F471447
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 637 | 384 | 614 | 176 |
Family's Representative Sequence
| Representative Sequence | 3300041460|Ga0451802_1450534|Ga0451802_1450534_60_674 |
| Length | 198 |
| Sequence | VPRRVGHGHDELAPAVAPRVGPAPVRTASFSPVNGVFGDVFNYEQTGLTLKFKPIVFPNQDVQVAMDKGAVTVMPRSETKRARAMWGLGRTQVANLMQGVTTGFERKLEINGVGYRAAVQGKNLQLALGYSHDVVFVIPEGIQIVTPKPTEIVINGIDRQKVGQVAAEIRAFRPPEPYKGKGVKYAGEFIFRKEGKKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 2 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 3 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 4 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 5 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 6 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 7 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 8 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 9 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 10 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 11 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 12 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 13 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 14 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 15 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 16 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 17 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 18 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 19 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 20 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 21 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 22 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 23 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 24 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 25 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 26 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 27 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 28 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 29 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 30 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 31 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 32 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 92 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 116 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 135 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 136 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 208 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 211 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 212 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 213 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 215 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 216 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 220 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 221 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 222 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 225 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 228 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 229 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 231 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 239 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 240 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 241 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 244 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 245 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 246 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 247 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 248 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 249 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 250 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 251 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 252 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 253 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 254 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 255 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 256 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 257 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 261 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 262 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 263 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 264 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 265 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 266 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 267 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 268 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 269 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 270 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 271 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 272 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 273 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 274 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 275 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 276 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 277 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 310 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 311 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 312 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 313 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 316 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 317 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 318 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 319 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 320 