
140 Ga0068859_100117085 3300005617 Bacteria 2729
141 Ga0068859_100188872 3300005617 Bacteria 2144
142 Ga0068859_100211180 3300005617 Bacteria 2027
143 Ga0068859_100407979 3300005617 Bacteria 1455
144 Ga0068859_100484377 3300005617 Bacteria 1332
145 Ga0068864_100269368 3300005618 Bacteria 1586
146 Ga0068864_100326104 3300005618 Bacteria 1443
147 Ga0068864_100366916 3300005618 Bacteria 1362
148 Ga0068864_100647618 3300005618 Bacteria 1029
149 Ga0068866_10011873 3300005718 Bacteria 3784
150 Ga0068861_100015533 3300005719 Bacteria 5368
151 Ga0068861_100030201 3300005719 Unclassified 3970
152 Ga0068861_100172263 3300005719 Bacteria 1795
153 Ga0068861_100542992 3300005719 Unclassified 1058
154 Ga0068851_10030603 3300005834 Bacteria 2670
155 Ga0068851_10144876 3300005834 Unclassified 1295
156 Ga0068870_10027373 3300005840 Unclassified 2851
157 Ga0068870_10054764 3300005840 Bacteria 2123
158 Ga0068863_100000476 3300005841 Bacteria 41058
159 Ga0068863_100000485 3300005841 Bacteria 40572
160 Ga0068863_100146065 3300005841 Unclassified 2262
161 Ga0068863_100225396 3300005841 Bacteria 1807
162 Ga0068863_100308975 3300005841 Bacteria 1534
163 Ga0068863_100414112 3300005841 Bacteria 1319
164 Ga0068858_100004033 3300005842 Bacteria 14492
165 Ga0068860_100000005 3300005843 Bacteria 472349
166 Ga0068860_100002587 3300005843 Bacteria 18931
167 Ga0068860_100008380 3300005843 Bacteria 10296
168 Ga0068860_100012112 3300005843 Bacteria 8496
169 Ga0068860_100013334 3300005843 Bacteria 8058
170 Ga0068860_100027488 3300005843 Bacteria 5479
171 Ga0068860_100031078 3300005843 Bacteria 5135
172 Ga0068860_100124977 3300005843 Bacteria 2465
173 Ga0068862_100009068 3300005844 Bacteria 8236
174 Ga0081539_10000696 3300005985 Bacteria 67397
175 Ga0075366_10001999 3300006195 Bacteria 10335
176 Ga0097621_100013866 3300006237 Bacteria 6017
177 Ga0097621_100052122 3300006237 Bacteria 3332
178 Ga0097621_100180952 3300006237 Bacteria 1821
179 Ga0097621_100326199 3300006237 Bacteria 1361
180 Ga0097621_100506797 3300006237 Bacteria 1094
181 Ga0068871_100015239 3300006358 Bacteria 5749
182 Ga0068871_100049270 3300006358 Unclassified 3404
183 Ga0068871_100057137 3300006358 Bacteria 3174
184 Ga0068871_100504142 3300006358 Unclassified 1091
185 Ga0075428_100003121 3300006844 Bacteria 18092
186 Ga0075428_100007566 3300006844 Bacteria 12034
187 Ga0075428_100023094 3300006844 Bacteria 6882
188 Ga0075428_100069853 3300006844 Bacteria 3840
189 Ga0075431_100012508 3300006847 Bacteria 8568
190 Ga0075429_100018759 3300006880 Bacteria 5990
191 Ga0075429_100184814 3300006880 Unclassified 1826
192 Ga0068865_100051554 3300006881 Bacteria 2849
193 Ga0068865_100129557 3300006881 Unclassified 1888
194 Ga0068865_100189753 3300006881 Bacteria 1588
195 Ga0097620_100000112 3300006931 Bacteria 77364
196 Ga0097620_100003332 3300006931 Bacteria 16330
197 Ga0097620_100003931 3300006931 Bacteria 15178
198 Ga0097620_100053844 3300006931 Unclassified 4046
199 Ga0097620_100095935 3300006931 Bacteria 3018
200 Ga0097620_100117076 3300006931 Bacteria 2729
201 Ga0097620_100188881 3300006931 Bacteria 2144
202 Ga0097620_100211189 3300006931 Bacteria 2027
203 Ga0097620_100408002 3300006931 Bacteria 1455
204 Ga0097620_100484375 3300006931 Bacteria 1332
205 Ga0105240_10000283 3300009093 Bacteria 99553
206 Ga0105240_10006407 3300009093 Bacteria 17305
207 Ga0105240_10068430 3300009093 Bacteria 4397
208 Ga0105240_10258780 3300009093 Bacteria 2009
209 Ga0111539_10003923 3300009094 Bacteria 19552
210 Ga0111539_10009064 3300009094 Bacteria 12594
211 Ga0111539_10080365 3300009094 Bacteria 3835
212 Ga0111539_10155517 3300009094 Bacteria 2676
213 Ga0111539_10343652 3300009094 Bacteria 1737
214 Ga0105245_10065301 3300009098 Bacteria 3291
215 Ga0105245_10115016 3300009098 Bacteria 2506
216 Ga0105245_10130853 3300009098 Unclassified 2353
217 Ga0105247_10001001 3300009101 Bacteria 21346
218 Ga0105247_10008670 3300009101 Bacteria 6196
219 Ga0114129_10001007 3300009147 Bacteria 36711
220 Ga0105243_10044799 3300009148 Bacteria 3473
221 Ga0105241_10000542 3300009174 Bacteria 28454
222 Ga0105241_10000789 3300009174 Bacteria 24075
223 Ga0105241_10008239 3300009174 Bacteria 7676
224 Ga0105241_10147647 3300009174 Bacteria 1920
225 Ga0105241_10278892 3300009174 Unclassified 1427
226 Ga0105242_10033102 3300009176 Bacteria 4137
227 Ga0105242_10357634 3300009176 Unclassified 1350
228 Ga0105248_10033347 3300009177 Bacteria 5752
229 Ga0105237_10000248 3300009545 Bacteria 76402
230 Ga0105237_10000316 3300009545 Bacteria 67633
231 Ga0105237_10000555 3300009545 Bacteria 52309
232 Ga0105237_10007107 3300009545 Bacteria 12302
233 Ga0105237_10007832 3300009545 Bacteria 11647
234 Ga0105237_10015582 3300009545 Bacteria 7906
235 Ga0105237_10369288 3300009545 Unclassified 1439
236 Ga0105238_10003699 3300009551 Bacteria 15225
237 Ga0105238_10024907 3300009551 Bacteria 6098
238 Ga0105238_10032876 3300009551 Bacteria 5280
239 Ga0105249_10005603 3300009553 Bacteria 10858
240 Ga0105249_10038533 3300009553 Bacteria 4337
241 Ga0105249_10049682 3300009553 Bacteria 3825
242 Ga0105249_10076748 3300009553 Bacteria 3098
243 Ga0105249_10193639 3300009553 Bacteria 1986
244 Ga0105249_10222172 3300009553 Bacteria 1859
245 Ga0105249_10295896 3300009553 Bacteria 1622
246 Ga0105239_10000012 3300010375 Bacteria 332279
247 Ga0105239_10000996 3300010375 Bacteria 39663
248 Ga0105239_10009807 3300010375 Bacteria 10760
249 Ga0105239_10012968 3300010375 Bacteria 9272
250 Ga0105239_10027035 3300010375 Bacteria 6316
251 Ga0105239_10108959 3300010375 Bacteria 3068
252 Ga0105239_10184403 3300010375 Bacteria 2335
253 Ga0105239_10220174 3300010375 Bacteria 2129
254 Ga0105239_10411678 3300010375 Unclassified 1531
255 Ga0105246_10051177 3300011119 Bacteria 2835
256 Ga0105246_10185632 3300011119 Bacteria 1605
257 Ga0157371_10015293 3300013102 Bacteria 5762
258 Ga0157370_10040114 3300013104 Bacteria 4521
259 Ga0157370_10103111 3300013104 Bacteria 2671
260 Ga0157370_10267326 3300013104 Unclassified 1580
261 Ga0157370_10298575 3300013104 Bacteria 1487
262 Ga0157369_10016317 3300013105 Bacteria 8359
263 Ga0157369_10033191 3300013105 Bacteria 5674
264 Ga0157369_10248061 3300013105 Bacteria 1859
265 Ga0157374_10045096 3300013296 Bacteria 4080
266 Ga0157374_10107133 3300013296 Bacteria 2686
267 Ga0157374_10162126 3300013296 Bacteria 2178
268 Ga0157378_10006346 3300013297 Bacteria 10345
269 Ga0157378_10014971 3300013297 Bacteria 6792
270 Ga0157378_10200539 3300013297 Bacteria 1887
271 Ga0157378_10418182 3300013297 Bacteria 1324
272 Ga0163162_10000780 3300013306 Bacteria 29667
273 Ga0163162_10004252 3300013306 Bacteria 13772
274 Ga0163162_10004980 3300013306 Bacteria 12798
275 Ga0163162_10086250 3300013306 Bacteria 3217
276 Ga0163162_10113575 3300013306 Bacteria 2807
277 Ga0163162_10394079 3300013306 Bacteria 1517
278 Ga0157372_10026322 3300013307 Bacteria 6329
279 Ga0157372_10068004 3300013307 Bacteria 4005
280 Ga0157372_10106252 3300013307 Bacteria 3211
281 Ga0157372_10216765 3300013307 Bacteria 2218
282 Ga0157372_10226937 3300013307 Unclassified 2165
283 Ga0157372_10314040 3300013307 Bacteria 1824
284 Ga0157372_10466324 3300013307 Unclassified 1472
285 Ga0157372_10747647 3300013307 Bacteria 1137
286 Ga0157375_10017395 3300013308 Bacteria 6487
287 Ga0157375_10064060 3300013308 Bacteria 3659
288 Ga0157375_10122087 3300013308 Unclassified 2716
289 Ga0157375_10228226 3300013308 Unclassified 2021
290 Ga0157375_10290153 3300013308 Bacteria 1799
291 Ga0157375_10401383 3300013308 Bacteria 1537
292 Ga0157375_10508081 3300013308 Bacteria 1369
293 Ga0157375_10522218 3300013308 Unclassified 1350
294 Ga0157375_10921203 3300013308 Unclassified 1017
295 Ga0163163_10027242 3300014325 Bacteria 5473
296 Ga0163163_10100291 3300014325 Bacteria 2918
297 Ga0163163_10499661 3300014325 Bacteria 1278
298 Ga0157380_10002095 3300014326 Bacteria 13370
299 Ga0157380_10025100 3300014326 Bacteria 4518
300 Ga0157380_10054181 3300014326 Bacteria 3182
301 Ga0157380_10060986 3300014326 Bacteria 3016
