F471447

General Info

Members Datasets Scaffolds Average Seq Length
637 384 614 176

Family's Representative Sequence

Representative Sequence 3300041460|Ga0451802_1450534|Ga0451802_1450534_60_674
Length 198
Sequence VPRRVGHGHDELAPAVAPRVGPAPVRTASFSPVNGVFGDVFNYEQTGLTLKFKPIVFPNQDVQVAMDKGAVTVMPRSETKRARAMWGLGRTQVANLMQGVTTGFERKLEINGVGYRAAVQGKNLQLALGYSHDVVFVIPEGIQIVTPKPTEIVINGIDRQKVGQVAAEIRAFRPPEPYKGKGVKYAGEFIFRKEGKKK

Samples

Sample ID Description Type Environment
1 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
2 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
3 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
4 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
5 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
6 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
7 2643221733 Bosea sp. Root381 Isolate Unclassified
8 2643221734 Bosea sp. Root670 Isolate Unclassified
9 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
10 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
11 2841760612 Bosea sp. Tri-49 Isolate Nodule
12 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
13 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
14 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
15 2844104063 Bosea sp. Tri-39 Isolate Nodule
16 2851246043 Bosea sp. Tri-54 Isolate Nodule
17 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
18 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
19 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
20 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
21 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
22 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
23 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
24 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
25 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
26 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
27 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
28 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
29 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
30 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
31 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
32 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
35 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
116 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
136 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
138 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
139 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
141 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
146 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
206 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
207 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
208 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
209 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
210 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
211 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
212 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
213 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
214 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
215 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
216 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
217 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
218 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
219 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
222 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
223 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
224 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
225 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
227 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
228 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
229 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
230 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
231 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
232 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
233 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
234 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
235 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
237 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
240 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
241 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
244 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
245 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
246 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
247 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
250 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
253 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
254 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
255 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
256 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
257 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
258 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
259 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
260 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
261 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
262 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
263 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
264 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
265 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
266 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
267 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
268 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
269 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
270 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
271 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
272 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
273 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
274 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
275 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
276 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
277 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
278 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
279 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
280 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
281 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
282 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
283 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
284 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
285 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
286 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
287 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
288 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
289 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
290 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
291 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
292 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
293 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
294 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
295 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
296 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
297 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
298 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
299 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
300 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
301 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
302 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
303 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
304 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
305 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
306 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
307 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
308 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
309 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
310 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
311 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
322 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
323 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
324 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
325 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
326 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
327 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
328 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
338 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
339 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
340 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
341 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
342 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
343 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
344 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
345 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
346 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
349 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
350 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
351 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
352 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
353 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
354 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
355 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
356 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
357 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
358 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
359 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
360 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
361 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
362 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
363 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
364 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
365 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
366 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