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 321 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 322 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 323 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 324 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 325 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 326 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 327 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 328 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 350 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 351 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 365 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 366 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 367 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 368 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 369 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 370 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 371 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 372 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 373 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 374 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 375 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 383 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 384 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.29 |
| Metatranscriptomes | 1.1 |
| Isolates | 3.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.28 |
| Nodule | 1.1 |
| Rhizoplane | 5.97 |
| Rhizosphere | 81.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1042367 | 3300001977 | Bacteria | 634 |
| 2 | JGI24740J21852_10076260 | 3300001979 | Bacteria | 887 |
| 3 | JGI24739J22299_10045863 | 3300001989 | Bacteria | 1433 |
| 4 | JGI24743J22301_10003130 | 3300001991 | Bacteria | 2582 |
| 5 | JGI24738J21930_10008307 | 3300002075 | Bacteria | 2364 |
| 6 | JGI24738J21930_10020059 | 3300002075 | Bacteria | 1391 |
| 7 | JGI24749J21850_1000052 | 3300002076 | Bacteria | 22270 |
| 8 | JGI24744J21845_10000585 | 3300002077 | Bacteria | 6547 |
| 9 | JGI24751J29686_10000379 | 3300002459 | Bacteria | 14986 |
| 10 | JGI25151J46595_10000038 | 3300003187 | Bacteria | 180430 |
| 11 | Ga0055542_1002777 | 3300003762 | Bacteria | 5290 |
| 12 | Ga0055526_1012008 | 3300003771 | Bacteria | 3828 |
| 13 | Ga0055524_1006440 | 3300003775 | Bacteria | 5089 |
| 14 | Ga0055534_1028384 | 3300003784 | Bacteria | 877 |
| 15 | Ga0070658_10010598 | 3300005327 | Bacteria | 7384 |
| 16 | Ga0070658_10073690 | 3300005327 | Bacteria | 2800 |
| 17 | Ga0070658_10097669 | 3300005327 | Bacteria | 2425 |
| 18 | Ga0070658_10225012 | 3300005327 | Bacteria | 1587 |
| 19 | Ga0070676_10092152 | 3300005328 | Bacteria | 1858 |
| 20 | Ga0070683_100037799 | 3300005329 | Bacteria | 4420 |
| 21 | Ga0070683_100429364 | 3300005329 | Bacteria | 1261 |
| 22 | Ga0070670_100000093 | 3300005331 | Bacteria | 84800 |
| 23 | Ga0070670_100030580 | 3300005331 | Bacteria | 4636 |
| 24 | Ga0068869_100000029 | 3300005334 | Bacteria | 61111 |
| 25 | Ga0070680_100005733 | 3300005336 | Bacteria | 9421 |
| 26 | Ga0070680_100024886 | 3300005336 | Bacteria | 4784 |
| 27 | Ga0070680_100063787 | 3300005336 | Bacteria | 3018 |
| 28 | Ga0070680_100082947 | 3300005336 | Bacteria | 2647 |
| 29 | Ga0070680_101147667 | 3300005336 | Bacteria | 672 |
| 30 | Ga0068868_100003973 | 3300005338 | Bacteria | 10321 |
| 31 | Ga0070660_100049574 | 3300005339 | Bacteria | 3228 |
| 32 | Ga0070660_100126597 | 3300005339 | Bacteria | 2041 |
| 33 | Ga0070660_100459877 | 3300005339 | Bacteria | 1056 |
| 34 | Ga0070660_100968203 | 3300005339 | Bacteria | 718 |
| 35 | Ga0070661_100069740 | 3300005344 | Bacteria | 2584 |
| 36 | Ga0070668_100010274 | 3300005347 | Bacteria | 6948 |
| 37 | Ga0070668_100205915 | 3300005347 | Bacteria | 1616 |
| 38 | Ga0070669_100000115 | 3300005353 | Bacteria | 75928 |
| 39 | Ga0070675_101754841 | 3300005354 | Bacteria | 573 |
| 40 | Ga0070671_100135894 | 3300005355 | Bacteria | 2073 |
| 41 | Ga0070671_100141969 | 3300005355 | Bacteria | 2026 |
| 42 | Ga0070671_101094875 | 3300005355 | Bacteria | 700 |
| 43 | Ga0070674_100056384 | 3300005356 | Bacteria | 2724 |
| 44 | Ga0070673_100000019 | 3300005364 | Bacteria | 107024 |
| 45 | Ga0070688_100098616 | 3300005365 | Bacteria | 1922 |
| 46 | Ga0070659_100183076 | 3300005366 | Bacteria | 1720 |
| 47 | Ga0070659_101162815 | 3300005366 | Bacteria | 681 |
| 48 | Ga0070667_100000088 | 3300005367 | Bacteria | 113956 |
| 49 | Ga0070667_100013671 | 3300005367 | Bacteria | 6708 |
| 50 | Ga0070709_10048001 | 3300005434 | Bacteria | 2662 |
| 51 | Ga0070714_100448914 | 3300005435 | Bacteria | 1225 |
| 52 | Ga0070714_100511011 | 3300005435 | Bacteria | 1146 |
| 53 | Ga0070713_100017903 | 3300005436 | Bacteria | 5375 |
| 54 | Ga0070713_101125750 | 3300005436 | Bacteria | 759 |
| 55 | Ga0070711_100044999 | 3300005439 | Bacteria | 2999 |
| 56 | Ga0070711_100158971 | 3300005439 | Bacteria | 1711 |
| 57 | Ga0070663_100016226 | 3300005455 | Bacteria | 4830 |
| 58 | Ga0070678_100006601 | 3300005456 | Bacteria | 6820 |
| 59 | Ga0070662_100202310 | 3300005457 | Bacteria | 1577 |
| 60 | Ga0070662_100515479 | 3300005457 | Bacteria | 999 |
| 61 | Ga0070681_10063895 | 3300005458 | Bacteria | 3653 |
| 62 | Ga0070681_10128718 | 3300005458 | Bacteria | 2464 |
| 63 | Ga0070681_10400379 | 3300005458 | Bacteria | 1284 |
| 64 | Ga0070681_10485858 | 3300005458 | Bacteria | 1148 |
| 65 | Ga0070681_10952663 | 3300005458 | Bacteria | 777 |
| 66 | Ga0068867_100000014 | 3300005459 | Bacteria | 112097 |
| 67 | Ga0068867_100772215 | 3300005459 | Bacteria | 854 |
| 68 | Ga0070685_10681786 | 3300005466 | Bacteria | 748 |