302 Ga0157380_10126512 3300014326 Bacteria 2173
303 Ga0157380_10144973 3300014326 Bacteria 2045
304 Ga0157380_10316930 3300014326 Bacteria 1444
305 Ga0157377_10068455 3300014745 Unclassified 2046
306 Ga0157377_10154731 3300014745 Bacteria 1421
307 Ga0157377_10265661 3300014745 Unclassified 1118
308 Ga0157379_10194992 3300014968 Bacteria 1830
309 Ga0157379_10212388 3300014968 Bacteria 1752
310 Ga0157376_10002778 3300014969 Bacteria 11957
311 Ga0157376_10122142 3300014969 Unclassified 2310
312 Ga0157376_10175790 3300014969 Bacteria 1953
313 Ga0163161_10015684 3300017792 Bacteria 5284
314 Ga0163161_10097717 3300017792 Bacteria 2181
315 Ga0209258_108861 3300025242 Bacteria 1384
316 Ga0209646_1000158 3300025246 Bacteria 92980
317 Ga0209026_1000372 3300025250 Bacteria 41244
318 Ga0209673_1000130 3300025273 Bacteria 163870
319 Ga0209564_1001031 3300025295 Bacteria 34240
320 Ga0209564_1001446 3300025295 Bacteria 24259
321 Ga0209758_1001017 3300025297 Bacteria 37093
322 Ga0209758_1002050 3300025297 Bacteria 21606
323 Ga0209758_1018652 3300025297 Bacteria 3388
324 Ga0209050_1000530 3300025298 Bacteria 63406
325 Ga0209050_1004932 3300025298 Bacteria 8714
326 Ga0207426_1000175 3300025302 Bacteria 160332
327 Ga0207426_1000452 3300025302 Bacteria 65182
328 Ga0207426_1000546 3300025302 Bacteria 52783
329 Ga0207426_1034809 3300025302 Bacteria 1613
330 Ga0209257_1000005 3300025304 Bacteria 1592528
331 Ga0209257_1001901 3300025304 Bacteria 22582
332 Ga0209257_1033802 3300025304 Bacteria 1603
333 Ga0207697_10018086 3300025315 Unclassified 2893
334 Ga0207697_10028728 3300025315 Bacteria 2275
335 Ga0207682_10049610 3300025893 Bacteria 1733
336 Ga0207688_10030630 3300025901 Bacteria 2967
337 Ga0207688_10094927 3300025901 Bacteria 1716
338 Ga0207680_10000035 3300025903 Bacteria 73889
339 Ga0207680_10046771 3300025903 Bacteria 2560
340 Ga0207645_10002051 3300025907 Bacteria 16146
341 Ga0207645_10139119 3300025907 Bacteria 1581
342 Ga0207643_10007403 3300025908 Bacteria 5888
343 Ga0207643_10025522 3300025908 Unclassified 3266
344 Ga0207654_10003031 3300025911 Bacteria 8521
345 Ga0207654_10058105 3300025911 Bacteria 2251
346 Ga0207654_10178063 3300025911 Unclassified 1385
347 Ga0207695_10000043 3300025913 Bacteria 444585
348 Ga0207695_10000684 3300025913 Bacteria 66519
349 Ga0207695_10007221 3300025913 Bacteria 14201
350 Ga0207695_10033618 3300025913 Bacteria 5590
351 Ga0207695_10060863 3300025913 Bacteria 3905
352 Ga0207671_10000671 3300025914 Bacteria 44609
353 Ga0207671_10001862 3300025914 Bacteria 23553
354 Ga0207671_10006909 3300025914 Bacteria 10007
355 Ga0207671_10009233 3300025914 Bacteria 8264
356 Ga0207662_10078420 3300025918 Bacteria 2011
357 Ga0207652_10093286 3300025921 Bacteria 2649
358 Ga0207681_10003807 3300025923 Bacteria 9358
359 Ga0207681_10028940 3300025923 Unclassified 3593
360 Ga0207681_10204466 3300025923 Bacteria 1518
361 Ga0207681_10230795 3300025923 Bacteria 1436
362 Ga0207681_10310752 3300025923 Unclassified 1250
363 Ga0207694_10025494 3300025924 Bacteria 4495
364 Ga0207694_10053114 3300025924 Bacteria 3141
365 Ga0207694_10079145 3300025924 Bacteria 2578
366 Ga0207650_10008851 3300025925 Bacteria 6879
367 Ga0207650_10028254 3300025925 Unclassified 4020
368 Ga0207650_10051265 3300025925 Unclassified 3054
369 Ga0207650_10107503 3300025925 Bacteria 2155
370 Ga0207659_10011068 3300025926 Bacteria 5687
371 Ga0207659_10042019 3300025926 Unclassified 3204
372 Ga0207659_10044660 3300025926 Bacteria 3119
373 Ga0207659_10081136 3300025926 Unclassified 2397
374 Ga0207659_10122011 3300025926 Bacteria 1998
375 Ga0207644_10034412 3300025931 Bacteria 3545
376 Ga0207644_10164397 3300025931 Bacteria 1728
377 Ga0207706_10033823 3300025933 Bacteria 4549
378 Ga0207686_10021158 3300025934 Bacteria 3728
379 Ga0207670_10002843 3300025936 Bacteria 9138
380 Ga0207670_10105669 3300025936 Bacteria 2018
381 Ga0207670_10189829 3300025936 Bacteria 1554
382 Ga0207669_10149947 3300025937 Bacteria 1632
383 Ga0207704_10078754 3300025938 Bacteria 2121
384 Ga0207704_10103240 3300025938 Bacteria 1906
385 Ga0207704_10326768 3300025938 Unclassified 1185
386 Ga0207691_10006112 3300025940 Bacteria 11634
387 Ga0207691_10021148 3300025940 Bacteria 6148
388 Ga0207691_10030613 3300025940 Bacteria 5027
389 Ga0207691_10031864 3300025940 Bacteria 4920
390 Ga0207691_10073006 3300025940 Bacteria 3094
391 Ga0207711_10084514 3300025941 Bacteria 2778
392 Ga0207689_10001648 3300025942 Bacteria 21164
393 Ga0207689_10003645 3300025942 Bacteria 14064
394 Ga0207689_10079665 3300025942 Bacteria 2692
395 Ga0207689_10120452 3300025942 Unclassified 2159
396 Ga0207689_10164404 3300025942 Bacteria 1829
397 Ga0207689_10216834 3300025942 Bacteria 1581
398 Ga0207661_10019647 3300025944 Bacteria 5042
399 Ga0207661_10282872 3300025944 Bacteria 1483
400 Ga0207679_10168273 3300025945 Bacteria 1802
401 Ga0207667_10082516 3300025949 Unclassified 3330
402 Ga0207667_10139460 3300025949 Unclassified 2496
403 Ga0207651_10012554 3300025960 Unclassified 4802
404 Ga0207651_10058851 3300025960 Bacteria 2657
405 Ga0207712_10008927 3300025961 Bacteria 6338
406 Ga0207712_10019270 3300025961 Bacteria 4454
407 Ga0207712_10060938 3300025961 Unclassified 2677
408 Ga0207712_10137635 3300025961 Bacteria 1870
409 Ga0207712_10164151 3300025961 Unclassified 1729
410 Ga0207712_10274988 3300025961 Bacteria 1372
411 Ga0207668_10107898 3300025972 Bacteria 2083
412 Ga0207658_10034283 3300025986 Bacteria 3627
413 Ga0207658_10043583 3300025986 Bacteria 3263
414 Ga0207658_10453257 3300025986 Bacteria 1136
415 Ga0207677_10205745 3300026023 Unclassified 1568
416 Ga0207677_10294379 3300026023 Bacteria 1338
417 Ga0207703_10038026 3300026035 Bacteria 3838
418 Ga0207639_10029911 3300026041 Bacteria 3992
419 Ga0207639_10137745 3300026041 Bacteria 2030
420 Ga0207639_10462311 3300026041 Bacteria 1154
421 Ga0207708_10018999 3300026075 Bacteria 5175
422 Ga0207708_10132976 3300026075 Bacteria 1946
423 Ga0207702_10326173 3300026078 Unclassified 1463
424 Ga0207641_10000013 3300026088 Bacteria 341378
425 Ga0207641_10030258 3300026088 Bacteria 4484
426 Ga0207641_10147089 3300026088 Bacteria 2131
427 Ga0207648_10002853 3300026089 Bacteria 18290
428 Ga0207648_10032643 3300026089 Bacteria 4595
429 Ga0207648_10070605 3300026089 Bacteria 3045
430 Ga0207648_10100242 3300026089 Bacteria 2537
431 Ga0207648_10122798 3300026089 Bacteria 2284
432 Ga0207648_10173638 3300026089 Unclassified 1906
433 Ga0207648_10223267 3300026089 Bacteria 1675
434 Ga0207676_10013262 3300026095 Bacteria 5920
435 Ga0207676_10017270 3300026095 Bacteria 5230
436 Ga0207676_10160464 3300026095 Bacteria 1947
437 Ga0207676_10281362 3300026095 Bacteria 1510
438 Ga0207674_10049557 3300026116 Bacteria 4295
439 Ga0207674_10052177 3300026116 Bacteria 4171
440 Ga0207674_10081584 3300026116 Bacteria 3236
441 Ga0207675_100000148 3300026118 Bacteria 61193
442 Ga0207675_100032835 3300026118 Bacteria 4836
443 Ga0207675_100630831 3300026118 Bacteria 1077
444 Ga0207683_10002413 3300026121 Bacteria 16319
445 Ga0207683_10051395 3300026121 Bacteria 3611
446 Ga0207683_10107900 3300026121 Bacteria 2491
447 Ga0207683_10375584 3300026121 Bacteria 1306
448 Ga0207698_10075623 3300026142 Bacteria 2692
449 Ga0207428_10080679 3300027907 Unclassified 2541
450 Ga0268266_10000010 3300028379 Bacteria 1030233
451 Ga0268266_10058744 3300028379 Unclassified 3312
452 Ga0268266_10161132 3300028379 Unclassified 2030
453 Ga0268265_10025386 3300028380 Unclassified 4205
454 Ga0268265_10191859 3300028380 Bacteria 1765
455 Ga0268265_10661785 3300028380 Bacteria 1005
456 Ga0268264_10000012 3300028381 Bacteria 521740
457 Ga0268264_10001276 3300028381 Bacteria 23868
458 Ga0268264_10010422 3300028381 Bacteria 7683
459 Ga0268264_10021751 3300028381 Bacteria 5236
460 Ga0268264_10021889 3300028381 Bacteria 5218
461 Ga0268264_10025702 3300028381 Bacteria 4810
462 Ga0268264_10141404 3300028381 Bacteria 2147
463 Ga0268264_10250297 3300028381 Bacteria 1646
464 Ga0307515_10000001 3300028794 Bacteria 4259510