367 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
368 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
369 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
370 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
371 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
372 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
373 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
374 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
375 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
376 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
382 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
383 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
384 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.29
Metatranscriptomes 1.1
Isolates 3.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.28
Nodule 1.1
Rhizoplane 5.97
Rhizosphere 81.32
Stem 0
Stem Tuber 0
Unclassified 5.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1042367 3300001977 Bacteria 634
2 JGI24740J21852_10076260 3300001979 Bacteria 887
3 JGI24739J22299_10045863 3300001989 Bacteria 1433
4 JGI24743J22301_10003130 3300001991 Bacteria 2582
5 JGI24738J21930_10008307 3300002075 Bacteria 2364
6 JGI24738J21930_10020059 3300002075 Bacteria 1391
7 JGI24749J21850_1000052 3300002076 Bacteria 22270
8 JGI24744J21845_10000585 3300002077 Bacteria 6547
9 JGI24751J29686_10000379 3300002459 Bacteria 14986
10 JGI25151J46595_10000038 3300003187 Bacteria 180430
11 Ga0055542_1002777 3300003762 Bacteria 5290
12 Ga0055526_1012008 3300003771 Bacteria 3828
13 Ga0055524_1006440 3300003775 Bacteria 5089
14 Ga0055534_1028384 3300003784 Bacteria 877
15 Ga0070658_10010598 3300005327 Bacteria 7384
16 Ga0070658_10073690 3300005327 Bacteria 2800
17 Ga0070658_10097669 3300005327 Bacteria 2425
18 Ga0070658_10225012 3300005327 Bacteria 1587
19 Ga0070676_10092152 3300005328 Bacteria 1858
20 Ga0070683_100037799 3300005329 Bacteria 4420
21 Ga0070683_100429364 3300005329 Bacteria 1261
22 Ga0070670_100000093 3300005331 Bacteria 84800
23 Ga0070670_100030580 3300005331 Bacteria 4636
24 Ga0068869_100000029 3300005334 Bacteria 61111
25 Ga0070680_100005733 3300005336 Bacteria 9421
26 Ga0070680_100024886 3300005336 Bacteria 4784
27 Ga0070680_100063787 3300005336 Bacteria 3018
28 Ga0070680_100082947 3300005336 Bacteria 2647
29 Ga0070680_101147667 3300005336 Bacteria 672
30 Ga0068868_100003973 3300005338 Bacteria 10321
31 Ga0070660_100049574 3300005339 Bacteria 3228
32 Ga0070660_100126597 3300005339 Bacteria 2041
33 Ga0070660_100459877 3300005339 Bacteria 1056
34 Ga0070660_100968203 3300005339 Bacteria 718
35 Ga0070661_100069740 3300005344 Bacteria 2584
36 Ga0070668_100010274 3300005347 Bacteria 6948
37 Ga0070668_100205915 3300005347 Bacteria 1616
38 Ga0070669_100000115 3300005353 Bacteria 75928
39 Ga0070675_101754841 3300005354 Bacteria 573
40 Ga0070671_100135894 3300005355 Bacteria 2073
41 Ga0070671_100141969 3300005355 Bacteria 2026
42 Ga0070671_101094875 3300005355 Bacteria 700
43 Ga0070674_100056384 3300005356 Bacteria 2724
44 Ga0070673_100000019 3300005364 Bacteria 107024
45 Ga0070688_100098616 3300005365 Bacteria 1922
46 Ga0070659_100183076 3300005366 Bacteria 1720
47 Ga0070659_101162815 3300005366 Bacteria 681
48 Ga0070667_100000088 3300005367 Bacteria 113956
49 Ga0070667_100013671 3300005367 Bacteria 6708
50 Ga0070709_10048001 3300005434 Bacteria 2662
51 Ga0070714_100448914 3300005435 Bacteria 1225
52 Ga0070714_100511011 3300005435 Bacteria 1146
53 Ga0070713_100017903 3300005436 Bacteria 5375
54 Ga0070713_101125750 3300005436 Bacteria 759
55 Ga0070711_100044999 3300005439 Bacteria 2999
56 Ga0070711_100158971 3300005439 Bacteria 1711
57 Ga0070663_100016226 3300005455 Bacteria 4830
58 Ga0070678_100006601 3300005456 Bacteria 6820
59 Ga0070662_100202310 3300005457 Bacteria 1577
60 Ga0070662_100515479 3300005457 Bacteria 999
61 Ga0070681_10063895 3300005458 Bacteria 3653
62 Ga0070681_10128718 3300005458 Bacteria 2464
63 Ga0070681_10400379 3300005458 Bacteria 1284
64 Ga0070681_10485858 3300005458 Bacteria 1148
65 Ga0070681_10952663 3300005458 Bacteria 777
66 Ga0068867_100000014 3300005459 Bacteria 112097
67 Ga0068867_100772215 3300005459 Bacteria 854
68 Ga0070685_10681786 3300005466 Bacteria 748
69 Ga0070679_100068171 3300005530 Bacteria 3549
70 Ga0070679_100083578 3300005530 Bacteria 3181
71 Ga0070679_100200073 3300005530 Bacteria 1964
72 Ga0070679_100242821 3300005530 Bacteria 1758
73 Ga0070679_100366118 3300005530 Bacteria 1389
74 Ga0070679_100696567 3300005530 Bacteria 959
75 Ga0070679_101099268 3300005530 Bacteria 740
76 Ga0070684_100431540 3300005535 Bacteria 1217
77 Ga0070697_100005582 3300005536 Bacteria 9698
78 Ga0068853_100892512 3300005539 Bacteria 853
79 Ga0070672_101170263 3300005543 Bacteria 684
80 Ga0070695_100007388 3300005545 Bacteria 6517
81 Ga0070693_100171905 3300005547 Bacteria 1389
82 Ga0070693_100272386 3300005547 Bacteria 1130
83 Ga0070665_100255950 3300005548 Bacteria 1752
84 Ga0070704_100880415 3300005549 Bacteria 804
85 Ga0068855_100027910 3300005563 Bacteria 6751
86 Ga0068855_100447267 3300005563 Bacteria 1410
87 Ga0068855_100810457 3300005563 Bacteria 994
88 Ga0068855_100913885 3300005563 Bacteria 926
89 Ga0070664_100122298 3300005564 Bacteria 2280
90 Ga0068857_100066375 3300005577 Bacteria 3210
91 Ga0068857_100324060 3300005577 Bacteria 1423
92 Ga0068857_100885056 3300005577 Bacteria 856
93 Ga0068857_101070198 3300005577 Bacteria 778
94 Ga0068854_100449464 3300005578 Bacteria 1076
95 Ga0068856_100060779 3300005614 Bacteria 3732
96 Ga0068856_100484785 3300005614 Bacteria 1257
97 Ga0068852_100166080 3300005616 Bacteria 2065
98 Ga0068852_100247205 3300005616 Bacteria 1707
99 Ga0068852_100383315 3300005616 Bacteria 1379
100 Ga0068852_101768801 3300005616 Bacteria 640
101 Ga0068859_100009835 3300005617 Bacteria 9655
102 Ga0068859_100096701 3300005617 Bacteria 3005
103 Ga0068864_100000087 3300005618 Bacteria 98532
104 Ga0068864_100754039 3300005618 Bacteria 954
105 Ga0068861_100006640 3300005719 Bacteria 7896
106 Ga0068851_10070267 3300005834 Bacteria 1810
107 Ga0068863_100008669 3300005841 Bacteria 9938
108 Ga0068860_100000220 3300005843 Bacteria 89460
109 Ga0068860_101008131 3300005843 Bacteria 851
110 Ga0068862_100000466 3300005844 Bacteria 43651
111 Ga0068862_100122633 3300005844 Bacteria 2292
112 Ga0081455_10004023 3300005937 Bacteria 16663
113 Ga0081455_10020755 3300005937 Bacteria 6176
114 Ga0081455_10041960 3300005937 Bacteria 4019
115 Ga0081540_1006488 3300005983 Bacteria 8508
116 Ga0081540_1051990 3300005983 Bacteria 2021
117 Ga0081539_10057536 3300005985 Bacteria 2150
118 Ga0075365_10164955 3300006038 Bacteria 1545
119 Ga0075365_10448116 3300006038 Bacteria 911
120 Ga0075365_10596615 3300006038 Bacteria 781
121 Ga0070712_100040629 3300006175 Bacteria 3190
122 Ga0075369_10014440 3300006186 Bacteria 3154
123 Ga0075366_10011613 3300006195 Bacteria 4976
124 Ga0075366_10181683 3300006195 Bacteria 1278
125 Ga0075366_10794142 3300006195 Bacteria 589
126 Ga0097621_100377578 3300006237 Bacteria 1265
127 Ga0075370_10211943 3300006353 Bacteria 1144
128 Ga0068871_100041983 3300006358 Bacteria 3669
129 Ga0075431_100013939 3300006847 Bacteria 8119
130 Ga0075433_10327457 3300006852 Bacteria 1355
131 Ga0075434_100185510 3300006871 Bacteria 2101
132 Ga0068865_100030870 3300006881 Bacteria 3568
133 Ga0075436_100014756 3300006914 Bacteria 5354
134 Ga0097620_100009835 3300006931 Bacteria 9655
135 Ga0097620_100096701 3300006931 Bacteria 3005
136 Ga0075435_100026460 3300007076 Bacteria 4526
137 Ga0075435_100388871 3300007076 Bacteria 1199
138 Ga0099795_10001948 3300007788 Bacteria 4692
139 Ga0105240_10015848 3300009093 Bacteria 10226
140 Ga0105240_10038434 3300009093 Bacteria 6139
141 Ga0105240_10337173 3300009093 Bacteria 1714
142 Ga0111539_10163484 3300009094 Bacteria 2603
143 Ga0111539_10483254 3300009094 Bacteria 1442
144 Ga0105245_10005275 3300009098 Bacteria 11352
145 Ga0105247_10804080 3300009101 Bacteria 718
146 Ga0114129_10001848 3300009147 Bacteria 28835
147 Ga0114129_10227354 3300009147 Bacteria 2514
148 Ga0114129_11835813 3300009147 Bacteria 736
149 Ga0105243_10000076 3300009148 Bacteria 110445
150 Ga0105243_10245578 3300009148 Bacteria 1595
151 Ga0105243_10477166 3300009148 Bacteria 1176
152 Ga0105242_10009804 3300009176 Bacteria 7341
153 Ga0105248_10003987 3300009177 Bacteria 16323
154 Ga0105248_10008689 3300009177 Bacteria 11162
155 Ga0105237_10045964 3300009545 Bacteria 4393
156 Ga0105237_10268995 3300009545 Bacteria 1707
157 Ga0105237_10553704 3300009545 Bacteria 1157
158 Ga0105238_10084340 3300009551 Bacteria 3167
159 Ga0105238_10164963 3300009551 Bacteria 2190
160 Ga0105238_10226631 3300009551 Bacteria 1845
161 Ga0105238_10271223 3300009551 Bacteria 1677
162 Ga0105238_11105398 3300009551 Bacteria 815
163 Ga0105249_10020004 3300009553 Bacteria 5978
164 Ga0105249_10123325 3300009553 Bacteria 2465
165 Ga0105148_100340 3300009978 Bacteria 5674
166 Ga0099796_10009160 3300010159 Bacteria 2669
167 Ga0105239_10343307 3300010375 Bacteria 1685
168 Ga0105239_10557218 3300010375 Bacteria 1306
169 Ga0105239_11006974 3300010375 Bacteria 958
170 Ga0105246_10052677 3300011119 Bacteria 2798
171 Ga0157326_1000064 3300012513 Bacteria 10255
172 Ga0157373_10069320 3300013100 Bacteria 2493
173 Ga0157373_10147610 3300013100 Bacteria 1654
174 Ga0157373_10159167 3300013100 Bacteria 1589
175 Ga0157373_10737579 3300013100 Bacteria 723
176 Ga0157371_10042695 3300013102 Bacteria 3232
177 Ga0157371_10206362 3300013102 Bacteria 1409
178 Ga0157371_10659969 3300013102 Bacteria 781
179 Ga0157371_10886225 3300013102 Bacteria 676
180 Ga0157370_10011636 3300013104 Bacteria 9184
181 Ga0157370_10108530 3300013104 Bacteria 2595
182 Ga0157370_10494637 3300013104 Bacteria 1123
183 Ga0157370_10776460 3300013104 Bacteria 872
184 Ga0157370_11330686 3300013104 Bacteria 647
185 Ga0157369_10077891 3300013105 Bacteria 3553
186 Ga0157369_10129027 3300013105 Bacteria 2680
187 Ga0157369_10337199 3300013105 Bacteria 1566
188 Ga0157369_10444632 3300013105 Bacteria 1342
189 Ga0157374_10044615 3300013296 Bacteria 4098
190 Ga0157374_10094106 3300013296 Bacteria 2863