| 69 | Ga0070679_100068171 | 3300005530 | Bacteria | 3549 |
| 70 | Ga0070679_100083578 | 3300005530 | Bacteria | 3181 |
| 71 | Ga0070679_100200073 | 3300005530 | Bacteria | 1964 |
| 72 | Ga0070679_100242821 | 3300005530 | Bacteria | 1758 |
| 73 | Ga0070679_100366118 | 3300005530 | Bacteria | 1389 |
| 74 | Ga0070679_100696567 | 3300005530 | Bacteria | 959 |
| 75 | Ga0070679_101099268 | 3300005530 | Bacteria | 740 |
| 76 | Ga0070684_100431540 | 3300005535 | Bacteria | 1217 |
| 77 | Ga0070697_100005582 | 3300005536 | Bacteria | 9698 |
| 78 | Ga0068853_100892512 | 3300005539 | Bacteria | 853 |
| 79 | Ga0070672_101170263 | 3300005543 | Bacteria | 684 |
| 80 | Ga0070695_100007388 | 3300005545 | Bacteria | 6517 |
| 81 | Ga0070693_100171905 | 3300005547 | Bacteria | 1389 |
| 82 | Ga0070693_100272386 | 3300005547 | Bacteria | 1130 |
| 83 | Ga0070665_100255950 | 3300005548 | Bacteria | 1752 |
| 84 | Ga0070704_100880415 | 3300005549 | Bacteria | 804 |
| 85 | Ga0068855_100027910 | 3300005563 | Bacteria | 6751 |
| 86 | Ga0068855_100447267 | 3300005563 | Bacteria | 1410 |
| 87 | Ga0068855_100810457 | 3300005563 | Bacteria | 994 |
| 88 | Ga0068855_100913885 | 3300005563 | Bacteria | 926 |
| 89 | Ga0070664_100122298 | 3300005564 | Bacteria | 2280 |
| 90 | Ga0068857_100066375 | 3300005577 | Bacteria | 3210 |
| 91 | Ga0068857_100324060 | 3300005577 | Bacteria | 1423 |
| 92 | Ga0068857_100885056 | 3300005577 | Bacteria | 856 |
| 93 | Ga0068857_101070198 | 3300005577 | Bacteria | 778 |
| 94 | Ga0068854_100449464 | 3300005578 | Bacteria | 1076 |
| 95 | Ga0068856_100060779 | 3300005614 | Bacteria | 3732 |
| 96 | Ga0068856_100484785 | 3300005614 | Bacteria | 1257 |
| 97 | Ga0068852_100166080 | 3300005616 | Bacteria | 2065 |
| 98 | Ga0068852_100247205 | 3300005616 | Bacteria | 1707 |
| 99 | Ga0068852_100383315 | 3300005616 | Bacteria | 1379 |
| 100 | Ga0068852_101768801 | 3300005616 | Bacteria | 640 |
| 101 | Ga0068859_100009835 | 3300005617 | Bacteria | 9655 |
| 102 | Ga0068859_100096701 | 3300005617 | Bacteria | 3005 |
| 103 | Ga0068864_100000087 | 3300005618 | Bacteria | 98532 |
| 104 | Ga0068864_100754039 | 3300005618 | Bacteria | 954 |
| 105 | Ga0068861_100006640 | 3300005719 | Bacteria | 7896 |
| 106 | Ga0068851_10070267 | 3300005834 | Bacteria | 1810 |
| 107 | Ga0068863_100008669 | 3300005841 | Bacteria | 9938 |
| 108 | Ga0068860_100000220 | 3300005843 | Bacteria | 89460 |
| 109 | Ga0068860_101008131 | 3300005843 | Bacteria | 851 |
| 110 | Ga0068862_100000466 | 3300005844 | Bacteria | 43651 |
| 111 | Ga0068862_100122633 | 3300005844 | Bacteria | 2292 |
| 112 | Ga0081455_10004023 | 3300005937 | Bacteria | 16663 |
| 113 | Ga0081455_10020755 | 3300005937 | Bacteria | 6176 |
| 114 | Ga0081455_10041960 | 3300005937 | Bacteria | 4019 |
| 115 | Ga0081540_1006488 | 3300005983 | Bacteria | 8508 |
| 116 | Ga0081540_1051990 | 3300005983 | Bacteria | 2021 |
| 117 | Ga0081539_10057536 | 3300005985 | Bacteria | 2150 |
| 118 | Ga0075365_10164955 | 3300006038 | Bacteria | 1545 |
| 119 | Ga0075365_10448116 | 3300006038 | Bacteria | 911 |
| 120 | Ga0075365_10596615 | 3300006038 | Bacteria | 781 |
| 121 | Ga0070712_100040629 | 3300006175 | Bacteria | 3190 |
| 122 | Ga0075369_10014440 | 3300006186 | Bacteria | 3154 |
| 123 | Ga0075366_10011613 | 3300006195 | Bacteria | 4976 |
| 124 | Ga0075366_10181683 | 3300006195 | Bacteria | 1278 |
| 125 | Ga0075366_10794142 | 3300006195 | Bacteria | 589 |
| 126 | Ga0097621_100377578 | 3300006237 | Bacteria | 1265 |
| 127 | Ga0075370_10211943 | 3300006353 | Bacteria | 1144 |
| 128 | Ga0068871_100041983 | 3300006358 | Bacteria | 3669 |
| 129 | Ga0075431_100013939 | 3300006847 | Bacteria | 8119 |
| 130 | Ga0075433_10327457 | 3300006852 | Bacteria | 1355 |
| 131 | Ga0075434_100185510 | 3300006871 | Bacteria | 2101 |
| 132 | Ga0068865_100030870 | 3300006881 | Bacteria | 3568 |
| 133 | Ga0075436_100014756 | 3300006914 | Bacteria | 5354 |
| 134 | Ga0097620_100009835 | 3300006931 | Bacteria | 9655 |
| 135 | Ga0097620_100096701 | 3300006931 | Bacteria | 3005 |
| 136 | Ga0075435_100026460 | 3300007076 | Bacteria | 4526 |
| 137 | Ga0075435_100388871 | 3300007076 | Bacteria | 1199 |
| 138 | Ga0099795_10001948 | 3300007788 | Bacteria | 4692 |
| 139 | Ga0105240_10015848 | 3300009093 | Bacteria | 10226 |
| 140 | Ga0105240_10038434 | 3300009093 | Bacteria | 6139 |
| 141 | Ga0105240_10337173 | 3300009093 | Bacteria | 1714 |
| 142 | Ga0111539_10163484 | 3300009094 | Bacteria | 2603 |
| 143 | Ga0111539_10483254 | 3300009094 | Bacteria | 1442 |
| 144 | Ga0105245_10005275 | 3300009098 | Bacteria | 11352 |
| 145 | Ga0105247_10804080 | 3300009101 | Bacteria | 718 |
| 146 | Ga0114129_10001848 | 3300009147 | Bacteria | 28835 |
| 147 | Ga0114129_10227354 | 3300009147 | Bacteria | 2514 |
| 148 | Ga0114129_11835813 | 3300009147 | Bacteria | 736 |
| 149 | Ga0105243_10000076 | 3300009148 | Bacteria | 110445 |
| 150 | Ga0105243_10245578 | 3300009148 | Bacteria | 1595 |
| 151 | Ga0105243_10477166 | 3300009148 | Bacteria | 1176 |
| 152 | Ga0105242_10009804 | 3300009176 | Bacteria | 7341 |
| 153 | Ga0105248_10003987 | 3300009177 | Bacteria | 16323 |
| 154 | Ga0105248_10008689 | 3300009177 | Bacteria | 11162 |
| 155 | Ga0105237_10045964 | 3300009545 | Bacteria | 4393 |
| 156 | Ga0105237_10268995 | 3300009545 | Bacteria | 1707 |
| 157 | Ga0105237_10553704 | 3300009545 | Bacteria | 1157 |
| 158 | Ga0105238_10084340 | 3300009551 | Bacteria | 3167 |
| 159 | Ga0105238_10164963 | 3300009551 | Bacteria | 2190 |
| 160 | Ga0105238_10226631 | 3300009551 | Bacteria | 1845 |
| 161 | Ga0105238_10271223 | 3300009551 | Bacteria | 1677 |
| 162 | Ga0105238_11105398 | 3300009551 | Bacteria | 815 |
| 163 | Ga0105249_10020004 | 3300009553 | Bacteria | 5978 |