465 Ga0307515_10000493 3300028794 Bacteria 94441
466 Ga0307515_10077470 3300028794 Bacteria 4390
467 Ga0307515_10229348 3300028794 Bacteria 1654
468 Ga0307515_10324168 3300028794 Bacteria 1204
469 Ga0316176_1183533 3300030732 Bacteria 4537
470 Ga0316183_1018965 3300030742 Bacteria 17476
471 Ga0316181_1020976 3300030744 Bacteria 6961
472 Ga0316182_1078834 3300030745 Bacteria 2541
473 Ga0307513_10185057 3300031456 Bacteria 1941
474 Ga0307513_10256823 3300031456 Bacteria 1540
475 Ga0307509_10024602 3300031507 Bacteria 6739
476 Ga0307408_100006842 3300031548 Bacteria 7560
477 Ga0307516_10202973 3300031730 Unclassified 1701
478 Ga0307413_10200580 3300031824 Bacteria 1441
479 Ga0307409_100263924 3300031995 Unclassified 1582
480 Ga0307416_100466736 3300032002 Bacteria 1319
481 Ga0307414_10000116 3300032004 Bacteria 56780
482 Ga0307414_10002034 3300032004 Bacteria 10506
483 Ga0307414_10079898 3300032004 Unclassified 2389
484 Ga0307414_10110950 3300032004 Bacteria 2088
485 Ga0307414_10271998 3300032004 Bacteria 1419
486 Ga0307414_10284209 3300032004 Bacteria 1392
487 Ga0307415_100032847 3300032126 Bacteria 3362
488 Ga0395900_0257029 3300037418 Bacteria 1746
489 Ga0395900_0272471 3300037418 Bacteria 1687
490 Ga0395905_0029083 3300037471 Bacteria 5208
491 Ga0316581_0054521 3300037588 Unclassified 1226
492 Ga0400483_029604 3300039062 Bacteria 1896
493 Ga0400483_263152 3300039062 Bacteria 2887
494 Ga0451787_220232 3300041441 Unclassified 1190
495 Ga0451800_0977102 3300041459 Bacteria 2080
496 Ga0451807_0193273 3300041486 Bacteria 1725
497 Ga0451807_2549040 3300041486 Bacteria 2991
498 Ga0451849_0953876 3300041505 Bacteria 2140
499 Ga0439442_006913 3300042002 Bacteria 2279
500 Ga0439443_020647 3300042003 Bacteria 1036
501 Ga0439457_005833 3300042014 Bacteria 3057
502 Ga0439462_0038759 3300042015 Bacteria 1270
503 Ga0450899_004392 3300042135 Bacteria 1512
504 Ga0439434_0044304 3300042435 Bacteria 1371
505 Ga0451577_0001672 3300042876 Bacteria 28652
506 Ga0451577_0040368 3300042876 Bacteria 4190
507 Ga0451577_0323694 3300042876 Unclassified 1398
508 Ga0466972_0000066 3300044658 Bacteria 103012
509 Ga0466972_0045552 3300044658 Bacteria 2125
510 Ga0453683_0164207 3300044673 Unclassified 1405
511 Ga0453684_0000721 3300044712 Bacteria 116843
512 Ga0453684_0013285 3300044712 Bacteria 13409
513 Ga0453684_0165136 3300044712 Bacteria 2614
514 Ga0466957_0000150 3300044842 Bacteria 30176
515 Ga0466957_0001411 3300044842 Bacteria 12525
516 Ga0466960_0052919 3300044901 Unclassified 1966
517 Ga0451576_0002506 3300045051 Bacteria 27244
518 Ga0451576_0069421 3300045051 Bacteria 3667
519 Ga0451576_0119976 3300045051 Unclassified 2738
520 Ga0495638_0000036 3300046460 Bacteria 275731
521 Ga0495650_0000023 3300046471 Bacteria 527763
522 Ga0495594_0023032 3300046499 Unclassified 3336
523 Ga0495583_0027285 3300046506 Bacteria 2820
524 Ga0495608_0177220 3300046511 Unclassified 1350
525 Ga0495610_0002537 3300046512 Bacteria 15227
526 Ga0495616_0014057 3300046513 Bacteria 4495
527 Ga0495630_0349779 3300046517 Bacteria 1131
528 Ga0495648_0002890 3300046524 Bacteria 15450
529 Ga0495648_0045567 3300046524 Bacteria 2727
530 Ga0495640_0151882 3300046533 Bacteria 1488
531 Ga0495609_0010682 3300046538 Bacteria 4395
532 Ga0495633_0009916 3300046558 Bacteria 5230
533 Ga0495668_0001178 3300046616 Bacteria 26625
534 Ga0495634_0038935 3300046642 Unclassified 3240
535 Ga0495611_0000010 3300046648 Bacteria 156661
536 Ga0495611_0054926 3300046648 Bacteria 1801
537 Ga0495625_0001061 3300046660 Bacteria 35942
538 Ga0495625_0034208 3300046660 Bacteria 3752
539 Ga0495625_0108059 3300046660 Bacteria 1903
540 Ga0495635_0302457 3300046663 Unclassified 1072
541 Ga0495661_0003335 3300046665 Bacteria 11894
542 Ga0495661_0048217 3300046665 Bacteria 2589
543 Ga0495647_0065363 3300046681 Bacteria 1444
544 Ga0495658_0276296 3300046683 Bacteria 1059
545 Ga0495670_0130595 3300046691 Bacteria 1309
546 Ga0495600_0065627 3300046809 Unclassified 2373
547 Ga0495680_0120150 3300047322 Bacteria 1940
548 Ga0495687_000009 3300047443 Bacteria 419317
549 Ga0495687_001020 3300047443 Bacteria 27944
550 Ga0495687_068543 3300047443 Bacteria 1432
551 Ga0495673_0038359 3300047469 Bacteria 2180
552 Ga0495686_0009118 3300047472 Bacteria 7189
553 Ga0496101_0414250 3300048904 Unclassified 1062
554 Ga0496102_0360460 3300048905 Bacteria 1369
555 Ga0496105_0013838 3300048908 Bacteria 6409
556 Ga0496109_0028710 3300048912 Bacteria 4979
557 Ga0496110_0020933 3300048913 Bacteria 5526
558 Ga0496112_0006341 3300048915 Bacteria 10382
559 Ga0496114_0019940 3300048917 Bacteria 5439
560 Ga0496115_0072931 3300048918 Bacteria 2786
561 Ga0496124_0106380 3300048927 Bacteria 2265
562 Ga0501043_0169602 3300049579 Unclassified 1703
563 Ga0501043_0332946 3300049579 Bacteria 1156
564 Ga0501047_0012642 3300049581 Bacteria 7998
565 Ga0501047_0050589 3300049581 Bacteria 4013
566 Ga0501201_001603 3300049651 Bacteria 2098
567 Ga0501202_008246 3300049652 Unclassified 1897
568 Ga0501207_012181 3300049654 Bacteria 1290
569 Ga0501217_001658 3300049661 Bacteria 4236
570 Ga0501217_058639 3300049661 Bacteria 1023
571 Ga0501222_010718 3300049662 Bacteria 1210
572 Ga0501224_006316 3300049664 Bacteria 1718
573 Ga0501227_038973 3300049665 Bacteria 1168
574 Ga0501235_005152 3300049669 Bacteria 2840
575 Ga0501236_000320 3300049670 Bacteria 5206
576 Ga0501257_017552 3300049686 Bacteria 1665
577 Ga0501257_021141 3300049686 Bacteria 1533
578 Ga0501259_002124 3300049688 Bacteria 3261
579 Ga0501261_002818 3300049690 Bacteria 2136
580 Ga0501221_002776 3300049704 Bacteria 2881
581 Ga0501225_0005390 3300049705 Bacteria 3758
582 Ga0501245_007219 3300049708 Bacteria 1568
583 Ga0501264_000131 3300049761 Bacteria 11704
584 Ga0501270_009860 3300049767 Bacteria 1244
585 Ga0501279_002300 3300049775 Bacteria 2511
586 Ga0501035_0200676 3300049822 Unclassified 1711
587 Ga0501044_0009291 3300049823 Bacteria 10730
588 Ga0501044_0555975 3300049823 Bacteria 1044
589 nmdc:mga0k408_91557_c1 3300050493 Bacteria 1786
590 nmdc:mga07m45_270534_c1 3300050496 Bacteria 988
591 nmdc:mga05p37_829_c1 3300050507 Bacteria 34660
592 nmdc:mga09592_36077_c1 3300050508 Bacteria 4141
593 nmdc:mga09592_6028_c1 3300050508 Bacteria 9886
594 nmdc:mga0qj67_216932_c1 3300050509 Bacteria 1553
595 nmdc:mga0qj67_236671_c1 3300050509 Unclassified 1482
596 nmdc:mga06r32_281091_c1 3300050510 Bacteria 1651
597 nmdc:mga06r32_6788_c1 3300050510 Bacteria 10285
598 nmdc:mga08y16_25950_c1 3300050511 Bacteria 6182
599 nmdc:mga08y16_277736_c1 3300050511 Bacteria 1728
600 nmdc:mga08y16_555811_c1 3300050511 Unclassified 1161
601 nmdc:mga08y16_8721_c1 3300050511 Bacteria 10633
602 Ga0495601_0029684 3300053077 Bacteria 3393
603 Ga0495595_0024675 3300053084 Unclassified 2657
604 Ga0500578_0000042 3300053086 Bacteria 129410
605 Ga0500578_0013541 3300053086 Bacteria 5254
606 Ga0500644_0057918 3300053088 Bacteria 1354
607 Ga0500583_0000023 3300053092 Bacteria 123584
608 Ga0500583_0001456 3300053092 Bacteria 6786
609 Ga0500583_0143882 3300053092 Bacteria 1185
610 Ga0500650_0112605 3300053098 Bacteria 1270
611 Ga0500562_003715 3300053108 Bacteria 3839
612 Ga0500642_0077571 3300053130 Bacteria 1521
613 Ga0500655_008874 3300053133 Unclassified 1809
614 Ga0500559_0027994 3300053136 Bacteria 2406
615 Ga0500568_0000753 3300053139 Bacteria 23079
616 Ga0500588_0052620 3300053146 Bacteria 1276
617 Ga0500616_0000004 3300053153 Bacteria 1002714
618 Ga0500616_0003930 3300053153 Bacteria 10918
619 Ga0500616_0023912 3300053153 Bacteria 3400
620 Ga0500616_0133422 3300053153 Unclassified 1170
621 Ga0500622_0000006 3300053156 Bacteria 464021
622 Ga0500622_0000061 3300053156 Bacteria 132248
623 Ga0500622_0001926 3300053156 Bacteria 15649
624 Ga0500622_0002754 3300053156 Bacteria 12384
625 Ga0500622_0006530 3300053156 Bacteria 6741
626 Ga0500611_000048 3300053727 Bacteria 56160
627 Ga0500645_032848 3300053730 Bacteria 1555

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049704 Ga0501221_002776 Ga0501221_002776_2041_2811 255