191 Ga0157378_10000504 3300013297 Bacteria 37070
192 Ga0163162_10504833 3300013306 Bacteria 1340
193 Ga0157372_10234957 3300013307 Bacteria 2126
194 Ga0157372_10519019 3300013307 Bacteria 1389
195 Ga0157372_11075511 3300013307 Bacteria 931
196 Ga0163163_10002310 3300014325 Bacteria 16099
197 Ga0163163_10024251 3300014325 Bacteria 5772
198 Ga0163163_10204491 3300014325 Bacteria 2023
199 Ga0157380_10000157 3300014326 Bacteria 39384
200 Ga0157380_10410045 3300014326 Bacteria 1288
201 Ga0157377_10145480 3300014745 Bacteria 1460
202 Ga0157379_10446478 3300014968 Bacteria 1193
203 Ga0157376_10000092 3300014969 Bacteria 68198
204 Ga0163161_10189654 3300017792 Bacteria 1580
205 Ga0213876_10013852 3300021384 Bacteria 4274
206 Ga0213875_10241366 3300021388 Bacteria 852
207 Ga0207427_104233 3300025231 Bacteria 2514
208 Ga0209437_109865 3300025233 Bacteria 1476
209 Ga0209026_1000352 3300025250 Bacteria 43432
210 Ga0209148_1004350 3300025254 Bacteria 3516
211 Ga0209233_1000003 3300025261 Bacteria 1607366
212 Ga0209233_1003903 3300025261 Bacteria 5177
213 Ga0209455_1002555 3300025272 Bacteria 6959
214 Ga0209673_1037691 3300025273 Bacteria 1417
215 Ga0209675_1002527 3300025291 Bacteria 9311
216 Ga0209676_1028639 3300025292 Bacteria 1730
217 Ga0209025_1000014 3300025294 Bacteria 865448
218 Ga0209025_1065919 3300025294 Bacteria 1319
219 Ga0209564_1002872 3300025295 Bacteria 12632
220 Ga0209256_1000108 3300025299 Bacteria 185884
221 Ga0207656_10023826 3300025321 Bacteria 2469
222 Ga0207688_10030543 3300025901 Bacteria 2972
223 Ga0207647_10389004 3300025904 Bacteria 787
224 Ga0207699_10302236 3300025906 Bacteria 1118
225 Ga0207645_10028915 3300025907 Bacteria 3575
226 Ga0207643_10207188 3300025908 Bacteria 1196
227 Ga0207705_10000243 3300025909 Bacteria 53479
228 Ga0207705_10002954 3300025909 Bacteria 12998
229 Ga0207705_10005544 3300025909 Bacteria 9436
230 Ga0207705_10040855 3300025909 Bacteria 3327
231 Ga0207705_10752239 3300025909 Bacteria 757
232 Ga0207654_10135541 3300025911 Bacteria 1563
233 Ga0207707_10009792 3300025912 Bacteria 8311
234 Ga0207707_10073118 3300025912 Bacteria 2989
235 Ga0207707_10261591 3300025912 Bacteria 1501
236 Ga0207707_10452187 3300025912 Bacteria 1099
237 Ga0207695_10012684 3300025913 Bacteria 10093
238 Ga0207695_10159517 3300025913 Bacteria 2188
239 Ga0207671_10068421 3300025914 Bacteria 2646
240 Ga0207671_10342326 3300025914 Bacteria 1185
241 Ga0207693_10004752 3300025915 Bacteria 11421
242 Ga0207693_10338978 3300025915 Bacteria 1177
243 Ga0207660_10033759 3300025917 Bacteria 3542
244 Ga0207660_10073946 3300025917 Bacteria 2486
245 Ga0207660_10109315 3300025917 Bacteria 2078
246 Ga0207660_10234972 3300025917 Bacteria 1442
247 Ga0207660_10238397 3300025917 Bacteria 1432
248 Ga0207660_10266788 3300025917 Bacteria 1355
249 Ga0207657_10039829 3300025919 Bacteria 4171
250 Ga0207657_10057078 3300025919 Bacteria 3366
251 Ga0207657_10098911 3300025919 Bacteria 2424
252 Ga0207657_10441080 3300025919 Bacteria 1022
253 Ga0207649_10670647 3300025920 Bacteria 802
254 Ga0207652_10022634 3300025921 Bacteria 5201
255 Ga0207652_10237592 3300025921 Bacteria 1642
256 Ga0207652_10259630 3300025921 Bacteria 1567
257 Ga0207652_10266174 3300025921 Bacteria 1546
258 Ga0207652_10414093 3300025921 Bacteria 1216
259 Ga0207681_10000005 3300025923 Bacteria 555724
260 Ga0207681_10138373 3300025923 Bacteria 1810
261 Ga0207694_10010694 3300025924 Bacteria 6927
262 Ga0207694_10161581 3300025924 Bacteria 1809
263 Ga0207694_10231602 3300025924 Bacteria 1509
264 Ga0207694_10258839 3300025924 Bacteria 1425
265 Ga0207650_10000004 3300025925 Bacteria 743372
266 Ga0207650_10014747 3300025925 Bacteria 5433
267 Ga0207659_10009064 3300025926 Bacteria 6208
268 Ga0207687_10079745 3300025927 Bacteria 2361
269 Ga0207700_10110657 3300025928 Bacteria 2209
270 Ga0207664_10006275 3300025929 Bacteria 8170
271 Ga0207664_10033079 3300025929 Bacteria 3969
272 Ga0207644_10082298 3300025931 Bacteria 2381
273 Ga0207644_10176989 3300025931 Bacteria 1669
274 Ga0207644_10370336 3300025931 Bacteria 1167
275 Ga0207644_10994302 3300025931 Bacteria 704
276 Ga0207690_10675799 3300025932 Bacteria 848
277 Ga0207706_10041508 3300025933 Bacteria 4079
278 Ga0207706_10543457 3300025933 Bacteria 1001
279 Ga0207686_10004287 3300025934 Bacteria 7648
280 Ga0207709_10000114 3300025935 Bacteria 124672
281 Ga0207709_10341562 3300025935 Bacteria 1127
282 Ga0207709_10360916 3300025935 Bacteria 1100
283 Ga0207669_10017734 3300025937 Bacteria 3660
284 Ga0207669_10278908 3300025937 Bacteria 1259
285 Ga0207704_10000008 3300025938 Bacteria 204682
286 Ga0207665_10140403 3300025939 Bacteria 1722
287 Ga0207691_10130675 3300025940 Bacteria 2219
288 Ga0207711_10001472 3300025941 Bacteria 21955
289 Ga0207711_10221727 3300025941 Bacteria 1730
290 Ga0207711_10492350 3300025941 Bacteria 1142
291 Ga0207689_10000608 3300025942 Bacteria 34222
292 Ga0207661_10038656 3300025944 Bacteria 3742
293 Ga0207679_10095607 3300025945 Bacteria 2310
294 Ga0207679_10098523 3300025945 Bacteria 2280
295 Ga0207667_10004001 3300025949 Bacteria 18104
296 Ga0207667_10033512 3300025949 Bacteria 5521
297 Ga0207651_10000008 3300025960 Bacteria 204538
298 Ga0207712_10077729 3300025961 Bacteria 2406
299 Ga0207712_10346030 3300025961 Bacteria 1234
300 Ga0207712_10868134 3300025961 Bacteria 796
301 Ga0207640_10026471 3300025981 Bacteria 3522
302 Ga0207640_10338594 3300025981 Bacteria 1204
303 Ga0207658_10000064 3300025986 Bacteria 117779
304 Ga0207658_10009141 3300025986 Bacteria 6722
305 Ga0207677_10000091 3300026023 Bacteria 74163
306 Ga0207703_10890785 3300026035 Bacteria 852
307 Ga0207639_10491719 3300026041 Bacteria 1120
308 Ga0207639_11053564 3300026041 Bacteria 762
309 Ga0207678_10045992 3300026067 Bacteria 3774
310 Ga0207702_10006302 3300026078 Bacteria 10251
311 Ga0207702_10247187 3300026078 Bacteria 1674
312 Ga0207702_10967111 3300026078 Bacteria 844
313 Ga0207641_10003244 3300026088 Bacteria 14521
314 Ga0207648_10000009 3300026089 Bacteria 204229
315 Ga0207676_10000006 3300026095 Bacteria 681936
316 Ga0207674_10066644 3300026116 Bacteria 3626
317 Ga0207674_10071868 3300026116 Bacteria 3476
318 Ga0207674_10373507 3300026116 Bacteria 1378
319 Ga0207674_10404168 3300026116 Bacteria 1320
320 Ga0207675_100001117 3300026118 Bacteria 26571
321 Ga0207683_10006500 3300026121 Bacteria 10001
322 Ga0207698_10230088 3300026142 Bacteria 1682
323 Ga0207698_10525453 3300026142 Bacteria 1156
324 Ga0207698_10833795 3300026142 Bacteria 926
325 Ga0209179_1109151 3300027512 Bacteria 617
326 Ga0268266_10400280 3300028379 Bacteria 1298
327 Ga0268266_10534549 3300028379 Bacteria 1122
328 Ga0268266_10624098 3300028379 Bacteria 1036
329 Ga0268265_10000001 3300028380 Bacteria 1230727
330 Ga0268265_10058458 3300028380 Bacteria 2944
331 Ga0268265_10941727 3300028380 Bacteria 850
332 Ga0268264_10000277 3300028381 Bacteria 86740
333 Ga0265337_1007309 3300028556 Bacteria 4141
334 Ga0265336_10052787 3300028666 Bacteria 1226
335 Ga0307515_10099360 3300028794 Bacteria 3534
336 Ga0265338_10169152 3300028800 Bacteria 1678
337 Ga0265338_10534408 3300028800 Bacteria 822
338 Ga0265332_10081675 3300031238 Bacteria 1371
339 Ga0265325_10003961 3300031241 Bacteria 9475
340 Ga0265325_10007856 3300031241 Bacteria 6350
341 Ga0265325_10075997 3300031241 Bacteria 1677
342 Ga0265340_10167086 3300031247 Bacteria 997
343 Ga0265339_10001408 3300031249 Bacteria 17842
344 Ga0265339_10052488 3300031249 Bacteria 2220
345 Ga0265331_10014930 3300031250 Bacteria 4119
346 Ga0265331_10235677 3300031250 Bacteria 822
347 Ga0265327_10072293 3300031251 Bacteria 1722
348 Ga0265316_10050124 3300031344 Bacteria 3285
349 Ga0265316_10091372 3300031344 Bacteria 2322
350 Ga0265313_10001884 3300031595 Bacteria 19075
351 Ga0265313_10009717 3300031595 Bacteria 6202
352 Ga0265313_10041399 3300031595 Bacteria 2270
353 Ga0265314_10235211 3300031711 Bacteria 1060
354 Ga0265342_10000677 3300031712 Bacteria 35579
355 Ga0265342_10085476 3300031712 Bacteria 1815
356 Ga0265342_10087093 3300031712 Bacteria 1795
357 Ga0307406_10090266 3300031901 Bacteria 2061
358 Ga0307409_100481191 3300031995 Bacteria 1205
359 Ga0307409_100533681 3300031995 Bacteria 1149
360 Ga0373926_0054062 3300035083 Bacteria 1454
361 Ga0373934_0008632 3300035086 Bacteria 3800
362 Ga0373944_0006361 3300035089 Bacteria 3134
363 Ga0373952_0069892 3300035092 Bacteria 876
364 Ga0373923_0028731 3300035111 Bacteria 2226
365 Ga0373941_0182888 3300035115 Bacteria 788
366 Ga0373953_0031007 3300035117 Bacteria 2077
367 Ga0373954_0082396 3300035118 Bacteria 1538
368 Ga0373954_0464403 3300035118 Bacteria 627
369 Ga0373956_0125127 3300035119 Bacteria 1202
370 Ga0373957_0034795 3300035120 Bacteria 1868
371 Ga0373957_0167166 3300035120 Bacteria 908
372 Ga0373943_0147879 3300035170 Bacteria 1271
373 Ga0373943_0204756 3300035170 Bacteria 1093
374 Ga0373946_0029660 3300035171 Bacteria 2179
375 Ga0373946_0126645 3300035171 Bacteria 1171
376 Ga0373946_0278477 3300035171 Bacteria 822
377 Ga0373955_0001179 3300035172 Bacteria 11123
378 Ga0373955_0754659 3300035172 Bacteria 598
379 Ga0373961_0288663 3300035241 Bacteria 604
380 Ga0373924_0029520 3300035410 Bacteria 2192
381 Ga0373931_0183942 3300035691 Bacteria 1239
382 Ga0373935_0117540 3300035692 Bacteria 1772
383 Ga0373935_0154285 3300035692 Bacteria 1561
384 Ga0373935_0197109 3300035692 Bacteria 1390
385 Ga0373935_0312809 3300035692 Bacteria 1113
386 Ga0373927_0041187 3300035695 Bacteria 2996
387 Ga0373927_0056189 3300035695 Bacteria 2544
388 Ga0373927_0106806 3300035695 Bacteria 1823
389 Ga0373933_0183204 3300035724 Bacteria 1336
390 Ga0373933_0390031 3300035724 Bacteria 907
391 Ga0373947_0058372 3300035725 Bacteria 2338
392 Ga0373947_0085267 3300035725 Bacteria 1961
393 Ga0373947_0188861 3300035725 Bacteria 1344
394 Ga0373937_0021580 3300036401 Bacteria 5778
395 Ga0373937_0040264 3300036401 Bacteria 4259
396 Ga0373925_0047403 3300037068 Bacteria 3198
397 Ga0373925_0502642 3300037068 Bacteria 995
398 Ga0373925_0630749 3300037068 Bacteria 883
399 Ga0373925_1267021 3300037068 Bacteria 605
400 Ga0395899_0000406 3300037312 Bacteria 50248
401 Ga0395899_0066694 3300037312 Bacteria 2642