| 164 | Ga0105249_10123325 | 3300009553 | Bacteria | 2465 |
| 165 | Ga0105148_100340 | 3300009978 | Bacteria | 5674 |
| 166 | Ga0099796_10009160 | 3300010159 | Bacteria | 2669 |
| 167 | Ga0105239_10343307 | 3300010375 | Bacteria | 1685 |
| 168 | Ga0105239_10557218 | 3300010375 | Bacteria | 1306 |
| 169 | Ga0105239_11006974 | 3300010375 | Bacteria | 958 |
| 170 | Ga0105246_10052677 | 3300011119 | Bacteria | 2798 |
| 171 | Ga0157326_1000064 | 3300012513 | Bacteria | 10255 |
| 172 | Ga0157373_10069320 | 3300013100 | Bacteria | 2493 |
| 173 | Ga0157373_10147610 | 3300013100 | Bacteria | 1654 |
| 174 | Ga0157373_10159167 | 3300013100 | Bacteria | 1589 |
| 175 | Ga0157373_10737579 | 3300013100 | Bacteria | 723 |
| 176 | Ga0157371_10042695 | 3300013102 | Bacteria | 3232 |
| 177 | Ga0157371_10206362 | 3300013102 | Bacteria | 1409 |
| 178 | Ga0157371_10659969 | 3300013102 | Bacteria | 781 |
| 179 | Ga0157371_10886225 | 3300013102 | Bacteria | 676 |
| 180 | Ga0157370_10011636 | 3300013104 | Bacteria | 9184 |
| 181 | Ga0157370_10108530 | 3300013104 | Bacteria | 2595 |
| 182 | Ga0157370_10494637 | 3300013104 | Bacteria | 1123 |
| 183 | Ga0157370_10776460 | 3300013104 | Bacteria | 872 |
| 184 | Ga0157370_11330686 | 3300013104 | Bacteria | 647 |
| 185 | Ga0157369_10077891 | 3300013105 | Bacteria | 3553 |
| 186 | Ga0157369_10129027 | 3300013105 | Bacteria | 2680 |
| 187 | Ga0157369_10337199 | 3300013105 | Bacteria | 1566 |
| 188 | Ga0157369_10444632 | 3300013105 | Bacteria | 1342 |
| 189 | Ga0157374_10044615 | 3300013296 | Bacteria | 4098 |
| 190 | Ga0157374_10094106 | 3300013296 | Bacteria | 2863 |
| 191 | Ga0157378_10000504 | 3300013297 | Bacteria | 37070 |
| 192 | Ga0163162_10504833 | 3300013306 | Bacteria | 1340 |
| 193 | Ga0157372_10234957 | 3300013307 | Bacteria | 2126 |
| 194 | Ga0157372_10519019 | 3300013307 | Bacteria | 1389 |
| 195 | Ga0157372_11075511 | 3300013307 | Bacteria | 931 |
| 196 | Ga0163163_10002310 | 3300014325 | Bacteria | 16099 |
| 197 | Ga0163163_10024251 | 3300014325 | Bacteria | 5772 |
| 198 | Ga0163163_10204491 | 3300014325 | Bacteria | 2023 |
| 199 | Ga0157380_10000157 | 3300014326 | Bacteria | 39384 |
| 200 | Ga0157380_10410045 | 3300014326 | Bacteria | 1288 |
| 201 | Ga0157377_10145480 | 3300014745 | Bacteria | 1460 |
| 202 | Ga0157379_10446478 | 3300014968 | Bacteria | 1193 |
| 203 | Ga0157376_10000092 | 3300014969 | Bacteria | 68198 |
| 204 | Ga0163161_10189654 | 3300017792 | Bacteria | 1580 |
| 205 | Ga0213876_10013852 | 3300021384 | Bacteria | 4274 |
| 206 | Ga0213875_10241366 | 3300021388 | Bacteria | 852 |
| 207 | Ga0207427_104233 | 3300025231 | Bacteria | 2514 |
| 208 | Ga0209437_109865 | 3300025233 | Bacteria | 1476 |
| 209 | Ga0209026_1000352 | 3300025250 | Bacteria | 43432 |
| 210 | Ga0209148_1004350 | 3300025254 | Bacteria | 3516 |
| 211 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 212 | Ga0209233_1003903 | 3300025261 | Bacteria | 5177 |
| 213 | Ga0209455_1002555 | 3300025272 | Bacteria | 6959 |
| 214 | Ga0209673_1037691 | 3300025273 | Bacteria | 1417 |
| 215 | Ga0209675_1002527 | 3300025291 | Bacteria | 9311 |
| 216 | Ga0209676_1028639 | 3300025292 | Bacteria | 1730 |
| 217 | Ga0209025_1000014 | 3300025294 | Bacteria | 865448 |
| 218 | Ga0209025_1065919 | 3300025294 | Bacteria | 1319 |
| 219 | Ga0209564_1002872 | 3300025295 | Bacteria | 12632 |
| 220 | Ga0209256_1000108 | 3300025299 | Bacteria | 185884 |
| 221 | Ga0207656_10023826 | 3300025321 | Bacteria | 2469 |
| 222 | Ga0207688_10030543 | 3300025901 | Bacteria | 2972 |
| 223 | Ga0207647_10389004 | 3300025904 | Bacteria | 787 |
| 224 | Ga0207699_10302236 | 3300025906 | Bacteria | 1118 |
| 225 | Ga0207645_10028915 | 3300025907 | Bacteria | 3575 |
| 226 | Ga0207643_10207188 | 3300025908 | Bacteria | 1196 |
| 227 | Ga0207705_10000243 | 3300025909 | Bacteria | 53479 |
| 228 | Ga0207705_10002954 | 3300025909 | Bacteria | 12998 |
| 229 | Ga0207705_10005544 | 3300025909 | Bacteria | 9436 |
| 230 | Ga0207705_10040855 | 3300025909 | Bacteria | 3327 |
| 231 | Ga0207705_10752239 | 3300025909 | Bacteria | 757 |
| 232 | Ga0207654_10135541 | 3300025911 | Bacteria | 1563 |
| 233 | Ga0207707_10009792 | 3300025912 | Bacteria | 8311 |
| 234 | Ga0207707_10073118 | 3300025912 | Bacteria | 2989 |
| 235 | Ga0207707_10261591 | 3300025912 | Bacteria | 1501 |
| 236 | Ga0207707_10452187 | 3300025912 | Bacteria | 1099 |
| 237 | Ga0207695_10012684 | 3300025913 | Bacteria | 10093 |
| 238 | Ga0207695_10159517 | 3300025913 | Bacteria | 2188 |
| 239 | Ga0207671_10068421 | 3300025914 | Bacteria | 2646 |
| 240 | Ga0207671_10342326 | 3300025914 | Bacteria | 1185 |
| 241 | Ga0207693_10004752 | 3300025915 | Bacteria | 11421 |
| 242 | Ga0207693_10338978 | 3300025915 | Bacteria | 1177 |
| 243 | Ga0207660_10033759 | 3300025917 | Bacteria | 3542 |
| 244 | Ga0207660_10073946 | 3300025917 | Bacteria | 2486 |
| 245 | Ga0207660_10109315 | 3300025917 | Bacteria | 2078 |
| 246 | Ga0207660_10234972 | 3300025917 | Bacteria | 1442 |
| 247 | Ga0207660_10238397 | 3300025917 | Bacteria | 1432 |
| 248 | Ga0207660_10266788 | 3300025917 | Bacteria | 1355 |
| 249 | Ga0207657_10039829 | 3300025919 | Bacteria | 4171 |
| 250 | Ga0207657_10057078 | 3300025919 | Bacteria | 3366 |
| 251 | Ga0207657_10098911 | 3300025919 | Bacteria | 2424 |
| 252 | Ga0207657_10441080 | 3300025919 | Bacteria | 1022 |
| 253 | Ga0207649_10670647 | 3300025920 | Bacteria | 802 |
| 254 | Ga0207652_10022634 | 3300025921 | Bacteria | 5201 |
| 255 | Ga0207652_10237592 | 3300025921 | Bacteria | 1642 |
| 256 | Ga0207652_10259630 | 3300025921 | Bacteria | 1567 |
| 257 | Ga0207652_10266174 | 3300025921 | Bacteria | 1546 |
| 258 | Ga0207652_10414093 | 3300025921 | Bacteria | 1216 |