2 3300049708 Ga0501245_007219 Ga0501245_007219_13_783 255
3 3300026118 Ga0207675_100630831 Ga0207675_1006308312 285
4 3300046683 Ga0495658_0276296 Ga0495658_0276296_165_1025 285
5 3300009176 Ga0105242_10033102 Ga0105242_100331024 287
6 3300009551 Ga0105238_10024907 Ga0105238_100249073 287
7 3300010375 Ga0105239_10012968 Ga0105239_100129683 287
8 3300039062 Ga0400483_263152 Ga0400483_263152_744_1637 289
9 3300053139 Ga0500568_0000753 Ga0500568_0000753_17539_18423 291
10 3300032004 Ga0307414_10079898 Ga0307414_100798981 293
11 3300032004 Ga0307414_10271998 Ga0307414_102719982 293
12 3300005843 Ga0068860_100000005 Ga0068860_100000005318 296
13 3300009553 Ga0105249_10193639 Ga0105249_101936392 296
14 3300013306 Ga0163162_10000780 Ga0163162_1000078020 296
15 3300028381 Ga0268264_10000012 Ga0268264_10000012300 296
16 3300037588 Ga0316581_0054521 Ga0316581_0054521_296_1210 296
17 3300009094 Ga0111539_10155517 Ga0111539_101555173 297
18 3300053086 Ga0500578_0000042 Ga0500578_0000042_42800_43738 297
19 3300049662 Ga0501222_010718 Ga0501222_010718_265_1164 298
20 3300050511 nmdc:mga08y16_277736_c1 nmdc:mga08y16_277736_c1_339_1265 298
21 3300009545 Ga0105237_10000248 Ga0105237_1000024828 299
22 3300013102 Ga0157371_10015293 Ga0157371_100152936 299
23 3300013308 Ga0157375_10921203 Ga0157375_109212031 299
24 3300025304 Ga0209257_1033802 Ga0209257_10338022 299
25 3300025914 Ga0207671_10000671 Ga0207671_1000067133 299
26 3300046558 Ga0495633_0009916 Ga0495633_0009916_814_1737 299
27 3300046642 Ga0495634_0038935 Ga0495634_0038935_26_934 299
28 3300049775 Ga0501279_002300 Ga0501279_002300_1003_1917 299
29 3300053153 Ga0500616_0000004 Ga0500616_0000004_514514_515416 299
30 3300005843 Ga0068860_100008380 Ga0068860_1000083805 300
31 3300009093 Ga0105240_10068430 Ga0105240_100684303 300
32 3300009545 Ga0105237_10369288 Ga0105237_103692881 300
33 3300025986 Ga0207658_10034283 Ga0207658_100342832 300
34 3300028381 Ga0268264_10010422 Ga0268264_100104228 300
35 3300044673 Ga0453683_0164207 Ga0453683_0164207_427_1332 300
36 3300045051 Ga0451576_0002506 Ga0451576_0002506_2134_3039 300
37 3300041505 Ga0451849_0953876 Ga0451849_0953876_1138_2076 301
38 3300049581 Ga0501047_0012642 Ga0501047_0012642_1734_2672 301
39 3300005843 Ga0068860_100002587 Ga0068860_1000025878 302
40 3300009093 Ga0105240_10006407 Ga0105240_100064073 302
41 3300009545 Ga0105237_10000555 Ga0105237_1000055517 302
42 3300009551 Ga0105238_10032876 Ga0105238_100328763 302
43 3300010375 Ga0105239_10220174 Ga0105239_102201742 302
44 3300013104 Ga0157370_10040114 Ga0157370_100401142 302
45 3300013105 Ga0157369_10033191 Ga0157369_100331914 302
46 3300014968 Ga0157379_10212388 Ga0157379_102123881 302
47 3300025914 Ga0207671_10009233 Ga0207671_100092332 302
48 3300025924 Ga0207694_10025494 Ga0207694_100254943 302
49 3300042002 Ga0439442_006913 Ga0439442_006913_1016_1936 302
50 3300005333 Ga0070677_10124609 Ga0070677_101246091 303
51 3300005353 Ga0070669_100523397 Ga0070669_1005233971 303
52 3300005364 Ga0070673_100109089 Ga0070673_1001090892 303
53 3300005438 Ga0070701_10094619 Ga0070701_100946191 303
54 3300005456 Ga0070678_100274743 Ga0070678_1002747431 303
55 3300025901 Ga0207688_10030630 Ga0207688_100306302 303
56 3300025940 Ga0207691_10031864 Ga0207691_100318641 303
57 3300037471 Ga0395905_0029083 Ga0395905_0029083_179_1135 303
58 3300049579 Ga0501043_0332946 Ga0501043_0332946_207_1136 303
59 3300049823 Ga0501044_0555975 Ga0501044_0555975_25_954 303
60 3300053156 Ga0500622_0002754 Ga0500622_0002754_5144_6058 303
61 3300003323 rootH1_10000759 rootH1_1000075930 304
62 3300005290 Ga0065712_10120171 Ga0065712_101201712 304
63 3300005293 Ga0065715_10028810 Ga0065715_100288102 304
64 3300005340 Ga0070689_100009434 Ga0070689_1000094342 304
65 3300005354 Ga0070675_100078509 Ga0070675_1000785092 304
66 3300005456 Ga0070678_100027719 Ga0070678_1000277193 304
67 3300005466 Ga0070685_10012719 Ga0070685_100127192 304
68 3300009094 Ga0111539_10009064 Ga0111539_100090648 304
69 3300011119 Ga0105246_10185632 Ga0105246_101856322 304
70 3300013308 Ga0157375_10401383 Ga0157375_104013831 304
71 3300014326 Ga0157380_10316930 Ga0157380_103169302 304
72 3300025925 Ga0207650_10107503 Ga0207650_101075032 304
73 3300026075 Ga0207708_10018999 Ga0207708_100189993 304
74 3300026121 Ga0207683_10051395 Ga0207683_100513952 304
75 3300028381 Ga0268264_10001276 Ga0268264_1000127610 304
76 3300046691 Ga0495670_0130595 Ga0495670_0130595_131_1072 304
77 3300050511 nmdc:mga08y16_555811_c1 nmdc:mga08y16_555811_c1_65_1006 304
78 3300053153 Ga0500616_0133422 Ga0500616_0133422_14_931 304
79 iso_pu_bacteria 2910245624 2910246571 304
80 iso_pu_bacteria 2919692658 2919697166 304
81 3300039062 Ga0400483_029604 Ga0400483_029604_826_1782 305
82 3300041441 Ga0451787_220232 Ga0451787_220232_149_1069 305
83 3300041459 Ga0451800_0977102 Ga0451800_0977102_820_1740 305
84 3300041486 Ga0451807_2549040 Ga0451807_2549040_1423_2343 305
85 3300049686 Ga0501257_017552 Ga0501257_017552_235_1155 305
86 3300050508 nmdc:mga09592_36077_c1 nmdc:mga09592_36077_c1_57_983 305
87 3300050510 nmdc:mga06r32_281091_c1 nmdc:mga06r32_281091_c1_125_1051 305
88 3300005353 Ga0070669_100192080 Ga0070669_1001920802 306
89 3300005617 Ga0068859_100484377 Ga0068859_1004843771 306
90 3300005843 Ga0068860_100012112 Ga0068860_1000121125 306
91 3300006931 Ga0097620_100484375 Ga0097620_1004843751 306
92 3300009174 Ga0105241_10008239 Ga0105241_100082394 306
93 3300010375 Ga0105239_10411678 Ga0105239_104116781 306
94 3300013105 Ga0157369_10016317 Ga0157369_100163179 306
95 3300013307 Ga0157372_10466324 Ga0157372_104663242 306
96 3300013307 Ga0157372_10747647 Ga0157372_107476472 306
97 3300025913 Ga0207695_10007221 Ga0207695_1000722110 306
98 3300025936 Ga0207670_10189829 Ga0207670_101898292 306
99 3300025942 Ga0207689_10079665 Ga0207689_100796652 306
100 3300026095 Ga0207676_10013262 Ga0207676_100132625 306
101 3300028381 Ga0268264_10021751 Ga0268264_100217513 306
102 3300032002 Ga0307416_100466736 Ga0307416_1004667362 306
103 3300032004 Ga0307414_10000116 Ga0307414_1000011622 306
104 3300048905 Ga0496102_0360460 Ga0496102_0360460_414_1352 306
105 iso_pu_bacteria 2599185184 2599478142 306
106 iso_pu_bacteria 2919437846 2919441572 306
107 iso_pu_bacteria 2928078545 2928080098 306
108 iso_pu_bacteria 2928147474 2928149732 306
109 3300013104 Ga0157370_10103111 Ga0157370_101031112 307
110 3300014969 Ga0157376_10175790 Ga0157376_101757902 307
111 3300049651 Ga0501201_001603 Ga0501201_001603_1033_1971 307
112 3300049654 Ga0501207_012181 Ga0501207_012181_132_1070 307
113 3300049661 Ga0501217_001658 Ga0501217_001658_3264_4202 307
114 3300049664 Ga0501224_006316 Ga0501224_006316_420_1358 307
115 3300049665 Ga0501227_038973 Ga0501227_038973_108_1046 307
116 3300049669 Ga0501235_005152 Ga0501235_005152_234_1172 307
117 3300049686 Ga0501257_021141 Ga0501257_021141_470_1408 307
118 3300049688 Ga0501259_002124 Ga0501259_002124_261_1199 307
119 3300049690 Ga0501261_002818 Ga0501261_002818_1022_1960 307
120 3300053086 Ga0500578_0013541 Ga0500578_0013541_413_1351 307
121 iso_pu_bacteria 2818991444 2819588551 307
122 iso_pu_bacteria 2929921140 2929924070 307
123 3300005288 Ga0065714_10078127 Ga0065714_100781271 308
124 3300005328 Ga0070676_10133554 Ga0070676_101335542 308
125 3300005356 Ga0070674_100127552 Ga0070674_1001275521 308
126 3300005356 Ga0070674_100178446 Ga0070674_1001784462 308
127 3300005466 Ga0070685_10076802 Ga0070685_100768022 308
128 3300005563 Ga0068855_100092304 Ga0068855_1000923045 308
129 3300005563 Ga0068855_100113271 Ga0068855_1001132712 308
130 3300005617 Ga0068859_100003931 Ga0068859_10000393115 308
131 3300005841 Ga0068863_100225396 Ga0068863_1002253962 308
132 3300006931 Ga0097620_100003931 Ga0097620_10000393115 308
133 3300009174 Ga0105241_10278892 Ga0105241_102788921 308
134 3300010375 Ga0105239_10000996 Ga0105239_1000099614 308
135 3300013296 Ga0157374_10162126 Ga0157374_101621262 308
136 3300013307 Ga0157372_10216765 Ga0157372_102167652 308