402 Ga0395900_0021199 3300037418 Bacteria 6643
403 Ga0395900_0056306 3300037418 Bacteria 4047
404 Ga0395900_0506830 3300037418 Bacteria 1156
405 Ga0395898_0126504 3300037466 Bacteria 2448
406 Ga0395898_0137366 3300037466 Bacteria 2341
407 Ga0395898_0222452 3300037466 Bacteria 1800
408 Ga0395898_1034210 3300037466 Bacteria 756
409 Ga0395905_0985174 3300037471 Bacteria 746
410 Ga0436364_0163040 3300037853 Bacteria 974
411 Ga0436364_0471401 3300037853 Bacteria 1568
412 Ga0395901_0097542 3300038443 Bacteria 3081
413 Ga0395901_0177540 3300038443 Bacteria 2233
414 Ga0395901_0978377 3300038443 Bacteria 823
415 Ga0400490_23185 3300038726 Bacteria 1324
416 Ga0400486_03338 3300038742 Bacteria 1064
417 Ga0400486_26153 3300038742 Bacteria 1558
418 Ga0436365_0802220 3300039437 Bacteria 2105
419 Ga0436365_1609996 3300039437 Bacteria 6251
420 Ga0436360_0447412 3300039438 Bacteria 1080
421 Ga0436360_0537617 3300039438 Bacteria 7493
422 Ga0436361_0327700 3300039447 Bacteria 2324
423 Ga0436363_1571548 3300039450 Bacteria 7951
424 Ga0436363_1616367 3300039450 Bacteria 1341
425 Ga0436362_0662105 3300039453 Bacteria 1089
426 Ga0436362_0857492 3300039453 Bacteria 729
427 Ga0439466_0074454 3300041411 Bacteria 1077
428 Ga0451802_1450534 3300041460 Bacteria 714
429 Ga0451806_367681 3300041462 Bacteria 2560
430 Ga0451807_1991054 3300041486 Bacteria 1946
431 Ga0451853_0019999 3300041512 Bacteria 801
432 Ga0439432_096371 3300042006 Bacteria 887
433 Ga0439455_0006431 3300042012 Bacteria 2438
434 Ga0439458_0004227 3300042157 Bacteria 3315
435 Ga0439434_0017101 3300042435 Bacteria 2169
436 Ga0466969_0095238 3300044656 Bacteria 1407
437 Ga0466972_0022049 3300044658 Bacteria 3171
438 Ga0466965_0245619 3300044683 Bacteria 959
439 Ga0466966_0032002 3300044684 Bacteria 3411
440 Ga0466966_0175993 3300044684 Bacteria 1299
441 Ga0466961_0078638 3300044693 Bacteria 2089
442 Ga0466961_0116483 3300044693 Bacteria 1679
443 Ga0466963_0015793 3300044694 Bacteria 4685
444 Ga0466963_0021397 3300044694 Bacteria 4080
445 Ga0466964_0045974 3300044706 Bacteria 1778
446 Ga0466971_0204777 3300044719 Bacteria 932
447 Ga0466957_0059645 3300044842 Bacteria 2339
448 Ga0466957_0090325 3300044842 Bacteria 1918
449 Ga0466957_0133264 3300044842 Bacteria 1594
450 Ga0466957_0213535 3300044842 Bacteria 1271
451 Ga0466960_0025122 3300044901 Bacteria 2693
452 Ga0466959_0030393 3300045049 Bacteria 3999
453 Ga0466959_0123080 3300045049 Bacteria 1842
454 Ga0466959_0131651 3300045049 Bacteria 1772
455 Ga0466958_0159500 3300045836 Bacteria 1424
456 Ga0495603_0346918 3300046455 Bacteria 852
457 Ga0495629_0453662 3300046459 Bacteria 868
458 Ga0495651_0123417 3300046462 Bacteria 1900
459 Ga0495664_0221638 3300046477 Bacteria 1145
460 Ga0495594_0339772 3300046499 Bacteria 855
461 Ga0495596_0280689 3300046500 Bacteria 647
462 Ga0495610_0018183 3300046512 Bacteria 3978
463 Ga0495637_0020520 3300046520 Bacteria 3041
464 Ga0495652_0178964 3300046529 Bacteria 1630
465 Ga0495640_0284484 3300046533 Bacteria 1029
466 Ga0495587_0067952 3300046536 Bacteria 2077
467 Ga0495667_0062276 3300046559 Bacteria 2445
468 Ga0495667_0111752 3300046559 Bacteria 1765
469 Ga0495667_0494739 3300046559 Bacteria 766
470 Ga0495634_0076021 3300046642 Bacteria 2205
471 Ga0495611_0020624 3300046648 Bacteria 2838
472 Ga0495625_0237448 3300046660 Bacteria 1188
473 Ga0495635_0060092 3300046663 Bacteria 2613
474 Ga0495635_0404725 3300046663 Bacteria 906
475 Ga0495657_0061609 3300046675 Bacteria 2481
476 Ga0495657_0323554 3300046675 Bacteria 916
477 Ga0495658_0173008 3300046683 Bacteria 1337
478 Ga0495613_0539447 3300046689 Bacteria 782
479 Ga0495624_0523343 3300046690 Bacteria 709
480 Ga0495581_0062181 3300047315 Bacteria 2157
481 Ga0495604_0072755 3300047317 Bacteria 2597
482 Ga0495672_0068822 3300047320 Bacteria 2011
483 Ga0495672_0117197 3300047320 Bacteria 1421
484 Ga0495680_0036997 3300047322 Bacteria 3912
485 Ga0495683_0108972 3300047323 Bacteria 1324
486 Ga0495675_0041019 3300047444 Bacteria 2950
487 Ga0495675_0058272 3300047444 Bacteria 2449
488 Ga0495684_0139724 3300047471 Bacteria 1816
489 Ga0495684_0184135 3300047471 Bacteria 1547
490 Ga0495686_0001008 3300047472 Bacteria 34224
491 Ga0495686_0274513 3300047472 Bacteria 939
492 Ga0495593_0035371 3300047673 Bacteria 2713
493 Ga0495602_0092509 3300048088 Bacteria 2505
494 Ga0496100_0027698 3300048903 Bacteria 3488
495 Ga0496101_0114970 3300048904 Bacteria 2029
496 Ga0496102_0033525 3300048905 Bacteria 4616
497 Ga0496102_0099939 3300048905 Bacteria 2693
498 Ga0496104_0002521 3300048907 Bacteria 15773
499 Ga0496104_0017958 3300048907 Bacteria 6448
500 Ga0496104_0050054 3300048907 Bacteria 3942
501 Ga0496105_0006441 3300048908 Bacteria 9025
502 Ga0496105_0021595 3300048908 Bacteria 5210
503 Ga0496105_0360202 3300048908 Bacteria 1160
504 Ga0496107_0135875 3300048910 Bacteria 1816
505 Ga0496107_0179092 3300048910 Bacteria 1574
506 Ga0496108_0001133 3300048911 Bacteria 20819
507 Ga0496108_0015644 3300048911 Bacteria 6187
508 Ga0496108_0027712 3300048911 Bacteria 4682
509 Ga0496109_0000583 3300048912 Bacteria 30510
510 Ga0496109_0013351 3300048912 Bacteria 7121
511 Ga0496110_0004757 3300048913 Bacteria 10571
512 Ga0496110_0013967 3300048913 Bacteria 6653
513 Ga0496110_0033920 3300048913 Bacteria 4417
514 Ga0496111_0002980 3300048914 Bacteria 10376
515 Ga0496111_0541575 3300048914 Bacteria 855
516 Ga0496112_0000884 3300048915 Bacteria 21517
517 Ga0496112_0002152 3300048915 Bacteria 15650
518 Ga0496113_0000351 3300048916 Bacteria 22021
519 Ga0496113_0001829 3300048916 Bacteria 12109
520 Ga0496113_0005226 3300048916 Bacteria 8080
521 Ga0496114_0077198 3300048917 Bacteria 2808
522 Ga0496114_0139896 3300048917 Bacteria 2095
523 Ga0496114_0313078 3300048917 Bacteria 1387
524 Ga0496114_0447658 3300048917 Bacteria 1144
525 Ga0496115_0009751 3300048918 Bacteria 7152
526 Ga0496115_0129762 3300048918 Bacteria 2077
527 Ga0496115_0361216 3300048918 Bacteria 1183
528 Ga0496115_0520969 3300048918 Bacteria 953
529 Ga0496117_0077019 3300048920 Bacteria 2208
530 Ga0496118_0017136 3300048921 Bacteria 6610
531 Ga0496118_0040427 3300048921 Bacteria 3708
532 Ga0496118_0089244 3300048921 Bacteria 2129
533 Ga0496120_0155211 3300048923 Bacteria 1146
534 Ga0496121_0373689 3300048924 Bacteria 942
535 Ga0496122_0055074 3300048925 Bacteria 2979
536 Ga0496123_0074841 3300048926 Bacteria 2093
537 Ga0496125_0052234 3300048928 Bacteria 3362
538 Ga0501310_020559 3300049130 Bacteria 820
539 Ga0501329_06189 3300049545 Bacteria 678
540 Ga0501033_0224530 3300049570 Bacteria 1336
541 Ga0501034_0132045 3300049571 Bacteria 2480
542 Ga0501034_0277504 3300049571 Bacteria 1616
543 Ga0501034_0285152 3300049571 Bacteria 1590
544 Ga0501036_0311249 3300049572 Bacteria 1316
545 Ga0501037_0069329 3300049573 Bacteria 2567
546 Ga0501043_0251795 3300049579 Bacteria 1360
547 Ga0501047_0000235 3300049581 Bacteria 65603
548 Ga0501047_0074415 3300049581 Bacteria 3270
549 Ga0501047_0466122 3300049581 Bacteria 1092
550 Ga0501048_0093362 3300049582 Bacteria 2123
551 Ga0501070_0199045 3300049586 Bacteria 1645
552 Ga0501073_0494686 3300049589 Bacteria 846
553 Ga0501074_0002757 3300049590 Bacteria 12304
554 Ga0501074_0338521 3300049590 Bacteria 1068
555 Ga0501075_0070033 3300049591 Bacteria 2651
556 Ga0501076_0097296 3300049592 Bacteria 2371
557 Ga0501076_0166011 3300049592 Bacteria 1799
558 Ga0501077_0102988 3300049593 Bacteria 1809
559 Ga0501079_0102385 3300049741 Bacteria 2221
560 Ga0501080_0013397 3300049742 Bacteria 7542
561 Ga0501080_0360541 3300049742 Bacteria 1312
562 Ga0501083_0004993 3300049744 Bacteria 9404
563 Ga0501035_0351152 3300049822 Bacteria 1234
564 Ga0501035_0985448 3300049822 Bacteria 663
565 Ga0501044_0055624 3300049823 Bacteria 4064
566 Ga0501044_0061936 3300049823 Bacteria 3826
567 Ga0501044_0076620 3300049823 Bacteria 3393
568 Ga0501044_0122636 3300049823 Bacteria 2598
569 Ga0501044_0288837 3300049823 Bacteria 1572
570 Ga0501045_0077461 3300049824 Bacteria 2450
571 nmdc:mga03683_382221_c1 3300050489 Bacteria 670
572 nmdc:mga0k408_161964_c1 3300050493 Bacteria 1333
573 nmdc:mga05p37_193059_c1 3300050507 Bacteria 2471
574 nmdc:mga05p37_208661_c1 3300050507 Bacteria 2362
575 nmdc:mga05p37_41651_c1 3300050507 Bacteria 5639
576 nmdc:mga09592_134808_c1 3300050508 Bacteria 2126
577 nmdc:mga0qj67_398999_c1 3300050509 Bacteria 1110
578 nmdc:mga06r32_388937_c1 3300050510 Bacteria 1377
579 nmdc:mga08y16_96065_c1 3300050511 Bacteria 3086
580 nmdc:mga0n895_78493_c1 3300050512 Bacteria 3286
581 nmdc:mga0rr50_433776_c1 3300050513 Bacteria 1112
582 nmdc:mga08x19_23_c1 3300050514 Bacteria 288286
583 nmdc:mga0a205_185339_c1 3300050515 Bacteria 1974
584 Ga0495601_0509942 3300053077 Bacteria 776
585 Ga0495612_0022709 3300053078 Bacteria 2514
586 Ga0495595_0012728 3300053084 Bacteria 3544
587 Ga0495595_0017179 3300053084 Bacteria 3110
588 Ga0495595_0204772 3300053084 Bacteria 983
589 Ga0495619_0008778 3300053085 Bacteria 6391
590 Ga0495619_0097132 3300053085 Bacteria 2001
591 Ga0495619_0115427 3300053085 Bacteria 1837
592 Ga0500641_0007663 3300053096 Bacteria 3847
593 Ga0500593_000058 3300053117 Bacteria 41070
594 Ga0500608_041046 3300053122 Bacteria 2218
595 Ga0500642_0080296 3300053130 Bacteria 1497
596 Ga0500655_000265 3300053133 Bacteria 12247
597 Ga0500568_0000001 3300053139 Bacteria 988705
598 Ga0500577_0040810 3300053142 Bacteria 1689
599 Ga0500577_0094396 3300053142 Bacteria 1214
600 Ga0500590_015132 3300053148 Bacteria 3982
601 Ga0500616_0050068 3300053153 Bacteria 2207
602 Ga0500622_0039247 3300053156 Bacteria 2469
603 Ga0500636_0029625 3300053177 Bacteria 3234
604 Ga0501084_0275420 3300054114 Bacteria 1421
605 Ga0587084_004230 3300059477 Bacteria 1631
606 Ga0587101_021594 3300059623 Bacteria 932
607 Ga0587068_000630 3300059641 Bacteria 3390
608 Ga0587069_011022 3300059642 Bacteria 1201
609 Ga0587079_002261 3300059647 Bacteria 2329
610 Ga0501082_0243438 3300060353 Bacteria 1565
611 Ga0466962_0043530 3300061719 Bacteria 2148
612 Ga0466962_0078938 3300061719 Bacteria 1573
613 Ga0466962_0248959 3300061719 Bacteria 873
614 Ga0530510_0097213 3300061734 Bacteria 2152