| 259 | Ga0207681_10000005 | 3300025923 | Bacteria | 555724 |
| 260 | Ga0207681_10138373 | 3300025923 | Bacteria | 1810 |
| 261 | Ga0207694_10010694 | 3300025924 | Bacteria | 6927 |
| 262 | Ga0207694_10161581 | 3300025924 | Bacteria | 1809 |
| 263 | Ga0207694_10231602 | 3300025924 | Bacteria | 1509 |
| 264 | Ga0207694_10258839 | 3300025924 | Bacteria | 1425 |
| 265 | Ga0207650_10000004 | 3300025925 | Bacteria | 743372 |
| 266 | Ga0207650_10014747 | 3300025925 | Bacteria | 5433 |
| 267 | Ga0207659_10009064 | 3300025926 | Bacteria | 6208 |
| 268 | Ga0207687_10079745 | 3300025927 | Bacteria | 2361 |
| 269 | Ga0207700_10110657 | 3300025928 | Bacteria | 2209 |
| 270 | Ga0207664_10006275 | 3300025929 | Bacteria | 8170 |
| 271 | Ga0207664_10033079 | 3300025929 | Bacteria | 3969 |
| 272 | Ga0207644_10082298 | 3300025931 | Bacteria | 2381 |
| 273 | Ga0207644_10176989 | 3300025931 | Bacteria | 1669 |
| 274 | Ga0207644_10370336 | 3300025931 | Bacteria | 1167 |
| 275 | Ga0207644_10994302 | 3300025931 | Bacteria | 704 |
| 276 | Ga0207690_10675799 | 3300025932 | Bacteria | 848 |
| 277 | Ga0207706_10041508 | 3300025933 | Bacteria | 4079 |
| 278 | Ga0207706_10543457 | 3300025933 | Bacteria | 1001 |
| 279 | Ga0207686_10004287 | 3300025934 | Bacteria | 7648 |
| 280 | Ga0207709_10000114 | 3300025935 | Bacteria | 124672 |
| 281 | Ga0207709_10341562 | 3300025935 | Bacteria | 1127 |
| 282 | Ga0207709_10360916 | 3300025935 | Bacteria | 1100 |
| 283 | Ga0207669_10017734 | 3300025937 | Bacteria | 3660 |
| 284 | Ga0207669_10278908 | 3300025937 | Bacteria | 1259 |
| 285 | Ga0207704_10000008 | 3300025938 | Bacteria | 204682 |
| 286 | Ga0207665_10140403 | 3300025939 | Bacteria | 1722 |
| 287 | Ga0207691_10130675 | 3300025940 | Bacteria | 2219 |
| 288 | Ga0207711_10001472 | 3300025941 | Bacteria | 21955 |
| 289 | Ga0207711_10221727 | 3300025941 | Bacteria | 1730 |
| 290 | Ga0207711_10492350 | 3300025941 | Bacteria | 1142 |
| 291 | Ga0207689_10000608 | 3300025942 | Bacteria | 34222 |
| 292 | Ga0207661_10038656 | 3300025944 | Bacteria | 3742 |
| 293 | Ga0207679_10095607 | 3300025945 | Bacteria | 2310 |
| 294 | Ga0207679_10098523 | 3300025945 | Bacteria | 2280 |
| 295 | Ga0207667_10004001 | 3300025949 | Bacteria | 18104 |
| 296 | Ga0207667_10033512 | 3300025949 | Bacteria | 5521 |
| 297 | Ga0207651_10000008 | 3300025960 | Bacteria | 204538 |
| 298 | Ga0207712_10077729 | 3300025961 | Bacteria | 2406 |
| 299 | Ga0207712_10346030 | 3300025961 | Bacteria | 1234 |
| 300 | Ga0207712_10868134 | 3300025961 | Bacteria | 796 |
| 301 | Ga0207640_10026471 | 3300025981 | Bacteria | 3522 |
| 302 | Ga0207640_10338594 | 3300025981 | Bacteria | 1204 |
| 303 | Ga0207658_10000064 | 3300025986 | Bacteria | 117779 |
| 304 | Ga0207658_10009141 | 3300025986 | Bacteria | 6722 |
| 305 | Ga0207677_10000091 | 3300026023 | Bacteria | 74163 |
| 306 | Ga0207703_10890785 | 3300026035 | Bacteria | 852 |
| 307 | Ga0207639_10491719 | 3300026041 | Bacteria | 1120 |
| 308 | Ga0207639_11053564 | 3300026041 | Bacteria | 762 |
| 309 | Ga0207678_10045992 | 3300026067 | Bacteria | 3774 |
| 310 | Ga0207702_10006302 | 3300026078 | Bacteria | 10251 |
| 311 | Ga0207702_10247187 | 3300026078 | Bacteria | 1674 |
| 312 | Ga0207702_10967111 | 3300026078 | Bacteria | 844 |
| 313 | Ga0207641_10003244 | 3300026088 | Bacteria | 14521 |
| 314 | Ga0207648_10000009 | 3300026089 | Bacteria | 204229 |
| 315 | Ga0207676_10000006 | 3300026095 | Bacteria | 681936 |
| 316 | Ga0207674_10066644 | 3300026116 | Bacteria | 3626 |
| 317 | Ga0207674_10071868 | 3300026116 | Bacteria | 3476 |
| 318 | Ga0207674_10373507 | 3300026116 | Bacteria | 1378 |
| 319 | Ga0207674_10404168 | 3300026116 | Bacteria | 1320 |
| 320 | Ga0207675_100001117 | 3300026118 | Bacteria | 26571 |
| 321 | Ga0207683_10006500 | 3300026121 | Bacteria | 10001 |
| 322 | Ga0207698_10230088 | 3300026142 | Bacteria | 1682 |
| 323 | Ga0207698_10525453 | 3300026142 | Bacteria | 1156 |
| 324 | Ga0207698_10833795 | 3300026142 | Bacteria | 926 |
| 325 | Ga0209179_1109151 | 3300027512 | Bacteria | 617 |
| 326 | Ga0268266_10400280 | 3300028379 | Bacteria | 1298 |
| 327 | Ga0268266_10534549 | 3300028379 | Bacteria | 1122 |
| 328 | Ga0268266_10624098 | 3300028379 | Bacteria | 1036 |
| 329 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 330 | Ga0268265_10058458 | 3300028380 | Bacteria | 2944 |
| 331 | Ga0268265_10941727 | 3300028380 | Bacteria | 850 |
| 332 | Ga0268264_10000277 | 3300028381 | Bacteria | 86740 |
| 333 | Ga0265337_1007309 | 3300028556 | Bacteria | 4141 |
| 334 | Ga0265336_10052787 | 3300028666 | Bacteria | 1226 |
| 335 | Ga0307515_10099360 | 3300028794 | Bacteria | 3534 |
| 336 | Ga0265338_10169152 | 3300028800 | Bacteria | 1678 |
| 337 | Ga0265338_10534408 | 3300028800 | Bacteria | 822 |
| 338 | Ga0265332_10081675 | 3300031238 | Bacteria | 1371 |
| 339 | Ga0265325_10003961 | 3300031241 | Bacteria | 9475 |
| 340 | Ga0265325_10007856 | 3300031241 | Bacteria | 6350 |
| 341 | Ga0265325_10075997 | 3300031241 | Bacteria | 1677 |
| 342 | Ga0265340_10167086 | 3300031247 | Bacteria | 997 |
| 343 | Ga0265339_10001408 | 3300031249 | Bacteria | 17842 |
| 344 | Ga0265339_10052488 | 3300031249 | Bacteria | 2220 |
| 345 | Ga0265331_10014930 | 3300031250 | Bacteria | 4119 |
| 346 | Ga0265331_10235677 | 3300031250 | Bacteria | 822 |
| 347 | Ga0265327_10072293 | 3300031251 | Bacteria | 1722 |
| 348 | Ga0265316_10050124 | 3300031344 | Bacteria | 3285 |
| 349 | Ga0265316_10091372 | 3300031344 | Bacteria | 2322 |
| 350 | Ga0265313_10001884 | 3300031595 | Bacteria | 19075 |
| 351 | Ga0265313_10009717 | 3300031595 | Bacteria | 6202 |
| 352 | Ga0265313_10041399 | 3300031595 | Bacteria | 2270 |