137 3300014326 Ga0157380_10060986 Ga0157380_100609863 308
138 3300025911 Ga0207654_10178063 Ga0207654_101780632 308
139 3300025913 Ga0207695_10033618 Ga0207695_100336182 308
140 3300025913 Ga0207695_10060863 Ga0207695_100608632 308
141 3300025924 Ga0207694_10053114 Ga0207694_100531141 308
142 3300025931 Ga0207644_10164397 Ga0207644_101643972 308
143 3300025949 Ga0207667_10082516 Ga0207667_100825162 308
144 3300025949 Ga0207667_10139460 Ga0207667_101394602 308
145 3300026041 Ga0207639_10029911 Ga0207639_100299112 308
146 3300026078 Ga0207702_10326173 Ga0207702_103261732 308
147 3300026088 Ga0207641_10030258 Ga0207641_100302582 308
148 3300046648 Ga0495611_0000010 Ga0495611_0000010_34453_35403 308
149 3300049767 Ga0501270_009860 Ga0501270_009860_61_1008 308
150 3300053146 Ga0500588_0052620 Ga0500588_0052620_63_1013 308
151 3300053153 Ga0500616_0003930 Ga0500616_0003930_6127_7077 308
152 3300053727 Ga0500611_000048 Ga0500611_000048_23300_24277 308
153 iso_pu_bacteria 2738541278 2738728156 308
154 3300001979 JGI24740J21852_10029148 JGI24740J21852_100291481 309
155 3300001990 JGI24737J22298_10002359 JGI24737J22298_100023592 309
156 3300002067 JGI24735J21928_10000002 JGI24735J21928_1000000295 309
157 3300002459 JGI24751J29686_10000589 JGI24751J29686_100005893 309
158 3300003316 rootH1_10007094 rootH1_100070947 309
159 3300003320 rootH2_10173791 rootH2_101737912 309
160 3300003320 rootH2_10175794 rootH2_101757942 309
161 3300003323 rootH1_10073696 rootH1_100736962 309
162 3300005293 Ga0065715_10166553 Ga0065715_101665532 309
163 3300005295 Ga0065707_10168424 Ga0065707_101684241 309
164 3300005327 Ga0070658_10023521 Ga0070658_100235211 309
165 3300005327 Ga0070658_10075016 Ga0070658_100750162 309
166 3300005331 Ga0070670_100018750 Ga0070670_1000187504 309
167 3300005335 Ga0070666_10000052 Ga0070666_1000005222 309
168 3300005336 Ga0070680_100022639 Ga0070680_1000226394 309
169 3300005353 Ga0070669_100234102 Ga0070669_1002341022 309
170 3300005354 Ga0070675_100076665 Ga0070675_1000766652 309
171 3300005364 Ga0070673_100142550 Ga0070673_1001425502 309
172 3300005364 Ga0070673_100407186 Ga0070673_1004071862 309
173 3300005367 Ga0070667_100131448 Ga0070667_1001314482 309
174 3300005456 Ga0070678_100375267 Ga0070678_1003752672 309
175 3300005458 Ga0070681_10257294 Ga0070681_102572942 309
176 3300005459 Ga0068867_100259117 Ga0068867_1002591172 309
177 3300005471 Ga0070698_100009442 Ga0070698_1000094426 309
178 3300005471 Ga0070698_100018854 Ga0070698_1000188542 309
179 3300005539 Ga0068853_100192716 Ga0068853_1001927162 309
180 3300005543 Ga0070672_100171855 Ga0070672_1001718552 309
181 3300005543 Ga0070672_100231410 Ga0070672_1002314101 309
182 3300005563 Ga0068855_100024942 Ga0068855_1000249423 309
183 3300005563 Ga0068855_100475284 Ga0068855_1004752841 309
184 3300005577 Ga0068857_100070726 Ga0068857_1000707262 309
185 3300005617 Ga0068859_100000112 Ga0068859_1000001126 309
186 3300005617 Ga0068859_100188872 Ga0068859_1001888722 309
187 3300005617 Ga0068859_100407979 Ga0068859_1004079792 309
188 3300005719 Ga0068861_100030201 Ga0068861_1000302012 309
189 3300005719 Ga0068861_100542992 Ga0068861_1005429921 309
190 3300005834 Ga0068851_10030603 Ga0068851_100306033 309
191 3300005841 Ga0068863_100000485 Ga0068863_10000048521 309
192 3300005842 Ga0068858_100004033 Ga0068858_1000040336 309
193 3300005843 Ga0068860_100013334 Ga0068860_1000133342 309
194 3300005985 Ga0081539_10000696 Ga0081539_1000069670 309
195 3300006237 Ga0097621_100013866 Ga0097621_1000138663 309
196 3300006237 Ga0097621_100506797 Ga0097621_1005067971 309
197 3300006358 Ga0068871_100049270 Ga0068871_1000492705 309
198 3300006931 Ga0097620_100000112 Ga0097620_10000011243 309
199 3300006931 Ga0097620_100188881 Ga0097620_1001888812 309
200 3300006931 Ga0097620_100408002 Ga0097620_1004080022 309
201 3300009098 Ga0105245_10065301 Ga0105245_100653012 309
202 3300009101 Ga0105247_10008670 Ga0105247_100086702 309
203 3300009148 Ga0105243_10044799 Ga0105243_100447994 309
204 3300009174 Ga0105241_10000789 Ga0105241_1000078914 309
205 3300009545 Ga0105237_10000316 Ga0105237_1000031610 309
206 3300009545 Ga0105237_10007107 Ga0105237_100071074 309
207 3300009545 Ga0105237_10015582 Ga0105237_100155825 309
208 3300009553 Ga0105249_10005603 Ga0105249_100056038 309
209 3300009553 Ga0105249_10076748 Ga0105249_100767484 309
210 3300009553 Ga0105249_10222172 Ga0105249_102221722 309
211 3300010375 Ga0105239_10000012 Ga0105239_10000012130 309
212 3300010375 Ga0105239_10009807 Ga0105239_100098074 309
213 3300010375 Ga0105239_10184403 Ga0105239_101844032 309
214 3300013104 Ga0157370_10267326 Ga0157370_102673261 309
215 3300013296 Ga0157374_10107133 Ga0157374_101071332 309
216 3300013297 Ga0157378_10006346 Ga0157378_100063469 309
217 3300013297 Ga0157378_10200539 Ga0157378_102005392 309
218 3300013306 Ga0163162_10004252 Ga0163162_100042526 309
219 3300013308 Ga0157375_10017395 Ga0157375_100173955 309
220 3300013308 Ga0157375_10290153 Ga0157375_102901532 309
221 3300014325 Ga0163163_10499661 Ga0163163_104996612 309
222 3300014968 Ga0157379_10194992 Ga0157379_101949922 309
223 3300014969 Ga0157376_10002778 Ga0157376_100027786 309
224 3300025903 Ga0207680_10000035 Ga0207680_1000003525 309
225 3300025911 Ga0207654_10003031 Ga0207654_100030315 309
226 3300025914 Ga0207671_10001862 Ga0207671_1000186212 309
227 3300025921 Ga0207652_10093286 Ga0207652_100932862 309
228 3300025923 Ga0207681_10204466 Ga0207681_102044662 309
229 3300025925 Ga0207650_10051265 Ga0207650_100512652 309
230 3300025926 Ga0207659_10044660 Ga0207659_100446602 309
231 3300025931 Ga0207644_10034412 Ga0207644_100344124 309
232 3300025940 Ga0207691_10073006 Ga0207691_100730062 309
233 3300025942 Ga0207689_10001648 Ga0207689_100016484 309
234 3300025942 Ga0207689_10120452 Ga0207689_101204522 309
235 3300025960 Ga0207651_10058851 Ga0207651_100588512 309
236 3300025961 Ga0207712_10019270 Ga0207712_100192701 309
237 3300025961 Ga0207712_10137635 Ga0207712_101376351 309
238 3300025961 Ga0207712_10274988 Ga0207712_102749882 309
239 3300025972 Ga0207668_10107898 Ga0207668_101078982 309
240 3300026023 Ga0207677_10205745 Ga0207677_102057452 309
241 3300026035 Ga0207703_10038026 Ga0207703_100380265 309
242 3300026089 Ga0207648_10122798 Ga0207648_101227982 309
243 3300026089 Ga0207648_10173638 Ga0207648_101736383 309
244 3300026095 Ga0207676_10160464 Ga0207676_101604642 309
245 3300026116 Ga0207674_10081584 Ga0207674_100815842 309
246 3300028381 Ga0268264_10021889 Ga0268264_100218894 309
247 3300028794 Ga0307515_10000001 Ga0307515_100000011774 309
248 3300028794 Ga0307515_10000493 Ga0307515_1000049350 309
249 3300028794 Ga0307515_10077470 Ga0307515_100774702 309
250 3300028794 Ga0307515_10229348 Ga0307515_102293482 309
251 3300028794 Ga0307515_10324168 Ga0307515_103241681 309
252 3300031507 Ga0307509_10024602 Ga0307509_100246024 309
253 3300032004 Ga0307414_10002034 Ga0307414_100020348 309
254 3300032004 Ga0307414_10110950 Ga0307414_101109502 309
255 3300037418 Ga0395900_0257029 Ga0395900_0257029_88_1026 309
256 3300042876 Ga0451577_0001672 Ga0451577_0001672_7820_8761 309
257 3300044712 Ga0453684_0000721 Ga0453684_0000721_74759_75700 309
258 3300045051 Ga0451576_0119976 Ga0451576_0119976_1778_2719 309
259 3300046471 Ga0495650_0000023 Ga0495650_0000023_276642_277595 309
260 3300046506 Ga0495583_0027285 Ga0495583_0027285_1009_1962 309
261 3300046512 Ga0495610_0002537 Ga0495610_0002537_2026_2979 309
262 3300046513 Ga0495616_0014057 Ga0495616_0014057_2574_3530 309
263 3300046517 Ga0495630_0349779 Ga0495630_0349779_183_1121 309
264 3300046524 Ga0495648_0045567 Ga0495648_0045567_292_1245 309
265 3300046538 Ga0495609_0010682 Ga0495609_0010682_1698_2651 309
266 3300046660 Ga0495625_0001061 Ga0495625_0001061_31955_32911 309
267 3300046665 Ga0495661_0003335 Ga0495661_0003335_8476_9429 309
268 3300046665 Ga0495661_0048217 Ga0495661_0048217_1621_2574 309
269 3300047443 Ga0495687_001020 Ga0495687_001020_5635_6588 309