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046690 Ga0495624_0523343 Ga0495624_0523343_22_627 145
2 3300047315 Ga0495581_0062181 Ga0495581_0062181_1526_2131 145
3 3300014326 Ga0157380_10410045 Ga0157380_104100453 152
4 3300046500 Ga0495596_0280689 Ga0495596_0280689_104_613 152
5 3300037471 Ga0395905_0985174 Ga0395905_0985174_196_675 159
6 3300049545 Ga0501329_06189 Ga0501329_06189_187_666 159
7 3300053084 Ga0495595_0204772 Ga0495595_0204772_35_514 159
8 3300005466 Ga0070685_10681786 Ga0070685_106817861 160
9 3300039438 Ga0436360_0537617 Ga0436360_0537617_2832_3368 160
10 3300025908 Ga0207643_10207188 Ga0207643_102071881 161
11 3300005937 Ga0081455_10020755 Ga0081455_1002075512 162
12 3300049130 Ga0501310_020559 Ga0501310_020559_20_511 163
13 3300005365 Ga0070688_100098616 Ga0070688_1000986162 166
14 3300037466 Ga0395898_1034210 Ga0395898_1034210_28_531 167
15 3300028380 Ga0268265_10941727 Ga0268265_109417272 169
16 3300035172 Ga0373955_0754659 Ga0373955_0754659_20_553 169
17 3300049593 Ga0501077_0102988 Ga0501077_0102988_509_1018 169
18 3300060353 Ga0501082_0243438 Ga0501082_0243438_978_1487 169
19 3300007788 Ga0099795_10001948 Ga0099795_100019483 170
20 3300010159 Ga0099796_10009160 Ga0099796_100091605 170
21 3300027512 Ga0209179_1109151 Ga0209179_11091511 170
22 3300035083 Ga0373926_0054062 Ga0373926_0054062_824_1357 170
23 3300035089 Ga0373944_0006361 Ga0373944_0006361_926_1459 170
24 3300035111 Ga0373923_0028731 Ga0373923_0028731_1060_1593 170
25 3300035170 Ga0373943_0204756 Ga0373943_0204756_348_881 170
26 3300035171 Ga0373946_0029660 Ga0373946_0029660_54_587 170
27 3300035692 Ga0373935_0117540 Ga0373935_0117540_783_1316 170
28 3300035695 Ga0373927_0056189 Ga0373927_0056189_722_1255 170
29 3300035725 Ga0373947_0085267 Ga0373947_0085267_817_1350 170
30 3300037068 Ga0373925_0047403 Ga0373925_0047403_2162_2695 170
31 3300009094 Ga0111539_10163484 Ga0111539_101634846 171
32 3300041460 Ga0451802_1450534 Ga0451802_1450534_60_674 171
33 3300047472 Ga0495686_0001008 Ga0495686_0001008_10439_10972 172
34 iso_pu_bacteria 2513237087 2513594037 173
35 iso_pu_bacteria 2582581305 2585262476 173
36 iso_pu_bacteria 2595698237 2596377143 173
37 iso_pu_bacteria 2643221541 2643729031 173
38 iso_pu_bacteria 2643221606 2644045044 173
39 iso_pu_bacteria 2643221671 2644391217 173
40 iso_pu_bacteria 2643221733 2644729066 173
41 iso_pu_bacteria 2643221734 2644735422 173
42 iso_pu_bacteria 2738541281 2738745691 173
43 iso_pu_bacteria 2738543032 2739354921 173
44 iso_pu_bacteria 2841760612 2841761391 173
45 iso_pu_bacteria 2841911363 2841913394 173
46 iso_pu_bacteria 2841917233 2841919141 173
47 iso_pu_bacteria 2842698319 2842701705 173
48 iso_pu_bacteria 2844104063 2844104416 173
49 iso_pu_bacteria 2851246043 2851247404 173
50 iso_pu_bacteria 2889306138 2889311586 173
51 iso_pu_bacteria 2891088606 2891092902 173
52 iso_pu_bacteria 2902405164 2902410519 173
53 iso_pu_bacteria 2917699015 2917699280 173
54 iso_pu_bacteria 2919138771 2919141398 173
55 iso_pu_bacteria 2928125067 2928130706 173
56 iso_pu_bacteria 8057529695 8057530426 173
57 3300039447 Ga0436361_0327700 Ga0436361_0327700_1524_2048 174
58 3300039450 Ga0436363_1571548 Ga0436363_1571548_2507_3031 174
59 3300001977 JGI24746J21847_1042367 JGI24746J21847_10423671 177
60 3300001979 JGI24740J21852_10076260 JGI24740J21852_100762601 177
61 3300001989 JGI24739J22299_10045863 JGI24739J22299_100458632 177
62 3300001991 JGI24743J22301_10003130 JGI24743J22301_100031304 177
63 3300002075 JGI24738J21930_10008307 JGI24738J21930_100083075 177
64 3300002075 JGI24738J21930_10020059 JGI24738J21930_100200592 177
65 3300002076 JGI24749J21850_1000052 JGI24749J21850_100005220 177
66 3300002077 JGI24744J21845_10000585 JGI24744J21845_100005853 177
67 3300002459 JGI24751J29686_10000379 JGI24751J29686_1000037915 177
68 3300003187 JGI25151J46595_10000038 JGI25151J46595_1000003818 177
69 3300003762 Ga0055542_1002777 Ga0055542_10027773 177
70 3300003771 Ga0055526_1012008 Ga0055526_10120084 177
71 3300003775 Ga0055524_1006440 Ga0055524_10064404 177
72 3300003784 Ga0055534_1028384 Ga0055534_10283841 177
73 3300005327 Ga0070658_10010598 Ga0070658_100105989 177
74 3300005327 Ga0070658_10073690 Ga0070658_100736903 177
75 3300005327 Ga0070658_10097669 Ga0070658_100976696 177
76 3300005327 Ga0070658_10225012 Ga0070658_102250123 177
77 3300005328 Ga0070676_10092152 Ga0070676_100921522 177
78 3300005329 Ga0070683_100037799 Ga0070683_1000377995 177
79 3300005329 Ga0070683_100429364 Ga0070683_1004293642 177
80 3300005331 Ga0070670_100000093 Ga0070670_1000000936 177
81 3300005331 Ga0070670_100030580 Ga0070670_1000305806 177
82 3300005334 Ga0068869_100000029 Ga0068869_10000002939 177
83 3300005336 Ga0070680_100005733 Ga0070680_10000573310 177
84 3300005336 Ga0070680_100024886 Ga0070680_1000248864 177
85 3300005336 Ga0070680_100063787 Ga0070680_1000637872 177
86 3300005336 Ga0070680_100082947 Ga0070680_1000829472 177
87 3300005336 Ga0070680_101147667 Ga0070680_1011476671 177
88 3300005338 Ga0068868_100003973 Ga0068868_10000397311 177
89 3300005339 Ga0070660_100049574 Ga0070660_1000495744 177
90 3300005339 Ga0070660_100126597 Ga0070660_1001265973 177
91 3300005339 Ga0070660_100459877 Ga0070660_1004598772 177
92 3300005339 Ga0070660_100968203 Ga0070660_1009682031 177
93 3300005344 Ga0070661_100069740 Ga0070661_1000697403 177
94 3300005347 Ga0070668_100010274 Ga0070668_1000102743 177
95 3300005347 Ga0070668_100205915 Ga0070668_1002059152 177
96 3300005353 Ga0070669_100000115 Ga0070669_1000001156 177
97 3300005354 Ga0070675_101754841 Ga0070675_1017548411 177
98 3300005355 Ga0070671_100135894 Ga0070671_1001358943 177
99 3300005355 Ga0070671_100141969 Ga0070671_1001419693 177
100 3300005355 Ga0070671_101094875 Ga0070671_1010948751 177
101 3300005356 Ga0070674_100056384 Ga0070674_1000563842 177
102 3300005364 Ga0070673_100000019 Ga0070673_100000019116 177
103 3300005366 Ga0070659_100183076 Ga0070659_1001830762 177
104 3300005366 Ga0070659_101162815 Ga0070659_1011628151 177
105 3300005367 Ga0070667_100000088 Ga0070667_10000008871 177
106 3300005367 Ga0070667_100013671 Ga0070667_1000136716 177
107 3300005434 Ga0070709_10048001 Ga0070709_100480012 177
108 3300005435 Ga0070714_100448914 Ga0070714_1004489142 177
109 3300005435 Ga0070714_100511011 Ga0070714_1005110112 177
110 3300005436 Ga0070713_100017903 Ga0070713_1000179032 177
111 3300005436 Ga0070713_101125750 Ga0070713_1011257501 177
112 3300005439 Ga0070711_100044999 Ga0070711_1000449994 177
113 3300005439 Ga0070711_100158971 Ga0070711_1001589711 177
114 3300005455 Ga0070663_100016226 Ga0070663_1000162263 177
115 3300005456 Ga0070678_100006601 Ga0070678_10000660112 177
116 3300005457 Ga0070662_100202310 Ga0070662_1002023103 177
117 3300005457 Ga0070662_100515479 Ga0070662_1005154791 177
118 3300005458 Ga0070681_10063895 Ga0070681_100638959 177
119 3300005458 Ga0070681_10128718 Ga0070681_101287184 177
120 3300005458 Ga0070681_10400379 Ga0070681_104003792 177
121 3300005458 Ga0070681_10485858 Ga0070681_104858582 177
122 3300005458 Ga0070681_10952663 Ga0070681_109526632 177
123 3300005459 Ga0068867_100000014 Ga0068867_100000014120 177
124 3300005459 Ga0068867_100772215 Ga0068867_1007722152 177
125 3300005530 Ga0070679_100068171 Ga0070679_1000681714 177
126 3300005530 Ga0070679_100083578 Ga0070679_1000835787 177
127 3300005530 Ga0070679_100200073 Ga0070679_1002000733 177
128 3300005530 Ga0070679_100242821 Ga0070679_1002428214 177
129 3300005530 Ga0070679_100366118 Ga0070679_1003661182 177
130 3300005530 Ga0070679_100696567 Ga0070679_1006965672 177
131 3300005530 Ga0070679_101099268 Ga0070679_1010992682 177
132 3300005535 Ga0070684_100431540 Ga0070684_1004315402 177
133 3300005536 Ga0070697_100005582 Ga0070697_1000055826 177
134 3300005539 Ga0068853_100892512 Ga0068853_1008925122 177
135 3300005543 Ga0070672_101170263 Ga0070672_1011702632 177
136 3300005545 Ga0070695_100007388 Ga0070695_1000073884 177
137 3300005547 Ga0070693_100171905 Ga0070693_1001719051 177
138 3300005547 Ga0070693_100272386 Ga0070693_1002723862 177
139 3300005548 Ga0070665_100255950 Ga0070665_1002559502 177
140 3300005549 Ga0070704_100880415 Ga0070704_1008804152 177
141 3300005563 Ga0068855_100027910 Ga0068855_10002791010 177
142 3300005563 Ga0068855_100447267 Ga0068855_1004472673 177
143 3300005563 Ga0068855_100810457 Ga0068855_1008104572 177
144 3300005563 Ga0068855_100913885 Ga0068855_1009138852 177
145 3300005564 Ga0070664_100122298 Ga0070664_1001222985 177
146 3300005577 Ga0068857_100066375 Ga0068857_1000663752 177
147 3300005577 Ga0068857_100324060 Ga0068857_1003240603 177
148 3300005577 Ga0068857_100885056 Ga0068857_1008850561 177
149 3300005577 Ga0068857_101070198 Ga0068857_1010701981 177
150 3300005578 Ga0068854_100449464 Ga0068854_1004494642 177
151 3300005614 Ga0068856_100060779 Ga0068856_1000607793 177
152 3300005614 Ga0068856_100484785 Ga0068856_1004847853 177
153 3300005616 Ga0068852_100166080 Ga0068852_1001660804 177
154 3300005616 Ga0068852_100247205 Ga0068852_1002472053 177
155 3300005616 Ga0068852_100383315 Ga0068852_1003833153 177
156 3300005616 Ga0068852_101768801 Ga0068852_1017688011 177
157 3300005617 Ga0068859_100009835 Ga0068859_1000098353 177
158 3300005617 Ga0068859_100096701 Ga0068859_1000967012 177
159 3300005618 Ga0068864_100000087 Ga0068864_1000000876 177
160 3300005618 Ga0068864_100754039 Ga0068864_1007540392 177
161 3300005719 Ga0068861_100006640 Ga0068861_10000664010 177
162 3300005834 Ga0068851_10070267 Ga0068851_100702672 177
163 3300005841 Ga0068863_100008669 Ga0068863_10000866916 177
164 3300005843 Ga0068860_100000220 Ga0068860_10000022023 177
165 3300005843 Ga0068860_101008131 Ga0068860_1010081311 177
166 3300005844 Ga0068862_100000466 Ga0068862_1000004666 177
167 3300005844 Ga0068862_100122633 Ga0068862_1001226333 177
168 3300005937 Ga0081455_10004023 Ga0081455_1000402322 177
169 3300005937 Ga0081455_10041960 Ga0081455_100419604 177
170 3300005983 Ga0081540_1006488 Ga0081540_10064883 177
171 3300005983 Ga0081540_1051990 Ga0081540_10519904 177
172 3300005985 Ga0081539_10057536 Ga0081539_100575364 177
173 3300006038 Ga0075365_10164955 Ga0075365_101649554 177