| 353 | Ga0265314_10235211 | 3300031711 | Bacteria | 1060 |
| 354 | Ga0265342_10000677 | 3300031712 | Bacteria | 35579 |
| 355 | Ga0265342_10085476 | 3300031712 | Bacteria | 1815 |
| 356 | Ga0265342_10087093 | 3300031712 | Bacteria | 1795 |
| 357 | Ga0307406_10090266 | 3300031901 | Bacteria | 2061 |
| 358 | Ga0307409_100481191 | 3300031995 | Bacteria | 1205 |
| 359 | Ga0307409_100533681 | 3300031995 | Bacteria | 1149 |
| 360 | Ga0373926_0054062 | 3300035083 | Bacteria | 1454 |
| 361 | Ga0373934_0008632 | 3300035086 | Bacteria | 3800 |
| 362 | Ga0373944_0006361 | 3300035089 | Bacteria | 3134 |
| 363 | Ga0373952_0069892 | 3300035092 | Bacteria | 876 |
| 364 | Ga0373923_0028731 | 3300035111 | Bacteria | 2226 |
| 365 | Ga0373941_0182888 | 3300035115 | Bacteria | 788 |
| 366 | Ga0373953_0031007 | 3300035117 | Bacteria | 2077 |
| 367 | Ga0373954_0082396 | 3300035118 | Bacteria | 1538 |
| 368 | Ga0373954_0464403 | 3300035118 | Bacteria | 627 |
| 369 | Ga0373956_0125127 | 3300035119 | Bacteria | 1202 |
| 370 | Ga0373957_0034795 | 3300035120 | Bacteria | 1868 |
| 371 | Ga0373957_0167166 | 3300035120 | Bacteria | 908 |
| 372 | Ga0373943_0147879 | 3300035170 | Bacteria | 1271 |
| 373 | Ga0373943_0204756 | 3300035170 | Bacteria | 1093 |
| 374 | Ga0373946_0029660 | 3300035171 | Bacteria | 2179 |
| 375 | Ga0373946_0126645 | 3300035171 | Bacteria | 1171 |
| 376 | Ga0373946_0278477 | 3300035171 | Bacteria | 822 |
| 377 | Ga0373955_0001179 | 3300035172 | Bacteria | 11123 |
| 378 | Ga0373955_0754659 | 3300035172 | Bacteria | 598 |
| 379 | Ga0373961_0288663 | 3300035241 | Bacteria | 604 |
| 380 | Ga0373924_0029520 | 3300035410 | Bacteria | 2192 |
| 381 | Ga0373931_0183942 | 3300035691 | Bacteria | 1239 |
| 382 | Ga0373935_0117540 | 3300035692 | Bacteria | 1772 |
| 383 | Ga0373935_0154285 | 3300035692 | Bacteria | 1561 |
| 384 | Ga0373935_0197109 | 3300035692 | Bacteria | 1390 |
| 385 | Ga0373935_0312809 | 3300035692 | Bacteria | 1113 |
| 386 | Ga0373927_0041187 | 3300035695 | Bacteria | 2996 |
| 387 | Ga0373927_0056189 | 3300035695 | Bacteria | 2544 |
| 388 | Ga0373927_0106806 | 3300035695 | Bacteria | 1823 |
| 389 | Ga0373933_0183204 | 3300035724 | Bacteria | 1336 |
| 390 | Ga0373933_0390031 | 3300035724 | Bacteria | 907 |
| 391 | Ga0373947_0058372 | 3300035725 | Bacteria | 2338 |
| 392 | Ga0373947_0085267 | 3300035725 | Bacteria | 1961 |
| 393 | Ga0373947_0188861 | 3300035725 | Bacteria | 1344 |
| 394 | Ga0373937_0021580 | 3300036401 | Bacteria | 5778 |
| 395 | Ga0373937_0040264 | 3300036401 | Bacteria | 4259 |
| 396 | Ga0373925_0047403 | 3300037068 | Bacteria | 3198 |
| 397 | Ga0373925_0502642 | 3300037068 | Bacteria | 995 |
| 398 | Ga0373925_0630749 | 3300037068 | Bacteria | 883 |
| 399 | Ga0373925_1267021 | 3300037068 | Bacteria | 605 |
| 400 | Ga0395899_0000406 | 3300037312 | Bacteria | 50248 |
| 401 | Ga0395899_0066694 | 3300037312 | Bacteria | 2642 |
| 402 | Ga0395900_0021199 | 3300037418 | Bacteria | 6643 |
| 403 | Ga0395900_0056306 | 3300037418 | Bacteria | 4047 |
| 404 | Ga0395900_0506830 | 3300037418 | Bacteria | 1156 |
| 405 | Ga0395898_0126504 | 3300037466 | Bacteria | 2448 |
| 406 | Ga0395898_0137366 | 3300037466 | Bacteria | 2341 |
| 407 | Ga0395898_0222452 | 3300037466 | Bacteria | 1800 |
| 408 | Ga0395898_1034210 | 3300037466 | Bacteria | 756 |
| 409 | Ga0395905_0985174 | 3300037471 | Bacteria | 746 |
| 410 | Ga0436364_0163040 | 3300037853 | Bacteria | 974 |
| 411 | Ga0436364_0471401 | 3300037853 | Bacteria | 1568 |
| 412 | Ga0395901_0097542 | 3300038443 | Bacteria | 3081 |
| 413 | Ga0395901_0177540 | 3300038443 | Bacteria | 2233 |
| 414 | Ga0395901_0978377 | 3300038443 | Bacteria | 823 |
| 415 | Ga0400490_23185 | 3300038726 | Bacteria | 1324 |
| 416 | Ga0400486_03338 | 3300038742 | Bacteria | 1064 |
| 417 | Ga0400486_26153 | 3300038742 | Bacteria | 1558 |
| 418 | Ga0436365_0802220 | 3300039437 | Bacteria | 2105 |
| 419 | Ga0436365_1609996 | 3300039437 | Bacteria | 6251 |
| 420 | Ga0436360_0447412 | 3300039438 | Bacteria | 1080 |
| 421 | Ga0436360_0537617 | 3300039438 | Bacteria | 7493 |
| 422 | Ga0436361_0327700 | 3300039447 | Bacteria | 2324 |
| 423 | Ga0436363_1571548 | 3300039450 | Bacteria | 7951 |
| 424 | Ga0436363_1616367 | 3300039450 | Bacteria | 1341 |
| 425 | Ga0436362_0662105 | 3300039453 | Bacteria | 1089 |
| 426 | Ga0436362_0857492 | 3300039453 | Bacteria | 729 |
| 427 | Ga0439466_0074454 | 3300041411 | Bacteria | 1077 |
| 428 | Ga0451802_1450534 | 3300041460 | Bacteria | 714 |
| 429 | Ga0451806_367681 | 3300041462 | Bacteria | 2560 |
| 430 | Ga0451807_1991054 | 3300041486 | Bacteria | 1946 |
| 431 | Ga0451853_0019999 | 3300041512 | Bacteria | 801 |
| 432 | Ga0439432_096371 | 3300042006 | Bacteria | 887 |
| 433 | Ga0439455_0006431 | 3300042012 | Bacteria | 2438 |
| 434 | Ga0439458_0004227 | 3300042157 | Bacteria | 3315 |
| 435 | Ga0439434_0017101 | 3300042435 | Bacteria | 2169 |
| 436 | Ga0466969_0095238 | 3300044656 | Bacteria | 1407 |
| 437 | Ga0466972_0022049 | 3300044658 | Bacteria | 3171 |
| 438 | Ga0466965_0245619 | 3300044683 | Bacteria | 959 |
| 439 | Ga0466966_0032002 | 3300044684 | Bacteria | 3411 |
| 440 | Ga0466966_0175993 | 3300044684 | Bacteria | 1299 |
| 441 | Ga0466961_0078638 | 3300044693 | Bacteria | 2089 |
| 442 | Ga0466961_0116483 | 3300044693 | Bacteria | 1679 |
| 443 | Ga0466963_0015793 | 3300044694 | Bacteria | 4685 |
| 444 | Ga0466963_0021397 | 3300044694 | Bacteria | 4080 |
| 445 | Ga0466964_0045974 | 3300044706 | Bacteria | 1778 |
| 446 | Ga0466971_0204777 | 3300044719 | Bacteria | 932 |
| 447 | Ga0466957_0059645 | 3300044842 | Bacteria | 2339 |
| 448 | Ga0466957_0090325 | 3300044842 | Bacteria | 1918 |
| 449 | Ga0466957_0133264 | 3300044842 | Bacteria | 1594 |