270 3300047443 Ga0495687_068543 Ga0495687_068543_301_1257 309
271 3300047469 Ga0495673_0038359 Ga0495673_0038359_860_1813 309
272 3300053098 Ga0500650_0112605 Ga0500650_0112605_250_1188 309
273 3300053133 Ga0500655_008874 Ga0500655_008874_557_1495 309
274 3300053730 Ga0500645_032848 Ga0500645_032848_151_1092 309
275 3300005289 Ga0065704_10113937 Ga0065704_101139372 310
276 3300005290 Ga0065712_10208330 Ga0065712_102083301 310
277 3300005328 Ga0070676_10016892 Ga0070676_100168923 310
278 3300005329 Ga0070683_100026743 Ga0070683_1000267431 310
279 3300005330 Ga0070690_100069209 Ga0070690_1000692092 310
280 3300005331 Ga0070670_100041313 Ga0070670_1000413134 310
281 3300005334 Ga0068869_100052661 Ga0068869_1000526612 310
282 3300005334 Ga0068869_100107086 Ga0068869_1001070862 310
283 3300005335 Ga0070666_10008027 Ga0070666_100080273 310
284 3300005337 Ga0070682_100081222 Ga0070682_1000812222 310
285 3300005338 Ga0068868_100028013 Ga0068868_1000280133 310
286 3300005340 Ga0070689_100130123 Ga0070689_1001301232 310
287 3300005344 Ga0070661_100158993 Ga0070661_1001589932 310
288 3300005347 Ga0070668_100056501 Ga0070668_1000565013 310
289 3300005353 Ga0070669_100036766 Ga0070669_1000367662 310
290 3300005354 Ga0070675_100018111 Ga0070675_1000181117 310
291 3300005356 Ga0070674_100359602 Ga0070674_1003596021 310
292 3300005364 Ga0070673_100437818 Ga0070673_1004378182 310
293 3300005365 Ga0070688_100092013 Ga0070688_1000920132 310
294 3300005365 Ga0070688_100111044 Ga0070688_1001110442 310
295 3300005367 Ga0070667_100062281 Ga0070667_1000622813 310
296 3300005367 Ga0070667_100190494 Ga0070667_1001904942 310
297 3300005436 Ga0070713_100373412 Ga0070713_1003734122 310
298 3300005456 Ga0070678_100089933 Ga0070678_1000899331 310
299 3300005459 Ga0068867_100005513 Ga0068867_1000055132 310
300 3300005471 Ga0070698_100001104 Ga0070698_1000011047 310
301 3300005471 Ga0070698_100005455 Ga0070698_1000054557 310
302 3300005530 Ga0070679_100184536 Ga0070679_1001845362 310
303 3300005539 Ga0068853_100127766 Ga0068853_1001277662 310
304 3300005543 Ga0070672_100022568 Ga0070672_1000225682 310
305 3300005543 Ga0070672_100137701 Ga0070672_1001377011 310
306 3300005543 Ga0070672_100234686 Ga0070672_1002346862 310
307 3300005548 Ga0070665_100447422 Ga0070665_1004474222 310
308 3300005564 Ga0070664_100035847 Ga0070664_1000358472 310
309 3300005564 Ga0070664_100473570 Ga0070664_1004735702 310
310 3300005616 Ga0068852_100574397 Ga0068852_1005743972 310
311 3300005617 Ga0068859_100003332 Ga0068859_1000033326 310
312 3300005617 Ga0068859_100053843 Ga0068859_1000538432 310
313 3300005617 Ga0068859_100117085 Ga0068859_1001170852 310
314 3300005617 Ga0068859_100211180 Ga0068859_1002111802 310
315 3300005618 Ga0068864_100269368 Ga0068864_1002693682 310
316 3300005618 Ga0068864_100326104 Ga0068864_1003261042 310
317 3300005618 Ga0068864_100366916 Ga0068864_1003669162 310
318 3300005618 Ga0068864_100647618 Ga0068864_1006476181 310
319 3300005718 Ga0068866_10011873 Ga0068866_100118733 310
320 3300005719 Ga0068861_100172263 Ga0068861_1001722632 310
321 3300005834 Ga0068851_10144876 Ga0068851_101448762 310
322 3300005840 Ga0068870_10054764 Ga0068870_100547642 310
323 3300005841 Ga0068863_100000476 Ga0068863_10000047621 310
324 3300005841 Ga0068863_100308975 Ga0068863_1003089752 310
325 3300005841 Ga0068863_100414112 Ga0068863_1004141122 310
326 3300005843 Ga0068860_100027488 Ga0068860_1000274882 310
327 3300005843 Ga0068860_100031078 Ga0068860_1000310783 310
328 3300005843 Ga0068860_100124977 Ga0068860_1001249771 310
329 3300006195 Ga0075366_10001999 Ga0075366_100019996 310
330 3300006237 Ga0097621_100180952 Ga0097621_1001809522 310
331 3300006237 Ga0097621_100326199 Ga0097621_1003261991 310
332 3300006358 Ga0068871_100015239 Ga0068871_1000152393 310
333 3300006358 Ga0068871_100504142 Ga0068871_1005041421 310
334 3300006844 Ga0075428_100023094 Ga0075428_1000230944 310
335 3300006880 Ga0075429_100018759 Ga0075429_1000187594 310
336 3300006881 Ga0068865_100051554 Ga0068865_1000515543 310
337 3300006881 Ga0068865_100129557 Ga0068865_1001295573 310
338 3300006931 Ga0097620_100003332 Ga0097620_1000033328 310
339 3300006931 Ga0097620_100053844 Ga0097620_1000538442 310
340 3300006931 Ga0097620_100117076 Ga0097620_1001170762 310
341 3300006931 Ga0097620_100211189 Ga0097620_1002111892 310
342 3300009093 Ga0105240_10258780 Ga0105240_102587802 310
343 3300009098 Ga0105245_10130853 Ga0105245_101308532 310
344 3300009101 Ga0105247_10001001 Ga0105247_100010012 310
345 3300009174 Ga0105241_10147647 Ga0105241_101476472 310
346 3300009176 Ga0105242_10357634 Ga0105242_103576341 310
347 3300009553 Ga0105249_10049682 Ga0105249_100496822 310
348 3300009553 Ga0105249_10295896 Ga0105249_102958962 310
349 3300011119 Ga0105246_10051177 Ga0105246_100511772 310
350 3300013104 Ga0157370_10298575 Ga0157370_102985752 310
351 3300013105 Ga0157369_10248061 Ga0157369_102480612 310
352 3300013297 Ga0157378_10014971 Ga0157378_100149714 310
353 3300013297 Ga0157378_10418182 Ga0157378_104181821 310
354 3300013306 Ga0163162_10004980 Ga0163162_100049801 310
355 3300013306 Ga0163162_10394079 Ga0163162_103940792 310
356 3300013307 Ga0157372_10026322 Ga0157372_100263223 310
357 3300013307 Ga0157372_10106252 Ga0157372_101062522 310
358 3300013307 Ga0157372_10226937 Ga0157372_102269372 310
359 3300013307 Ga0157372_10314040 Ga0157372_103140401 310
360 3300013308 Ga0157375_10508081 Ga0157375_105080812 310
361 3300013308 Ga0157375_10522218 Ga0157375_105222182 310
362 3300014325 Ga0163163_10027242 Ga0163163_100272423 310
363 3300014325 Ga0163163_10100291 Ga0163163_101002913 310
364 3300014326 Ga0157380_10054181 Ga0157380_100541813 310
365 3300014745 Ga0157377_10068455 Ga0157377_100684552 310
366 3300014745 Ga0157377_10154731 Ga0157377_101547312 310
367 3300017792 Ga0163161_10097717 Ga0163161_100977172 310
368 3300025315 Ga0207697_10028728 Ga0207697_100287282 310
369 3300025893 Ga0207682_10049610 Ga0207682_100496102 310
370 3300025901 Ga0207688_10094927 Ga0207688_100949272 310
371 3300025907 Ga0207645_10002051 Ga0207645_100020515 310
372 3300025907 Ga0207645_10139119 Ga0207645_101391192 310
373 3300025908 Ga0207643_10007403 Ga0207643_100074034 310
374 3300025918 Ga0207662_10078420 Ga0207662_100784201 310
375 3300025923 Ga0207681_10230795 Ga0207681_102307952 310
376 3300025923 Ga0207681_10310752 Ga0207681_103107521 310
377 3300025925 Ga0207650_10008851 Ga0207650_100088515 310
378 3300025926 Ga0207659_10011068 Ga0207659_100110685 310
379 3300025926 Ga0207659_10042019 Ga0207659_100420193 310
380 3300025933 Ga0207706_10033823 Ga0207706_100338234 310
381 3300025934 Ga0207686_10021158 Ga0207686_100211582 310
382 3300025936 Ga0207670_10002843 Ga0207670_1000284310 310
383 3300025936 Ga0207670_10105669 Ga0207670_101056691 310
384 3300025938 Ga0207704_10103240 Ga0207704_101032403 310
385 3300025938 Ga0207704_10326768 Ga0207704_103267681 310
386 3300025940 Ga0207691_10006112 Ga0207691_100061125 310
387 3300025940 Ga0207691_10021148 Ga0207691_100211486 310
388 3300025940 Ga0207691_10030613 Ga0207691_100306134 310
389 3300025942 Ga0207689_10003645 Ga0207689_100036457 310
390 3300025942 Ga0207689_10164404 Ga0207689_101644041 310
391 3300025942 Ga0207689_10216834 Ga0207689_102168341 310
392 3300025944 Ga0207661_10019647 Ga0207661_100196471 310
393 3300025944 Ga0207661_10282872 Ga0207661_102828721 310
394 3300025945 Ga0207679_10168273 Ga0207679_101682732 310
395 3300025961 Ga0207712_10008927 Ga0207712_100089275 310
396 3300025986 Ga0207658_10043583 Ga0207658_100435833 310
397 3300025986 Ga0207658_10453257 Ga0207658_104532571 310
398 3300026023 Ga0207677_10294379 Ga0207677_102943791 310
399 3300026041 Ga0207639_10137745 Ga0207639_101377452 310
400 3300026041 Ga0207639_10462311 Ga0207639_104623111 310
401 3300026088 Ga0207641_10000013 Ga0207641_10000013195 310
402 3300026088 Ga0207641_10147089 Ga0207641_101470891 310
403 3300026089 Ga0207648_10002853 Ga0207648_100028538 310
404 3300026089 Ga0207648_10032643 Ga0207648_100326433 310