174 3300006038 Ga0075365_10448116 Ga0075365_104481162 177
175 3300006038 Ga0075365_10596615 Ga0075365_105966152 177
176 3300006175 Ga0070712_100040629 Ga0070712_1000406296 177
177 3300006186 Ga0075369_10014440 Ga0075369_100144403 177
178 3300006195 Ga0075366_10011613 Ga0075366_1001161312 177
179 3300006195 Ga0075366_10181683 Ga0075366_101816832 177
180 3300006195 Ga0075366_10794142 Ga0075366_107941421 177
181 3300006237 Ga0097621_100377578 Ga0097621_1003775782 177
182 3300006353 Ga0075370_10211943 Ga0075370_102119432 177
183 3300006358 Ga0068871_100041983 Ga0068871_1000419833 177
184 3300006847 Ga0075431_100013939 Ga0075431_1000139394 177
185 3300006852 Ga0075433_10327457 Ga0075433_103274573 177
186 3300006871 Ga0075434_100185510 Ga0075434_1001855103 177
187 3300006881 Ga0068865_100030870 Ga0068865_1000308702 177
188 3300006914 Ga0075436_100014756 Ga0075436_10001475611 177
189 3300006931 Ga0097620_100009835 Ga0097620_10000983512 177
190 3300006931 Ga0097620_100096701 Ga0097620_1000967012 177
191 3300007076 Ga0075435_100026460 Ga0075435_1000264604 177
192 3300007076 Ga0075435_100388871 Ga0075435_1003888712 177
193 3300009093 Ga0105240_10015848 Ga0105240_100158489 177
194 3300009093 Ga0105240_10038434 Ga0105240_100384346 177
195 3300009093 Ga0105240_10337173 Ga0105240_103371733 177
196 3300009094 Ga0111539_10483254 Ga0111539_104832541 177
197 3300009098 Ga0105245_10005275 Ga0105245_100052752 177
198 3300009101 Ga0105247_10804080 Ga0105247_108040802 177
199 3300009147 Ga0114129_10001848 Ga0114129_1000184818 177
200 3300009147 Ga0114129_10227354 Ga0114129_102273545 177
201 3300009147 Ga0114129_11835813 Ga0114129_118358131 177
202 3300009148 Ga0105243_10000076 Ga0105243_100000769 177
203 3300009148 Ga0105243_10245578 Ga0105243_102455782 177
204 3300009148 Ga0105243_10477166 Ga0105243_104771662 177
205 3300009176 Ga0105242_10009804 Ga0105242_100098049 177
206 3300009177 Ga0105248_10003987 Ga0105248_1000398712 177
207 3300009177 Ga0105248_10008689 Ga0105248_1000868910 177
208 3300009545 Ga0105237_10045964 Ga0105237_100459644 177
209 3300009545 Ga0105237_10268995 Ga0105237_102689952 177
210 3300009545 Ga0105237_10553704 Ga0105237_105537042 177
211 3300009551 Ga0105238_10084340 Ga0105238_100843406 177
212 3300009551 Ga0105238_10164963 Ga0105238_101649634 177
213 3300009551 Ga0105238_10226631 Ga0105238_102266313 177
214 3300009551 Ga0105238_10271223 Ga0105238_102712231 177
215 3300009551 Ga0105238_11105398 Ga0105238_111053982 177
216 3300009553 Ga0105249_10020004 Ga0105249_100200042 177
217 3300009553 Ga0105249_10123325 Ga0105249_101233256 177
218 3300009978 Ga0105148_100340 Ga0105148_1003404 177
219 3300010375 Ga0105239_10343307 Ga0105239_103433074 177
220 3300010375 Ga0105239_10557218 Ga0105239_105572182 177
221 3300010375 Ga0105239_11006974 Ga0105239_110069742 177
222 3300011119 Ga0105246_10052677 Ga0105246_100526777 177
223 3300012513 Ga0157326_1000064 Ga0157326_100006410 177
224 3300013100 Ga0157373_10069320 Ga0157373_100693201 177
225 3300013100 Ga0157373_10147610 Ga0157373_101476103 177
226 3300013100 Ga0157373_10159167 Ga0157373_101591673 177
227 3300013100 Ga0157373_10737579 Ga0157373_107375792 177
228 3300013102 Ga0157371_10042695 Ga0157371_100426957 177
229 3300013102 Ga0157371_10206362 Ga0157371_102063622 177
230 3300013102 Ga0157371_10659969 Ga0157371_106599692 177
231 3300013102 Ga0157371_10886225 Ga0157371_108862251 177
232 3300013104 Ga0157370_10011636 Ga0157370_100116366 177
233 3300013104 Ga0157370_10108530 Ga0157370_101085306 177
234 3300013104 Ga0157370_10494637 Ga0157370_104946372 177
235 3300013104 Ga0157370_10776460 Ga0157370_107764602 177
236 3300013104 Ga0157370_11330686 Ga0157370_113306861 177
237 3300013105 Ga0157369_10077891 Ga0157369_100778916 177
238 3300013105 Ga0157369_10129027 Ga0157369_101290274 177
239 3300013105 Ga0157369_10337199 Ga0157369_103371992 177
240 3300013105 Ga0157369_10444632 Ga0157369_104446322 177
241 3300013296 Ga0157374_10044615 Ga0157374_100446152 177
242 3300013296 Ga0157374_10094106 Ga0157374_100941063 177
243 3300013297 Ga0157378_10000504 Ga0157378_1000050442 177
244 3300013306 Ga0163162_10504833 Ga0163162_105048332 177
245 3300013307 Ga0157372_10234957 Ga0157372_102349574 177
246 3300013307 Ga0157372_10519019 Ga0157372_105190191 177
247 3300013307 Ga0157372_11075511 Ga0157372_110755112 177
248 3300014325 Ga0163163_10002310 Ga0163163_1000231013 177
249 3300014325 Ga0163163_10024251 Ga0163163_100242516 177
250 3300014325 Ga0163163_10204491 Ga0163163_102044913 177
251 3300014326 Ga0157380_10000157 Ga0157380_1000015712 177
252 3300014745 Ga0157377_10145480 Ga0157377_101454803 177
253 3300014968 Ga0157379_10446478 Ga0157379_104464782 177
254 3300014969 Ga0157376_10000092 Ga0157376_1000009247 177
255 3300017792 Ga0163161_10189654 Ga0163161_101896542 177
256 3300021384 Ga0213876_10013852 Ga0213876_100138523 177
257 3300021388 Ga0213875_10241366 Ga0213875_102413662 177
258 3300025231 Ga0207427_104233 Ga0207427_1042334 177
259 3300025233 Ga0209437_109865 Ga0209437_1098652 177
260 3300025250 Ga0209026_1000352 Ga0209026_100035234 177
261 3300025254 Ga0209148_1004350 Ga0209148_10043506 177
262 3300025261 Ga0209233_1000003 Ga0209233_1000003951 177
263 3300025261 Ga0209233_1003903 Ga0209233_10039033 177
264 3300025272 Ga0209455_1002555 Ga0209455_10025552 177
265 3300025273 Ga0209673_1037691 Ga0209673_10376912 177
266 3300025291 Ga0209675_1002527 Ga0209675_100252715 177
267 3300025292 Ga0209676_1028639 Ga0209676_10286393 177
268 3300025294 Ga0209025_1000014 Ga0209025_100001412 177
269 3300025294 Ga0209025_1065919 Ga0209025_10659192 177
270 3300025295 Ga0209564_1002872 Ga0209564_100287213 177
271 3300025299 Ga0209256_1000108 Ga0209256_1000108184 177
272 3300025321 Ga0207656_10023826 Ga0207656_100238263 177
273 3300025901 Ga0207688_10030543 Ga0207688_100305432 177
274 3300025904 Ga0207647_10389004 Ga0207647_103890041 177
275 3300025906 Ga0207699_10302236 Ga0207699_103022361 177
276 3300025907 Ga0207645_10028915 Ga0207645_100289159 177
277 3300025909 Ga0207705_10000243 Ga0207705_1000024320 177
278 3300025909 Ga0207705_10002954 Ga0207705_1000295419 177
279 3300025909 Ga0207705_10005544 Ga0207705_100055449 177
280 3300025909 Ga0207705_10040855 Ga0207705_100408556 177
281 3300025909 Ga0207705_10752239 Ga0207705_107522391 177
282 3300025911 Ga0207654_10135541 Ga0207654_101355412 177
283 3300025912 Ga0207707_10009792 Ga0207707_100097929 177
284 3300025912 Ga0207707_10073118 Ga0207707_100731186 177
285 3300025912 Ga0207707_10261591 Ga0207707_102615912 177
286 3300025912 Ga0207707_10452187 Ga0207707_104521872 177
287 3300025913 Ga0207695_10012684 Ga0207695_1001268410 177
288 3300025913 Ga0207695_10159517 Ga0207695_101595174 177
289 3300025914 Ga0207671_10068421 Ga0207671_100684215 177
290 3300025914 Ga0207671_10342326 Ga0207671_103423262 177
291 3300025915 Ga0207693_10004752 Ga0207693_100047526 177
292 3300025915 Ga0207693_10338978 Ga0207693_103389782 177
293 3300025917 Ga0207660_10033759 Ga0207660_100337592 177
294 3300025917 Ga0207660_10073946 Ga0207660_100739465 177
295 3300025917 Ga0207660_10109315 Ga0207660_101093153 177
296 3300025917 Ga0207660_10234972 Ga0207660_102349724 177
297 3300025917 Ga0207660_10238397 Ga0207660_102383973 177
298 3300025917 Ga0207660_10266788 Ga0207660_102667883 177
299 3300025919 Ga0207657_10039829 Ga0207657_100398291 177
300 3300025919 Ga0207657_10057078 Ga0207657_100570786 177
301 3300025919 Ga0207657_10098911 Ga0207657_100989111 177
302 3300025919 Ga0207657_10441080 Ga0207657_104410802 177
303 3300025920 Ga0207649_10670647 Ga0207649_106706472 177
304 3300025921 Ga0207652_10022634 Ga0207652_100226349 177
305 3300025921 Ga0207652_10237592 Ga0207652_102375922 177
306 3300025921 Ga0207652_10259630 Ga0207652_102596303 177
307 3300025921 Ga0207652_10266174 Ga0207652_102661743 177
308 3300025921 Ga0207652_10414093 Ga0207652_104140933 177
309 3300025923 Ga0207681_10000005 Ga0207681_1000000557 177
310 3300025923 Ga0207681_10138373 Ga0207681_101383731 177
311 3300025924 Ga0207694_10010694 Ga0207694_100106947 177
312 3300025924 Ga0207694_10161581 Ga0207694_101615814 177
313 3300025924 Ga0207694_10231602 Ga0207694_102316023 177
314 3300025924 Ga0207694_10258839 Ga0207694_102588393 177
315 3300025925 Ga0207650_10000004 Ga0207650_10000004664 177
316 3300025925 Ga0207650_10014747 Ga0207650_100147475 177
317 3300025926 Ga0207659_10009064 Ga0207659_100090646 177
318 3300025927 Ga0207687_10079745 Ga0207687_100797455 177
319 3300025928 Ga0207700_10110657 Ga0207700_101106574 177
320 3300025929 Ga0207664_10006275 Ga0207664_1000627510 177
321 3300025929 Ga0207664_10033079 Ga0207664_100330796 177
322 3300025931 Ga0207644_10082298 Ga0207644_100822983 177
323 3300025931 Ga0207644_10176989 Ga0207644_101769893 177
324 3300025931 Ga0207644_10370336 Ga0207644_103703362 177
325 3300025931 Ga0207644_10994302 Ga0207644_109943021 177
326 3300025932 Ga0207690_10675799 Ga0207690_106757991 177
327 3300025933 Ga0207706_10041508 Ga0207706_100415085 177
328 3300025933 Ga0207706_10543457 Ga0207706_105434572 177
329 3300025934 Ga0207686_10004287 Ga0207686_100042878 177
330 3300025935 Ga0207709_10000114 Ga0207709_1000011426 177
331 3300025935 Ga0207709_10341562 Ga0207709_103415622 177
332 3300025935 Ga0207709_10360916 Ga0207709_103609163 177
333 3300025937 Ga0207669_10017734 Ga0207669_100177342 177
334 3300025937 Ga0207669_10278908 Ga0207669_102789082 177
335 3300025938 Ga0207704_10000008 Ga0207704_10000008116 177
336 3300025939 Ga0207665_10140403 Ga0207665_101404032 177
337 3300025940 Ga0207691_10130675 Ga0207691_101306752 177
338 3300025941 Ga0207711_10001472 Ga0207711_1000147215 177
339 3300025941 Ga0207711_10221727 Ga0207711_102217272 177
340 3300025941 Ga0207711_10492350 Ga0207711_104923502 177
341 3300025942 Ga0207689_10000608 Ga0207689_1000060840 177
342 3300025944 Ga0207661_10038656 Ga0207661_100386566 177
343 3300025945 Ga0207679_10095607 Ga0207679_100956074 177
344 3300025945 Ga0207679_10098523 Ga0207679_100985232 177
345 3300025949 Ga0207667_10004001 Ga0207667_1000400112 177
346 3300025949 Ga0207667_10033512 Ga0207667_100335123 177