| 450 | Ga0466957_0213535 | 3300044842 | Bacteria | 1271 |
| 451 | Ga0466960_0025122 | 3300044901 | Bacteria | 2693 |
| 452 | Ga0466959_0030393 | 3300045049 | Bacteria | 3999 |
| 453 | Ga0466959_0123080 | 3300045049 | Bacteria | 1842 |
| 454 | Ga0466959_0131651 | 3300045049 | Bacteria | 1772 |
| 455 | Ga0466958_0159500 | 3300045836 | Bacteria | 1424 |
| 456 | Ga0495603_0346918 | 3300046455 | Bacteria | 852 |
| 457 | Ga0495629_0453662 | 3300046459 | Bacteria | 868 |
| 458 | Ga0495651_0123417 | 3300046462 | Bacteria | 1900 |
| 459 | Ga0495664_0221638 | 3300046477 | Bacteria | 1145 |
| 460 | Ga0495594_0339772 | 3300046499 | Bacteria | 855 |
| 461 | Ga0495596_0280689 | 3300046500 | Bacteria | 647 |
| 462 | Ga0495610_0018183 | 3300046512 | Bacteria | 3978 |
| 463 | Ga0495637_0020520 | 3300046520 | Bacteria | 3041 |
| 464 | Ga0495652_0178964 | 3300046529 | Bacteria | 1630 |
| 465 | Ga0495640_0284484 | 3300046533 | Bacteria | 1029 |
| 466 | Ga0495587_0067952 | 3300046536 | Bacteria | 2077 |
| 467 | Ga0495667_0062276 | 3300046559 | Bacteria | 2445 |
| 468 | Ga0495667_0111752 | 3300046559 | Bacteria | 1765 |
| 469 | Ga0495667_0494739 | 3300046559 | Bacteria | 766 |
| 470 | Ga0495634_0076021 | 3300046642 | Bacteria | 2205 |
| 471 | Ga0495611_0020624 | 3300046648 | Bacteria | 2838 |
| 472 | Ga0495625_0237448 | 3300046660 | Bacteria | 1188 |
| 473 | Ga0495635_0060092 | 3300046663 | Bacteria | 2613 |
| 474 | Ga0495635_0404725 | 3300046663 | Bacteria | 906 |
| 475 | Ga0495657_0061609 | 3300046675 | Bacteria | 2481 |
| 476 | Ga0495657_0323554 | 3300046675 | Bacteria | 916 |
| 477 | Ga0495658_0173008 | 3300046683 | Bacteria | 1337 |
| 478 | Ga0495613_0539447 | 3300046689 | Bacteria | 782 |
| 479 | Ga0495624_0523343 | 3300046690 | Bacteria | 709 |
| 480 | Ga0495581_0062181 | 3300047315 | Bacteria | 2157 |
| 481 | Ga0495604_0072755 | 3300047317 | Bacteria | 2597 |
| 482 | Ga0495672_0068822 | 3300047320 | Bacteria | 2011 |
| 483 | Ga0495672_0117197 | 3300047320 | Bacteria | 1421 |
| 484 | Ga0495680_0036997 | 3300047322 | Bacteria | 3912 |
| 485 | Ga0495683_0108972 | 3300047323 | Bacteria | 1324 |
| 486 | Ga0495675_0041019 | 3300047444 | Bacteria | 2950 |
| 487 | Ga0495675_0058272 | 3300047444 | Bacteria | 2449 |
| 488 | Ga0495684_0139724 | 3300047471 | Bacteria | 1816 |
| 489 | Ga0495684_0184135 | 3300047471 | Bacteria | 1547 |
| 490 | Ga0495686_0001008 | 3300047472 | Bacteria | 34224 |
| 491 | Ga0495686_0274513 | 3300047472 | Bacteria | 939 |
| 492 | Ga0495593_0035371 | 3300047673 | Bacteria | 2713 |
| 493 | Ga0495602_0092509 | 3300048088 | Bacteria | 2505 |
| 494 | Ga0496100_0027698 | 3300048903 | Bacteria | 3488 |
| 495 | Ga0496101_0114970 | 3300048904 | Bacteria | 2029 |
| 496 | Ga0496102_0033525 | 3300048905 | Bacteria | 4616 |
| 497 | Ga0496102_0099939 | 3300048905 | Bacteria | 2693 |
| 498 | Ga0496104_0002521 | 3300048907 | Bacteria | 15773 |
| 499 | Ga0496104_0017958 | 3300048907 | Bacteria | 6448 |
| 500 | Ga0496104_0050054 | 3300048907 | Bacteria | 3942 |
| 501 | Ga0496105_0006441 | 3300048908 | Bacteria | 9025 |
| 502 | Ga0496105_0021595 | 3300048908 | Bacteria | 5210 |
| 503 | Ga0496105_0360202 | 3300048908 | Bacteria | 1160 |
| 504 | Ga0496107_0135875 | 3300048910 | Bacteria | 1816 |
| 505 | Ga0496107_0179092 | 3300048910 | Bacteria | 1574 |
| 506 | Ga0496108_0001133 | 3300048911 | Bacteria | 20819 |
| 507 | Ga0496108_0015644 | 3300048911 | Bacteria | 6187 |
| 508 | Ga0496108_0027712 | 3300048911 | Bacteria | 4682 |
| 509 | Ga0496109_0000583 | 3300048912 | Bacteria | 30510 |
| 510 | Ga0496109_0013351 | 3300048912 | Bacteria | 7121 |
| 511 | Ga0496110_0004757 | 3300048913 | Bacteria | 10571 |
| 512 | Ga0496110_0013967 | 3300048913 | Bacteria | 6653 |
| 513 | Ga0496110_0033920 | 3300048913 | Bacteria | 4417 |
| 514 | Ga0496111_0002980 | 3300048914 | Bacteria | 10376 |
| 515 | Ga0496111_0541575 | 3300048914 | Bacteria | 855 |
| 516 | Ga0496112_0000884 | 3300048915 | Bacteria | 21517 |
| 517 | Ga0496112_0002152 | 3300048915 | Bacteria | 15650 |
| 518 | Ga0496113_0000351 | 3300048916 | Bacteria | 22021 |
| 519 | Ga0496113_0001829 | 3300048916 | Bacteria | 12109 |
| 520 | Ga0496113_0005226 | 3300048916 | Bacteria | 8080 |
| 521 | Ga0496114_0077198 | 3300048917 | Bacteria | 2808 |
| 522 | Ga0496114_0139896 | 3300048917 | Bacteria | 2095 |
| 523 | Ga0496114_0313078 | 3300048917 | Bacteria | 1387 |
| 524 | Ga0496114_0447658 | 3300048917 | Bacteria | 1144 |
| 525 | Ga0496115_0009751 | 3300048918 | Bacteria | 7152 |
| 526 | Ga0496115_0129762 | 3300048918 | Bacteria | 2077 |
| 527 | Ga0496115_0361216 | 3300048918 | Bacteria | 1183 |
| 528 | Ga0496115_0520969 | 3300048918 | Bacteria | 953 |
| 529 | Ga0496117_0077019 | 3300048920 | Bacteria | 2208 |
| 530 | Ga0496118_0017136 | 3300048921 | Bacteria | 6610 |
| 531 | Ga0496118_0040427 | 3300048921 | Bacteria | 3708 |
| 532 | Ga0496118_0089244 | 3300048921 | Bacteria | 2129 |
| 533 | Ga0496120_0155211 | 3300048923 | Bacteria | 1146 |
| 534 | Ga0496121_0373689 | 3300048924 | Bacteria | 942 |
| 535 | Ga0496122_0055074 | 3300048925 | Bacteria | 2979 |
| 536 | Ga0496123_0074841 | 3300048926 | Bacteria | 2093 |
| 537 | Ga0496125_0052234 | 3300048928 | Bacteria | 3362 |
| 538 | Ga0501310_020559 | 3300049130 | Bacteria | 820 |
| 539 | Ga0501329_06189 | 3300049545 | Bacteria | 678 |
| 540 | Ga0501033_0224530 | 3300049570 | Bacteria | 1336 |
| 541 | Ga0501034_0132045 | 3300049571 | Bacteria | 2480 |
| 542 | Ga0501034_0277504 | 3300049571 | Bacteria | 1616 |
| 543 | Ga0501034_0285152 | 3300049571 | Bacteria | 1590 |
| 544 | Ga0501036_0311249 | 3300049572 | Bacteria | 1316 |
| 545 | Ga0501037_0069329 | 3300049573 | Bacteria | 2567 |