405 3300026089 Ga0207648_10070605 Ga0207648_100706053 310
406 3300026095 Ga0207676_10017270 Ga0207676_100172705 310
407 3300026095 Ga0207676_10281362 Ga0207676_102813622 310
408 3300026116 Ga0207674_10052177 Ga0207674_100521773 310
409 3300026118 Ga0207675_100032835 Ga0207675_1000328353 310
410 3300026121 Ga0207683_10002413 Ga0207683_100024136 310
411 3300026121 Ga0207683_10107900 Ga0207683_101079002 310
412 3300026121 Ga0207683_10375584 Ga0207683_103755841 310
413 3300026142 Ga0207698_10075623 Ga0207698_100756232 310
414 3300028379 Ga0268266_10161132 Ga0268266_101611323 310
415 3300028380 Ga0268265_10661785 Ga0268265_106617851 310
416 3300028381 Ga0268264_10025702 Ga0268264_100257023 310
417 3300028381 Ga0268264_10141404 Ga0268264_101414042 310
418 3300028381 Ga0268264_10250297 Ga0268264_102502972 310
419 3300032126 Ga0307415_100032847 Ga0307415_1000328472 310
420 3300037418 Ga0395900_0272471 Ga0395900_0272471_538_1494 310
421 3300042003 Ga0439443_020647 Ga0439443_020647_28_1011 310
422 3300046499 Ga0495594_0023032 Ga0495594_0023032_133_1095 310
423 3300046616 Ga0495668_0001178 Ga0495668_0001178_16461_17405 310
424 3300046660 Ga0495625_0034208 Ga0495625_0034208_29_973 310
425 3300047472 Ga0495686_0009118 Ga0495686_0009118_2569_3522 310
426 3300048927 Ga0496124_0106380 Ga0496124_0106380_316_1260 310
427 3300049579 Ga0501043_0169602 Ga0501043_0169602_687_1643 310
428 3300049661 Ga0501217_058639 Ga0501217_058639_60_1004 310
429 3300049822 Ga0501035_0200676 Ga0501035_0200676_58_1014 310
430 3300050508 nmdc:mga09592_6028_c1 nmdc:mga09592_6028_c1_6047_7114 310
431 3300053153 Ga0500616_0023912 Ga0500616_0023912_1823_2758 310
432 3300005290 Ga0065712_10019398 Ga0065712_100193981 311
433 3300005365 Ga0070688_100114381 Ga0070688_1001143811 311
434 3300005457 Ga0070662_100345941 Ga0070662_1003459411 311
435 3300014326 Ga0157380_10144973 Ga0157380_101449732 311
436 3300025913 Ga0207695_10000043 Ga0207695_10000043269 311
437 3300025923 Ga0207681_10028940 Ga0207681_100289402 311
438 3300026075 Ga0207708_10132976 Ga0207708_101329762 311
439 iso_pu_bacteria 8003151029 8003157105 311
440 3300003316 rootH1_10002571 rootH1_100025715 312
441 3300003320 rootH2_10126160 rootH2_101261602 312
442 3300003322 rootL2_10016899 rootL2_100168993 312
443 3300003322 rootL2_10201290 rootL2_102012901 312
444 3300003322 rootL2_10278457 rootL2_102784573 312
445 3300003323 rootH1_10006645 rootH1_1000664571 312
446 3300003323 rootH1_10165904 rootH1_101659042 312
447 3300003323 rootH1_10351761 rootH1_103517612 312
448 3300005614 Ga0068856_100006063 Ga0068856_1000060637 312
449 3300010375 Ga0105239_10027035 Ga0105239_100270352 312
450 3300025242 Ga0209258_108861 Ga0209258_1088611 312
451 3300031456 Ga0307513_10185057 Ga0307513_101850572 312
452 3300031456 Ga0307513_10256823 Ga0307513_102568232 312
453 3300031730 Ga0307516_10202973 Ga0307516_102029732 312
454 3300032004 Ga0307414_10284209 Ga0307414_102842091 312
455 3300042014 Ga0439457_005833 Ga0439457_005833_210_1148 312
456 3300042015 Ga0439462_0038759 Ga0439462_0038759_282_1220 312
457 3300044658 Ga0466972_0000066 Ga0466972_0000066_59854_60792 312
458 3300044842 Ga0466957_0000150 Ga0466957_0000150_13695_14633 312
459 3300049581 Ga0501047_0050589 Ga0501047_0050589_1606_2544 312
460 3300049705 Ga0501225_0005390 Ga0501225_0005390_1347_2285 312
461 3300049823 Ga0501044_0009291 Ga0501044_0009291_5532_6470 312
462 3300050493 nmdc:mga0k408_91557_c1 nmdc:mga0k408_91557_c1_613_1551 312
463 3300053092 Ga0500583_0143882 Ga0500583_0143882_22_960 312
464 3300053136 Ga0500559_0027994 Ga0500559_0027994_472_1419 312
465 3300053156 Ga0500622_0006530 Ga0500622_0006530_389_1327 312
466 iso_pu_bacteria 2842903701 2842903817 312
467 3300006844 Ga0075428_100003121 Ga0075428_1000031218 313
468 3300006844 Ga0075428_100007566 Ga0075428_1000075662 313
469 3300006847 Ga0075431_100012508 Ga0075431_1000125087 313
470 3300006880 Ga0075429_100184814 Ga0075429_1001848141 313
471 3300009094 Ga0111539_10003923 Ga0111539_100039233 313
472 3300009094 Ga0111539_10343652 Ga0111539_103436522 313
473 3300025298 Ga0209050_1004932 Ga0209050_10049322 313
474 3300042876 Ga0451577_0040368 Ga0451577_0040368_2633_3577 313
475 3300044712 Ga0453684_0013285 Ga0453684_0013285_1895_2839 313
476 3300045051 Ga0451576_0069421 Ga0451576_0069421_2410_3360 313
477 3300046460 Ga0495638_0000036 Ga0495638_0000036_85128_86072 313
478 3300046511 Ga0495608_0177220 Ga0495608_0177220_361_1329 313
479 3300046663 Ga0495635_0302457 Ga0495635_0302457_83_1051 313
480 3300046681 Ga0495647_0065363 Ga0495647_0065363_426_1394 313
481 3300046809 Ga0495600_0065627 Ga0495600_0065627_537_1505 313
482 3300047322 Ga0495680_0120150 Ga0495680_0120150_817_1785 313
483 3300050509 nmdc:mga0qj67_216932_c1 nmdc:mga0qj67_216932_c1_204_1154 313
484 3300050509 nmdc:mga0qj67_236671_c1 nmdc:mga0qj67_236671_c1_488_1441 313
485 3300050510 nmdc:mga06r32_6788_c1 nmdc:mga06r32_6788_c1_7437_8390 313
486 3300053077 Ga0495601_0029684 Ga0495601_0029684_1114_2082 313
487 3300053084 Ga0495595_0024675 Ga0495595_0024675_702_1670 313
488 3300053108 Ga0500562_003715 Ga0500562_003715_1558_2502 313
489 3300053156 Ga0500622_0000006 Ga0500622_0000006_223845_224789 313
490 3300053156 Ga0500622_0000061 Ga0500622_0000061_88450_89394 313
491 3300005290 Ga0065712_10002491 Ga0065712_100024914 314
492 3300005290 Ga0065712_10002820 Ga0065712_100028203 314
493 3300005290 Ga0065712_10137784 Ga0065712_101377841 314
494 3300005293 Ga0065715_10000581 Ga0065715_1000058111 314
495 3300005295 Ga0065707_10280051 Ga0065707_102800511 314
496 3300005328 Ga0070676_10017898 Ga0070676_100178984 314
497 3300005330 Ga0070690_100172599 Ga0070690_1001725992 314
498 3300005331 Ga0070670_100230303 Ga0070670_1002303032 314
499 3300005353 Ga0070669_100067361 Ga0070669_1000673612 314
500 3300005354 Ga0070675_100056265 Ga0070675_1000562652 314
501 3300005364 Ga0070673_100048839 Ga0070673_1000488392 314
502 3300005365 Ga0070688_100003773 Ga0070688_1000037736 314
503 3300005365 Ga0070688_100009299 Ga0070688_1000092992 314
504 3300005466 Ga0070685_10017272 Ga0070685_100172723 314
505 3300005544 Ga0070686_100028522 Ga0070686_1000285222 314
506 3300005548 Ga0070665_100024663 Ga0070665_1000246632 314
507 3300005616 Ga0068852_100397950 Ga0068852_1003979502 314
508 3300005617 Ga0068859_100095934 Ga0068859_1000959343 314
509 3300005719 Ga0068861_100015533 Ga0068861_1000155332 314
510 3300005840 Ga0068870_10027373 Ga0068870_100273732 314
511 3300005841 Ga0068863_100146065 Ga0068863_1001460653 314
512 3300005844 Ga0068862_100009068 Ga0068862_1000090682 314
513 3300006237 Ga0097621_100052122 Ga0097621_1000521223 314
514 3300006358 Ga0068871_100057137 Ga0068871_1000571372 314
515 3300006881 Ga0068865_100189753 Ga0068865_1001897532 314
516 3300006931 Ga0097620_100095935 Ga0097620_1000959353 314
517 3300009094 Ga0111539_10080365 Ga0111539_100803653 314
518 3300009098 Ga0105245_10115016 Ga0105245_101150162 314
519 3300009177 Ga0105248_10033347 Ga0105248_100333473 314
520 3300009553 Ga0105249_10038533 Ga0105249_100385333 314
521 3300013296 Ga0157374_10045096 Ga0157374_100450962 314
522 3300013306 Ga0163162_10086250 Ga0163162_100862502 314
523 3300013306 Ga0163162_10113575 Ga0163162_101135753 314
524 3300013308 Ga0157375_10064060 Ga0157375_100640603 314
525 3300013308 Ga0157375_10122087 Ga0157375_101220872 314
526 3300013308 Ga0157375_10228226 Ga0157375_102282262 314
527 3300014326 Ga0157380_10025100 Ga0157380_100251003 314
528 3300014745 Ga0157377_10265661 Ga0157377_102656611 314
529 3300014969 Ga0157376_10122142 Ga0157376_101221422 314
530 3300017792 Ga0163161_10015684 Ga0163161_100156843 314
531 3300025304 Ga0209257_1000005 Ga0209257_1000005652 314
532 3300025315 Ga0207697_10018086 Ga0207697_100180862 314
533 3300025908 Ga0207643_10025522 Ga0207643_100255222 314
534 3300025923 Ga0207681_10003807 Ga0207681_100038076 314
535 3300025925 Ga0207650_10028254 Ga0207650_100282542 314
536 3300025926 Ga0207659_10081136 Ga0207659_100811362 314