347 3300025960 Ga0207651_10000008 Ga0207651_10000008108 177
348 3300025961 Ga0207712_10077729 Ga0207712_100777292 177
349 3300025961 Ga0207712_10346030 Ga0207712_103460303 177
350 3300025961 Ga0207712_10868134 Ga0207712_108681342 177
351 3300025981 Ga0207640_10026471 Ga0207640_100264713 177
352 3300025981 Ga0207640_10338594 Ga0207640_103385942 177
353 3300025986 Ga0207658_10000064 Ga0207658_1000006446 177
354 3300025986 Ga0207658_10009141 Ga0207658_100091416 177
355 3300026023 Ga0207677_10000091 Ga0207677_1000009189 177
356 3300026035 Ga0207703_10890785 Ga0207703_108907852 177
357 3300026041 Ga0207639_10491719 Ga0207639_104917192 177
358 3300026041 Ga0207639_11053564 Ga0207639_110535642 177
359 3300026067 Ga0207678_10045992 Ga0207678_100459922 177
360 3300026078 Ga0207702_10006302 Ga0207702_100063027 177
361 3300026078 Ga0207702_10247187 Ga0207702_102471872 177
362 3300026078 Ga0207702_10967111 Ga0207702_109671112 177
363 3300026088 Ga0207641_10003244 Ga0207641_1000324413 177
364 3300026089 Ga0207648_10000009 Ga0207648_10000009108 177
365 3300026095 Ga0207676_10000006 Ga0207676_1000000648 177
366 3300026116 Ga0207674_10066644 Ga0207674_100666446 177
367 3300026116 Ga0207674_10071868 Ga0207674_100718685 177
368 3300026116 Ga0207674_10373507 Ga0207674_103735072 177
369 3300026116 Ga0207674_10404168 Ga0207674_104041683 177
370 3300026118 Ga0207675_100001117 Ga0207675_10000111718 177
371 3300026121 Ga0207683_10006500 Ga0207683_1000650016 177
372 3300026142 Ga0207698_10230088 Ga0207698_102300883 177
373 3300026142 Ga0207698_10525453 Ga0207698_105254532 177
374 3300026142 Ga0207698_10833795 Ga0207698_108337952 177
375 3300028379 Ga0268266_10400280 Ga0268266_104002803 177
376 3300028379 Ga0268266_10534549 Ga0268266_105345492 177
377 3300028379 Ga0268266_10624098 Ga0268266_106240982 177
378 3300028380 Ga0268265_10000001 Ga0268265_100000011130 177
379 3300028380 Ga0268265_10058458 Ga0268265_100584583 177
380 3300028381 Ga0268264_10000277 Ga0268264_1000027790 177
381 3300028556 Ga0265337_1007309 Ga0265337_10073095 177
382 3300028666 Ga0265336_10052787 Ga0265336_100527871 177
383 3300028794 Ga0307515_10099360 Ga0307515_100993606 177
384 3300028800 Ga0265338_10169152 Ga0265338_101691522 177
385 3300028800 Ga0265338_10534408 Ga0265338_105344082 177
386 3300031238 Ga0265332_10081675 Ga0265332_100816751 177
387 3300031241 Ga0265325_10003961 Ga0265325_1000396116 177
388 3300031241 Ga0265325_10007856 Ga0265325_100078564 177
389 3300031241 Ga0265325_10075997 Ga0265325_100759971 177
390 3300031247 Ga0265340_10167086 Ga0265340_101670861 177
391 3300031249 Ga0265339_10001408 Ga0265339_1000140816 177
392 3300031249 Ga0265339_10052488 Ga0265339_100524882 177
393 3300031250 Ga0265331_10014930 Ga0265331_100149307 177
394 3300031250 Ga0265331_10235677 Ga0265331_102356771 177
395 3300031251 Ga0265327_10072293 Ga0265327_100722932 177
396 3300031344 Ga0265316_10050124 Ga0265316_100501245 177
397 3300031344 Ga0265316_10091372 Ga0265316_100913723 177
398 3300031595 Ga0265313_10001884 Ga0265313_1000188423 177
399 3300031595 Ga0265313_10009717 Ga0265313_100097175 177
400 3300031595 Ga0265313_10041399 Ga0265313_100413995 177
401 3300031711 Ga0265314_10235211 Ga0265314_102352112 177
402 3300031712 Ga0265342_10000677 Ga0265342_1000067726 177
403 3300031712 Ga0265342_10085476 Ga0265342_100854761 177
404 3300031712 Ga0265342_10087093 Ga0265342_100870933 177
405 3300031901 Ga0307406_10090266 Ga0307406_100902664 177
406 3300031995 Ga0307409_100481191 Ga0307409_1004811912 177
407 3300031995 Ga0307409_100533681 Ga0307409_1005336812 177
408 3300035086 Ga0373934_0008632 Ga0373934_0008632_2520_3053 177
409 3300035092 Ga0373952_0069892 Ga0373952_0069892_122_655 177
410 3300035115 Ga0373941_0182888 Ga0373941_0182888_128_661 177
411 3300035117 Ga0373953_0031007 Ga0373953_0031007_36_569 177
412 3300035118 Ga0373954_0082396 Ga0373954_0082396_256_789 177
413 3300035118 Ga0373954_0464403 Ga0373954_0464403_19_552 177
414 3300035119 Ga0373956_0125127 Ga0373956_0125127_573_1106 177
415 3300035120 Ga0373957_0034795 Ga0373957_0034795_397_930 177
416 3300035120 Ga0373957_0167166 Ga0373957_0167166_31_564 177
417 3300035170 Ga0373943_0147879 Ga0373943_0147879_656_1189 177
418 3300035171 Ga0373946_0126645 Ga0373946_0126645_595_1128 177
419 3300035171 Ga0373946_0278477 Ga0373946_0278477_26_559 177
420 3300035172 Ga0373955_0001179 Ga0373955_0001179_8149_8682 177
421 3300035241 Ga0373961_0288663 Ga0373961_0288663_40_573 177
422 3300035410 Ga0373924_0029520 Ga0373924_0029520_1063_1596 177
423 3300035691 Ga0373931_0183942 Ga0373931_0183942_629_1162 177
424 3300035692 Ga0373935_0154285 Ga0373935_0154285_960_1493 177
425 3300035692 Ga0373935_0197109 Ga0373935_0197109_844_1377 177
426 3300035692 Ga0373935_0312809 Ga0373935_0312809_17_550 177
427 3300035695 Ga0373927_0041187 Ga0373927_0041187_639_1172 177
428 3300035695 Ga0373927_0106806 Ga0373927_0106806_491_1024 177
429 3300035724 Ga0373933_0183204 Ga0373933_0183204_49_582 177
430 3300035724 Ga0373933_0390031 Ga0373933_0390031_102_635 177
431 3300035725 Ga0373947_0058372 Ga0373947_0058372_1390_1923 177
432 3300035725 Ga0373947_0188861 Ga0373947_0188861_162_695 177
433 3300036401 Ga0373937_0021580 Ga0373937_0021580_3643_4176 177
434 3300036401 Ga0373937_0040264 Ga0373937_0040264_1440_1973 177
435 3300037068 Ga0373925_0502642 Ga0373925_0502642_348_881 177
436 3300037068 Ga0373925_0630749 Ga0373925_0630749_234_767 177
437 3300037068 Ga0373925_1267021 Ga0373925_1267021_49_582 177
438 3300037312 Ga0395899_0000406 Ga0395899_0000406_49312_49845 177
439 3300037312 Ga0395899_0066694 Ga0395899_0066694_966_1499 177
440 3300037418 Ga0395900_0021199 Ga0395900_0021199_1192_1725 177
441 3300037418 Ga0395900_0056306 Ga0395900_0056306_242_775 177
442 3300037418 Ga0395900_0506830 Ga0395900_0506830_345_878 177
443 3300037466 Ga0395898_0126504 Ga0395898_0126504_1221_1754 177
444 3300037466 Ga0395898_0137366 Ga0395898_0137366_1414_1947 177
445 3300037466 Ga0395898_0222452 Ga0395898_0222452_289_822 177
446 3300037853 Ga0436364_0163040 Ga0436364_0163040_70_603 177
447 3300037853 Ga0436364_0471401 Ga0436364_0471401_668_1201 177
448 3300038443 Ga0395901_0097542 Ga0395901_0097542_2151_2684 177
449 3300038443 Ga0395901_0177540 Ga0395901_0177540_1188_1721 177
450 3300038443 Ga0395901_0978377 Ga0395901_0978377_34_567 177
451 3300038726 Ga0400490_23185 Ga0400490_23185_213_749 177
452 3300038742 Ga0400486_03338 Ga0400486_03338_512_1048 177
453 3300038742 Ga0400486_26153 Ga0400486_26153_534_1070 177
454 3300039437 Ga0436365_0802220 Ga0436365_0802220_861_1394 177
455 3300039437 Ga0436365_1609996 Ga0436365_1609996_1821_2354 177
456 3300039438 Ga0436360_0447412 Ga0436360_0447412_534_1067 177
457 3300039450 Ga0436363_1616367 Ga0436363_1616367_717_1250 177
458 3300039453 Ga0436362_0662105 Ga0436362_0662105_359_892 177
459 3300039453 Ga0436362_0857492 Ga0436362_0857492_160_696 177
460 3300041411 Ga0439466_0074454 Ga0439466_0074454_471_1004 177
461 3300041462 Ga0451806_367681 Ga0451806_367681_1288_1821 177
462 3300041486 Ga0451807_1991054 Ga0451807_1991054_1003_1536 177
463 3300041512 Ga0451853_0019999 Ga0451853_0019999_101_634 177
464 3300042006 Ga0439432_096371 Ga0439432_096371_310_843 177
465 3300042012 Ga0439455_0006431 Ga0439455_0006431_928_1461 177
466 3300042157 Ga0439458_0004227 Ga0439458_0004227_1010_1543 177
467 3300042435 Ga0439434_0017101 Ga0439434_0017101_1432_1965 177
468 3300044656 Ga0466969_0095238 Ga0466969_0095238_795_1328 177
469 3300044658 Ga0466972_0022049 Ga0466972_0022049_2575_3108 177
470 3300044683 Ga0466965_0245619 Ga0466965_0245619_96_629 177
471 3300044684 Ga0466966_0032002 Ga0466966_0032002_2574_3107 177
472 3300044684 Ga0466966_0175993 Ga0466966_0175993_213_746 177
473 3300044693 Ga0466961_0078638 Ga0466961_0078638_899_1432 177
474 3300044693 Ga0466961_0116483 Ga0466961_0116483_744_1277 177
475 3300044694 Ga0466963_0015793 Ga0466963_0015793_624_1157 177
476 3300044694 Ga0466963_0021397 Ga0466963_0021397_1277_1810 177
477 3300044706 Ga0466964_0045974 Ga0466964_0045974_177_710 177
478 3300044719 Ga0466971_0204777 Ga0466971_0204777_214_747 177
479 3300044842 Ga0466957_0059645 Ga0466957_0059645_440_973 177
480 3300044842 Ga0466957_0090325 Ga0466957_0090325_172_705 177
481 3300044842 Ga0466957_0133264 Ga0466957_0133264_306_839 177
482 3300044842 Ga0466957_0213535 Ga0466957_0213535_314_847 177
483 3300044901 Ga0466960_0025122 Ga0466960_0025122_1135_1668 177
484 3300045049 Ga0466959_0030393 Ga0466959_0030393_1077_1610 177
485 3300045049 Ga0466959_0123080 Ga0466959_0123080_465_998 177
486 3300045049 Ga0466959_0131651 Ga0466959_0131651_817_1350 177
487 3300045836 Ga0466958_0159500 Ga0466958_0159500_592_1125 177
488 3300046455 Ga0495603_0346918 Ga0495603_0346918_247_780 177
489 3300046459 Ga0495629_0453662 Ga0495629_0453662_222_755 177
490 3300046462 Ga0495651_0123417 Ga0495651_0123417_118_651 177
491 3300046477 Ga0495664_0221638 Ga0495664_0221638_205_738 177
492 3300046499 Ga0495594_0339772 Ga0495594_0339772_215_748 177
493 3300046512 Ga0495610_0018183 Ga0495610_0018183_700_1233 177
494 3300046520 Ga0495637_0020520 Ga0495637_0020520_1787_2320 177
495 3300046529 Ga0495652_0178964 Ga0495652_0178964_240_773 177
496 3300046533 Ga0495640_0284484 Ga0495640_0284484_22_555 177
497 3300046536 Ga0495587_0067952 Ga0495587_0067952_501_1034 177
498 3300046559 Ga0495667_0062276 Ga0495667_0062276_1231_1764 177
499 3300046559 Ga0495667_0111752 Ga0495667_0111752_1136_1669 177
500 3300046559 Ga0495667_0494739 Ga0495667_0494739_217_750 177
501 3300046642 Ga0495634_0076021 Ga0495634_0076021_346_879 177
502 3300046648 Ga0495611_0020624 Ga0495611_0020624_92_625 177
503 3300046660 Ga0495625_0237448 Ga0495625_0237448_272_805 177
504 3300046663 Ga0495635_0060092 Ga0495635_0060092_1491_2024 177
505 3300046663 Ga0495635_0404725 Ga0495635_0404725_28_561 177
506 3300046675 Ga0495657_0061609 Ga0495657_0061609_783_1316 177
507 3300046675 Ga0495657_0323554 Ga0495657_0323554_247_780 177
508 3300046683 Ga0495658_0173008 Ga0495658_0173008_172_705 177
509 3300046689 Ga0495613_0539447 Ga0495613_0539447_14_547 177
510 3300047317 Ga0495604_0072755 Ga0495604_0072755_1252_1785 177