537 3300025926 Ga0207659_10122011 Ga0207659_101220112 314
538 3300025937 Ga0207669_10149947 Ga0207669_101499472 314
539 3300025938 Ga0207704_10078754 Ga0207704_100787542 314
540 3300025941 Ga0207711_10084514 Ga0207711_100845143 314
541 3300025960 Ga0207651_10012554 Ga0207651_100125542 314
542 3300025961 Ga0207712_10060938 Ga0207712_100609383 314
543 3300025961 Ga0207712_10164151 Ga0207712_101641511 314
544 3300026089 Ga0207648_10100242 Ga0207648_101002422 314
545 3300026089 Ga0207648_10223267 Ga0207648_102232672 314
546 3300026116 Ga0207674_10049557 Ga0207674_100495574 314
547 3300026118 Ga0207675_100000148 Ga0207675_10000014821 314
548 3300027907 Ga0207428_10080679 Ga0207428_100806792 314
549 3300028379 Ga0268266_10058744 Ga0268266_100587443 314
550 3300028380 Ga0268265_10025386 Ga0268265_100253863 314
551 3300028380 Ga0268265_10191859 Ga0268265_101918592 314
552 3300042135 Ga0450899_004392 Ga0450899_004392_102_1058 314
553 3300042435 Ga0439434_0044304 Ga0439434_0044304_153_1109 314
554 3300046533 Ga0495640_0151882 Ga0495640_0151882_484_1455 314
555 3300048904 Ga0496101_0414250 Ga0496101_0414250_72_1043 314
556 3300048908 Ga0496105_0013838 Ga0496105_0013838_4162_5145 314
557 3300048912 Ga0496109_0028710 Ga0496109_0028710_967_1938 314
558 3300048913 Ga0496110_0020933 Ga0496110_0020933_574_1545 314
559 3300048915 Ga0496112_0006341 Ga0496112_0006341_1265_2236 314
560 3300048917 Ga0496114_0019940 Ga0496114_0019940_2977_3960 314
561 3300048918 Ga0496115_0072931 Ga0496115_0072931_957_1940 314
562 3300050511 nmdc:mga08y16_25950_c1 nmdc:mga08y16_25950_c1_901_1857 314
563 3300001979 JGI24740J21852_10010686 JGI24740J21852_100106863 315
564 3300001989 JGI24739J22299_10000891 JGI24739J22299_100008912 315
565 3300002738 JGI25154J39366_1000073 JGI25154J39366_100007372 315
566 3300003215 JGI25153J46596_10002735 JGI25153J46596_100027357 315
567 3300003316 rootH1_10135168 rootH1_101351682 315
568 3300003316 rootH1_10137532 rootH1_101375321 315
569 3300003322 rootL2_10076611 rootL2_100766113 315
570 3300003323 rootH1_10004404 rootH1_100044047 315
571 3300003323 rootH1_10034661 rootH1_100346617 315
572 3300003354 JGI25160J50197_1001184 JGI25160J50197_10011848 315
573 3300003771 Ga0055526_1004984 Ga0055526_10049847 315
574 3300003771 Ga0055526_1018541 Ga0055526_10185412 315
575 3300003790 Ga0055528_1000072 Ga0055528_100007226 315
576 3300003791 Ga0055530_10001331 Ga0055530_100013317 315
577 3300005262 Ga0065165_1000038 Ga0065165_100003887 315
578 3300005335 Ga0070666_10070536 Ga0070666_100705362 315
579 3300005548 Ga0070665_100000006 Ga0070665_100000006401 315
580 3300006844 Ga0075428_100069853 Ga0075428_1000698532 315
581 3300009093 Ga0105240_10000283 Ga0105240_1000028355 315
582 3300009147 Ga0114129_10001007 Ga0114129_1000100721 315
583 3300009174 Ga0105241_10000542 Ga0105241_1000054214 315
584 3300009545 Ga0105237_10007832 Ga0105237_100078326 315
585 3300009551 Ga0105238_10003699 Ga0105238_1000369910 315
586 3300010375 Ga0105239_10108959 Ga0105239_101089593 315
587 3300013307 Ga0157372_10068004 Ga0157372_100680042 315
588 3300014326 Ga0157380_10002095 Ga0157380_100020957 315
589 3300014326 Ga0157380_10126512 Ga0157380_101265123 315
590 3300025246 Ga0209646_1000158 Ga0209646_100015811 315
591 3300025250 Ga0209026_1000372 Ga0209026_100037220 315
592 3300025273 Ga0209673_1000130 Ga0209673_100013048 315
593 3300025295 Ga0209564_1001031 Ga0209564_10010316 315
594 3300025295 Ga0209564_1001446 Ga0209564_100144621 315
595 3300025297 Ga0209758_1001017 Ga0209758_10010178 315
596 3300025297 Ga0209758_1002050 Ga0209758_10020504 315
597 3300025297 Ga0209758_1018652 Ga0209758_10186523 315
598 3300025298 Ga0209050_1000530 Ga0209050_100053032 315
599 3300025302 Ga0207426_1000175 Ga0207426_100017586 315
600 3300025302 Ga0207426_1000452 Ga0207426_100045232 315
601 3300025302 Ga0207426_1000546 Ga0207426_100054623 315
602 3300025302 Ga0207426_1034809 Ga0207426_10348092 315
603 3300025304 Ga0209257_1001901 Ga0209257_100190110 315
604 3300025903 Ga0207680_10046771 Ga0207680_100467712 315
605 3300025911 Ga0207654_10058105 Ga0207654_100581051 315
606 3300025913 Ga0207695_10000684 Ga0207695_1000068420 315
607 3300025914 Ga0207671_10006909 Ga0207671_100069093 315
608 3300025924 Ga0207694_10079145 Ga0207694_100791452 315
609 3300028379 Ga0268266_10000010 Ga0268266_10000010481 315
610 3300030732 Ga0316176_1183533 Ga0316176_11835332 315
611 3300030742 Ga0316183_1018965 Ga0316183_10189657 315
612 3300030744 Ga0316181_1020976 Ga0316181_10209762 315
613 3300030745 Ga0316182_1078834 Ga0316182_10788342 315
614 3300031548 Ga0307408_100006842 Ga0307408_1000068422 315
615 3300031824 Ga0307413_10200580 Ga0307413_102005801 315
616 3300031995 Ga0307409_100263924 Ga0307409_1002639241 315
617 3300041486 Ga0451807_0193273 Ga0451807_0193273_278_1240 315
618 3300042876 Ga0451577_0323694 Ga0451577_0323694_381_1331 315
619 3300044658 Ga0466972_0045552 Ga0466972_0045552_266_1231 315
620 3300044712 Ga0453684_0165136 Ga0453684_0165136_920_1870 315
621 3300044842 Ga0466957_0001411 Ga0466957_0001411_4700_5740 315
622 3300044901 Ga0466960_0052919 Ga0466960_0052919_99_1064 315
623 3300046524 Ga0495648_0002890 Ga0495648_0002890_13663_14613 315
624 3300046648 Ga0495611_0054926 Ga0495611_0054926_32_982 315
625 3300046660 Ga0495625_0108059 Ga0495625_0108059_936_1883 315
626 3300047443 Ga0495687_000009 Ga0495687_000009_282590_283564 315
627 3300049652 Ga0501202_008246 Ga0501202_008246_385_1335 315
628 3300049670 Ga0501236_000320 Ga0501236_000320_1398_2348 315
629 3300049761 Ga0501264_000131 Ga0501264_000131_3680_4630 315
630 3300050496 nmdc:mga07m45_270534_c1 nmdc:mga07m45_270534_c1_19_972 315
631 3300050507 nmdc:mga05p37_829_c1 nmdc:mga05p37_829_c1_2025_2972 315
632 3300050511 nmdc:mga08y16_8721_c1 nmdc:mga08y16_8721_c1_3647_4597 315
633 3300053088 Ga0500644_0057918 Ga0500644_0057918_301_1284 315
634 3300053092 Ga0500583_0000023 Ga0500583_0000023_55721_56692 315
635 3300053092 Ga0500583_0001456 Ga0500583_0001456_3947_4897 315
636 3300053130 Ga0500642_0077571 Ga0500642_0077571_39_989 315
637 3300053156 Ga0500622_0001926 Ga0500622_0001926_11494_12444 315

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03737

RraA-like

Aldolase/RraA

94

278

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x15-assembly1.cif.gz_A-2 crystal structure of streptomyces coelicolor rraas2, an unusual member of the rnase es inhibitor rraa protein family 0.8798 48 265
5x15-assembly1.cif.gz_A-2 crystal structure of streptomyces coelicolor rraas2, an unusual member of the rnase es inhibitor rraa protein family 0.8715 48 265
3k4i-assembly1.cif.gz_B crystal structure of uncharacterized protein pspto_3204 from pseudomonas syringae pv. tomato str. dc3000 0.8328 49 278
5ir2-assembly1.cif.gz_A crystal structure of novel cellulases from microbes associated with the gut ecosystem 0.8241 25 260
3k4i-assembly1.cif.gz_B crystal structure of uncharacterized protein pspto_3204 from pseudomonas syringae pv. tomato str. dc3000 0.8176 49 278
ID Description Score Start End Superfamily
3k4iB01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.839 49 241 3.50.30.40
3k4iB01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8341 49 241 3.50.30.40
5ir2A00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8313 28 260 3.50.30.40
1j3lD00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8215 61 241 3.50.30.40
3nojA01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8213 66 240 3.50.30.40
ID Description Score Start End GO Terms
AF-A0A7V8KP58-F1-model_v4 deleted 0.9847 22 311
AF-A0A2E0KY70-F1-model_v4 Dimethylmenaquinone methyltransferase 0.9819 24 295 GO:0008168
GO:0032259
GO:0046872
AF-A0A4Q5Z5S6-F1-model_v4 RraA family protein 0.9816 24 278 GO:0046872
AF-A0A2N9M833-F1-model_v4 Demethylmenaquinone methyltransferase 0.9812 21 315 GO:0008168
GO:0032259
AF-A0A836QMV3-F1-model_v4 RraA family protein 0.9802 25 143

Feature Viewer

pLDDT pTM Quality
91.35 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map