511 3300047320 Ga0495672_0068822 Ga0495672_0068822_959_1492 177
512 3300047320 Ga0495672_0117197 Ga0495672_0117197_22_555 177
513 3300047322 Ga0495680_0036997 Ga0495680_0036997_1521_2054 177
514 3300047323 Ga0495683_0108972 Ga0495683_0108972_700_1233 177
515 3300047444 Ga0495675_0041019 Ga0495675_0041019_2202_2735 177
516 3300047444 Ga0495675_0058272 Ga0495675_0058272_1536_2069 177
517 3300047471 Ga0495684_0139724 Ga0495684_0139724_741_1274 177
518 3300047471 Ga0495684_0184135 Ga0495684_0184135_331_864 177
519 3300047472 Ga0495686_0274513 Ga0495686_0274513_346_879 177
520 3300047673 Ga0495593_0035371 Ga0495593_0035371_343_876 177
521 3300048088 Ga0495602_0092509 Ga0495602_0092509_1162_1695 177
522 3300048903 Ga0496100_0027698 Ga0496100_0027698_412_945 177
523 3300048904 Ga0496101_0114970 Ga0496101_0114970_910_1443 177
524 3300048905 Ga0496102_0033525 Ga0496102_0033525_250_783 177
525 3300048905 Ga0496102_0099939 Ga0496102_0099939_1764_2297 177
526 3300048907 Ga0496104_0002521 Ga0496104_0002521_6597_7130 177
527 3300048907 Ga0496104_0017958 Ga0496104_0017958_3003_3536 177
528 3300048907 Ga0496104_0050054 Ga0496104_0050054_846_1379 177
529 3300048908 Ga0496105_0006441 Ga0496105_0006441_4556_5089 177
530 3300048908 Ga0496105_0021595 Ga0496105_0021595_4346_4879 177
531 3300048908 Ga0496105_0360202 Ga0496105_0360202_150_683 177
532 3300048910 Ga0496107_0135875 Ga0496107_0135875_815_1348 177
533 3300048910 Ga0496107_0179092 Ga0496107_0179092_898_1431 177
534 3300048911 Ga0496108_0001133 Ga0496108_0001133_6958_7491 177
535 3300048911 Ga0496108_0015644 Ga0496108_0015644_1898_2431 177
536 3300048911 Ga0496108_0027712 Ga0496108_0027712_985_1518 177
537 3300048912 Ga0496109_0000583 Ga0496109_0000583_5371_5904 177
538 3300048912 Ga0496109_0013351 Ga0496109_0013351_5089_5622 177
539 3300048913 Ga0496110_0004757 Ga0496110_0004757_4641_5174 177
540 3300048913 Ga0496110_0013967 Ga0496110_0013967_5616_6149 177
541 3300048913 Ga0496110_0033920 Ga0496110_0033920_573_1106 177
542 3300048914 Ga0496111_0002980 Ga0496111_0002980_7237_7770 177
543 3300048914 Ga0496111_0541575 Ga0496111_0541575_25_558 177
544 3300048915 Ga0496112_0000884 Ga0496112_0000884_20595_21128 177
545 3300048915 Ga0496112_0002152 Ga0496112_0002152_4001_4534 177
546 3300048916 Ga0496113_0000351 Ga0496113_0000351_300_833 177
547 3300048916 Ga0496113_0001829 Ga0496113_0001829_121_654 177
548 3300048916 Ga0496113_0005226 Ga0496113_0005226_1420_1953 177
549 3300048917 Ga0496114_0077198 Ga0496114_0077198_1663_2196 177
550 3300048917 Ga0496114_0139896 Ga0496114_0139896_848_1381 177
551 3300048917 Ga0496114_0313078 Ga0496114_0313078_194_727 177
552 3300048917 Ga0496114_0447658 Ga0496114_0447658_567_1100 177
553 3300048918 Ga0496115_0009751 Ga0496115_0009751_5970_6503 177
554 3300048918 Ga0496115_0129762 Ga0496115_0129762_1023_1556 177
555 3300048918 Ga0496115_0361216 Ga0496115_0361216_56_589 177
556 3300048918 Ga0496115_0520969 Ga0496115_0520969_189_722 177
557 3300048920 Ga0496117_0077019 Ga0496117_0077019_777_1310 177
558 3300048921 Ga0496118_0017136 Ga0496118_0017136_5277_5810 177
559 3300048921 Ga0496118_0040427 Ga0496118_0040427_2064_2597 177
560 3300048921 Ga0496118_0089244 Ga0496118_0089244_395_928 177
561 3300048923 Ga0496120_0155211 Ga0496120_0155211_446_979 177
562 3300048924 Ga0496121_0373689 Ga0496121_0373689_395_928 177
563 3300048925 Ga0496122_0055074 Ga0496122_0055074_1459_1992 177
564 3300048926 Ga0496123_0074841 Ga0496123_0074841_673_1206 177
565 3300048928 Ga0496125_0052234 Ga0496125_0052234_1653_2186 177
566 3300049570 Ga0501033_0224530 Ga0501033_0224530_377_910 177
567 3300049571 Ga0501034_0132045 Ga0501034_0132045_51_584 177
568 3300049571 Ga0501034_0277504 Ga0501034_0277504_684_1217 177
569 3300049571 Ga0501034_0285152 Ga0501034_0285152_621_1154 177
570 3300049572 Ga0501036_0311249 Ga0501036_0311249_202_735 177
571 3300049573 Ga0501037_0069329 Ga0501037_0069329_1941_2474 177
572 3300049579 Ga0501043_0251795 Ga0501043_0251795_677_1210 177
573 3300049581 Ga0501047_0000235 Ga0501047_0000235_56298_56831 177
574 3300049581 Ga0501047_0074415 Ga0501047_0074415_1219_1752 177
575 3300049581 Ga0501047_0466122 Ga0501047_0466122_270_803 177
576 3300049582 Ga0501048_0093362 Ga0501048_0093362_244_777 177
577 3300049586 Ga0501070_0199045 Ga0501070_0199045_412_945 177
578 3300049589 Ga0501073_0494686 Ga0501073_0494686_259_792 177
579 3300049590 Ga0501074_0002757 Ga0501074_0002757_6709_7242 177
580 3300049590 Ga0501074_0338521 Ga0501074_0338521_59_592 177
581 3300049591 Ga0501075_0070033 Ga0501075_0070033_110_643 177
582 3300049592 Ga0501076_0097296 Ga0501076_0097296_810_1343 177
583 3300049592 Ga0501076_0166011 Ga0501076_0166011_1239_1772 177
584 3300049741 Ga0501079_0102385 Ga0501079_0102385_1492_2025 177
585 3300049742 Ga0501080_0013397 Ga0501080_0013397_1610_2143 177
586 3300049742 Ga0501080_0360541 Ga0501080_0360541_113_646 177
587 3300049744 Ga0501083_0004993 Ga0501083_0004993_5380_5913 177
588 3300049822 Ga0501035_0351152 Ga0501035_0351152_61_594 177
589 3300049822 Ga0501035_0985448 Ga0501035_0985448_120_653 177
590 3300049823 Ga0501044_0055624 Ga0501044_0055624_3198_3731 177
591 3300049823 Ga0501044_0061936 Ga0501044_0061936_1180_1713 177
592 3300049823 Ga0501044_0076620 Ga0501044_0076620_884_1417 177
593 3300049823 Ga0501044_0122636 Ga0501044_0122636_1947_2480 177
594 3300049823 Ga0501044_0288837 Ga0501044_0288837_328_861 177
595 3300049824 Ga0501045_0077461 Ga0501045_0077461_509_1042 177
596 3300050489 nmdc:mga03683_382221_c1 nmdc:mga03683_382221_c1_85_618 177
597 3300050493 nmdc:mga0k408_161964_c1 nmdc:mga0k408_161964_c1_150_683 177
598 3300050507 nmdc:mga05p37_193059_c1 nmdc:mga05p37_193059_c1_968_1501 177
599 3300050507 nmdc:mga05p37_208661_c1 nmdc:mga05p37_208661_c1_1425_1958 177
600 3300050507 nmdc:mga05p37_41651_c1 nmdc:mga05p37_41651_c1_4501_5034 177
601 3300050508 nmdc:mga09592_134808_c1 nmdc:mga09592_134808_c1_532_1065 177
602 3300050509 nmdc:mga0qj67_398999_c1 nmdc:mga0qj67_398999_c1_280_813 177
603 3300050510 nmdc:mga06r32_388937_c1 nmdc:mga06r32_388937_c1_258_791 177
604 3300050511 nmdc:mga08y16_96065_c1 nmdc:mga08y16_96065_c1_463_996 177
605 3300050512 nmdc:mga0n895_78493_c1 nmdc:mga0n895_78493_c1_29_562 177
606 3300050513 nmdc:mga0rr50_433776_c1 nmdc:mga0rr50_433776_c1_208_741 177
607 3300050514 nmdc:mga08x19_23_c1 nmdc:mga08x19_23_c1_108755_109288 177
608 3300050515 nmdc:mga0a205_185339_c1 nmdc:mga0a205_185339_c1_1127_1660 177
609 3300053077 Ga0495601_0509942 Ga0495601_0509942_46_579 177
610 3300053078 Ga0495612_0022709 Ga0495612_0022709_1220_1753 177
611 3300053084 Ga0495595_0012728 Ga0495595_0012728_2315_2848 177
612 3300053084 Ga0495595_0017179 Ga0495595_0017179_29_562 177
613 3300053085 Ga0495619_0008778 Ga0495619_0008778_5830_6363 177
614 3300053085 Ga0495619_0097132 Ga0495619_0097132_715_1248 177
615 3300053085 Ga0495619_0115427 Ga0495619_0115427_577_1110 177
616 3300053096 Ga0500641_0007663 Ga0500641_0007663_1791_2324 177
617 3300053117 Ga0500593_000058 Ga0500593_000058_7621_8154 177
618 3300053122 Ga0500608_041046 Ga0500608_041046_1208_1741 177
619 3300053130 Ga0500642_0080296 Ga0500642_0080296_748_1281 177
620 3300053133 Ga0500655_000265 Ga0500655_000265_8504_9037 177
621 3300053139 Ga0500568_0000001 Ga0500568_0000001_8353_8886 177
622 3300053142 Ga0500577_0040810 Ga0500577_0040810_191_724 177
623 3300053142 Ga0500577_0094396 Ga0500577_0094396_246_779 177
624 3300053148 Ga0500590_015132 Ga0500590_015132_2564_3097 177
625 3300053153 Ga0500616_0050068 Ga0500616_0050068_708_1241 177
626 3300053156 Ga0500622_0039247 Ga0500622_0039247_801_1334 177
627 3300053177 Ga0500636_0029625 Ga0500636_0029625_927_1460 177
628 3300054114 Ga0501084_0275420 Ga0501084_0275420_517_1050 177
629 3300059477 Ga0587084_004230 Ga0587084_004230_969_1502 177
630 3300059623 Ga0587101_021594 Ga0587101_021594_256_789 177
631 3300059641 Ga0587068_000630 Ga0587068_000630_339_872 177
632 3300059642 Ga0587069_011022 Ga0587069_011022_194_727 177
633 3300059647 Ga0587079_002261 Ga0587079_002261_37_570 177
634 3300061719 Ga0466962_0043530 Ga0466962_0043530_1275_1808 177
635 3300061719 Ga0466962_0078938 Ga0466962_0078938_251_784 177
636 3300061719 Ga0466962_0248959 Ga0466962_0248959_44_577 177
637 3300061734 Ga0530510_0097213 Ga0530510_0097213_236_769 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

111

186

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v3b-assembly1.cif.gz_G cryo-em structure of the acinetobacter baumannii ribosome: 70s in empty state 0.9647 7 175
6yef-assembly1.cif.gz_H 70s initiation complex with assigned rrna modifications from staphylococcus aureus 0.9643 9 169
5li0-assembly1.cif.gz_H 70s ribosome from staphylococcus aureus 0.9619 9 171
5x8t-assembly1.cif.gz_G structure of the 50s large subunit of chloroplast ribosome from spinach 0.9596 3 174
7nhn-assembly1.cif.gz_K vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9593 9 173
ID Description Score Start End Superfamily
af_Q6AU10_7_103_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9551 85 177 3.90.930.12
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9538 83 167 3.90.930.12
af_O21037_77_170_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9524 83 177 3.90.930.12
af_Q25814_82_167_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9492 83 164 3.90.930.12
4g5lH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9491 83 169 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A2J1D431-F1-model_v4 deleted 0.9914 74 168
AF-Q7Y029-F1-model_v4 Ribosomal protein CtrL6e, 5'-partial 0.987 71 175 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A453I2C9-F1-model_v4 Large ribosomal subunit protein uL6 alpha-beta domain-containing protein 0.9868 66 175 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A5K0W5Y2-F1-model_v4 Large ribosomal subunit protein uL6 alpha-beta domain-containing protein 0.9846 71 175 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A645DGU1-F1-model_v4 50S ribosomal protein L6 0.9835 55 175 GO:0002181
GO:0003735
GO:0019843
GO:0022625

Feature Viewer

pLDDT pTM Quality
81.19 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map