| 546 | Ga0501043_0251795 | 3300049579 | Bacteria | 1360 |
| 547 | Ga0501047_0000235 | 3300049581 | Bacteria | 65603 |
| 548 | Ga0501047_0074415 | 3300049581 | Bacteria | 3270 |
| 549 | Ga0501047_0466122 | 3300049581 | Bacteria | 1092 |
| 550 | Ga0501048_0093362 | 3300049582 | Bacteria | 2123 |
| 551 | Ga0501070_0199045 | 3300049586 | Bacteria | 1645 |
| 552 | Ga0501073_0494686 | 3300049589 | Bacteria | 846 |
| 553 | Ga0501074_0002757 | 3300049590 | Bacteria | 12304 |
| 554 | Ga0501074_0338521 | 3300049590 | Bacteria | 1068 |
| 555 | Ga0501075_0070033 | 3300049591 | Bacteria | 2651 |
| 556 | Ga0501076_0097296 | 3300049592 | Bacteria | 2371 |
| 557 | Ga0501076_0166011 | 3300049592 | Bacteria | 1799 |
| 558 | Ga0501077_0102988 | 3300049593 | Bacteria | 1809 |
| 559 | Ga0501079_0102385 | 3300049741 | Bacteria | 2221 |
| 560 | Ga0501080_0013397 | 3300049742 | Bacteria | 7542 |
| 561 | Ga0501080_0360541 | 3300049742 | Bacteria | 1312 |
| 562 | Ga0501083_0004993 | 3300049744 | Bacteria | 9404 |
| 563 | Ga0501035_0351152 | 3300049822 | Bacteria | 1234 |
| 564 | Ga0501035_0985448 | 3300049822 | Bacteria | 663 |
| 565 | Ga0501044_0055624 | 3300049823 | Bacteria | 4064 |
| 566 | Ga0501044_0061936 | 3300049823 | Bacteria | 3826 |
| 567 | Ga0501044_0076620 | 3300049823 | Bacteria | 3393 |
| 568 | Ga0501044_0122636 | 3300049823 | Bacteria | 2598 |
| 569 | Ga0501044_0288837 | 3300049823 | Bacteria | 1572 |
| 570 | Ga0501045_0077461 | 3300049824 | Bacteria | 2450 |
| 571 | nmdc:mga03683_382221_c1 | 3300050489 | Bacteria | 670 |
| 572 | nmdc:mga0k408_161964_c1 | 3300050493 | Bacteria | 1333 |
| 573 | nmdc:mga05p37_193059_c1 | 3300050507 | Bacteria | 2471 |
| 574 | nmdc:mga05p37_208661_c1 | 3300050507 | Bacteria | 2362 |
| 575 | nmdc:mga05p37_41651_c1 | 3300050507 | Bacteria | 5639 |
| 576 | nmdc:mga09592_134808_c1 | 3300050508 | Bacteria | 2126 |
| 577 | nmdc:mga0qj67_398999_c1 | 3300050509 | Bacteria | 1110 |
| 578 | nmdc:mga06r32_388937_c1 | 3300050510 | Bacteria | 1377 |
| 579 | nmdc:mga08y16_96065_c1 | 3300050511 | Bacteria | 3086 |
| 580 | nmdc:mga0n895_78493_c1 | 3300050512 | Bacteria | 3286 |
| 581 | nmdc:mga0rr50_433776_c1 | 3300050513 | Bacteria | 1112 |
| 582 | nmdc:mga08x19_23_c1 | 3300050514 | Bacteria | 288286 |
| 583 | nmdc:mga0a205_185339_c1 | 3300050515 | Bacteria | 1974 |
| 584 | Ga0495601_0509942 | 3300053077 | Bacteria | 776 |
| 585 | Ga0495612_0022709 | 3300053078 | Bacteria | 2514 |
| 586 | Ga0495595_0012728 | 3300053084 | Bacteria | 3544 |
| 587 | Ga0495595_0017179 | 3300053084 | Bacteria | 3110 |
| 588 | Ga0495595_0204772 | 3300053084 | Bacteria | 983 |
| 589 | Ga0495619_0008778 | 3300053085 | Bacteria | 6391 |
| 590 | Ga0495619_0097132 | 3300053085 | Bacteria | 2001 |
| 591 | Ga0495619_0115427 | 3300053085 | Bacteria | 1837 |
| 592 | Ga0500641_0007663 | 3300053096 | Bacteria | 3847 |
| 593 | Ga0500593_000058 | 3300053117 | Bacteria | 41070 |
| 594 | Ga0500608_041046 | 3300053122 | Bacteria | 2218 |
| 595 | Ga0500642_0080296 | 3300053130 | Bacteria | 1497 |
| 596 | Ga0500655_000265 | 3300053133 | Bacteria | 12247 |
| 597 | Ga0500568_0000001 | 3300053139 | Bacteria | 988705 |
| 598 | Ga0500577_0040810 | 3300053142 | Bacteria | 1689 |
| 599 | Ga0500577_0094396 | 3300053142 | Bacteria | 1214 |
| 600 | Ga0500590_015132 | 3300053148 | Bacteria | 3982 |
| 601 | Ga0500616_0050068 | 3300053153 | Bacteria | 2207 |
| 602 | Ga0500622_0039247 | 3300053156 | Bacteria | 2469 |
| 603 | Ga0500636_0029625 | 3300053177 | Bacteria | 3234 |
| 604 | Ga0501084_0275420 | 3300054114 | Bacteria | 1421 |
| 605 | Ga0587084_004230 | 3300059477 | Bacteria | 1631 |
| 606 | Ga0587101_021594 | 3300059623 | Bacteria | 932 |
| 607 | Ga0587068_000630 | 3300059641 | Bacteria | 3390 |
| 608 | Ga0587069_011022 | 3300059642 | Bacteria | 1201 |
| 609 | Ga0587079_002261 | 3300059647 | Bacteria | 2329 |
| 610 | Ga0501082_0243438 | 3300060353 | Bacteria | 1565 |
| 611 | Ga0466962_0043530 | 3300061719 | Bacteria | 2148 |
| 612 | Ga0466962_0078938 | 3300061719 | Bacteria | 1573 |
| 613 | Ga0466962_0248959 | 3300061719 | Bacteria | 873 |
| 614 | Ga0530510_0097213 | 3300061734 | Bacteria | 2152 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046690 | Ga0495624_0523343 | Ga0495624_0523343_22_627 | 145 |
| 2 | 3300047315 | Ga0495581_0062181 | Ga0495581_0062181_1526_2131 | 145 |
| 3 | 3300014326 | Ga0157380_10410045 | Ga0157380_104100453 | 152 |
| 4 | 3300046500 | Ga0495596_0280689 | Ga0495596_0280689_104_613 | 152 |
| 5 | 3300037471 | Ga0395905_0985174 | Ga0395905_0985174_196_675 | 159 |
| 6 | 3300049545 | Ga0501329_06189 | Ga0501329_06189_187_666 | 159 |
| 7 | 3300053084 | Ga0495595_0204772 | Ga0495595_0204772_35_514 | 159 |
| 8 | 3300005466 | Ga0070685_10681786 | Ga0070685_106817861 | 160 |
| 9 | 3300039438 | Ga0436360_0537617 | Ga0436360_0537617_2832_3368 | 160 |
| 10 | 3300025908 | Ga0207643_10207188 | Ga0207643_102071881 | 161 |
| 11 | 3300005937 | Ga0081455_10020755 | Ga0081455_1002075512 | 162 |
| 12 | 3300049130 | Ga0501310_020559 | Ga0501310_020559_20_511 | 163 |
| 13 | 3300005365 | Ga0070688_100098616 | Ga0070688_1000986162 | 166 |
| 14 | 3300037466 | Ga0395898_1034210 | Ga0395898_1034210_28_531 | 167 |
| 15 | 3300028380 | Ga0268265_10941727 | Ga0268265_109417272 | 169 |
| 16 | 3300035172 | Ga0373955_0754659 | Ga0373955_0754659_20_553 | 169 |
| 17 | 3300049593 | Ga0501077_0102988 | Ga0501077_0102988_509_1018 | 169 |
| 18 | 3300060353 | Ga0501082_0243438 | Ga0501082_0243438_978_1487 | 169 |
| 19 | 3300007788 | Ga0099795_10001948 | Ga0099795_100019483 | 170 |
| 20 | 3300010159 | Ga0099796_10009160 | Ga0099796_100091605 | 170 |
| 21 | 3300027512 | Ga0209179_1109151 | Ga0209179_11091511 | 170 |
| 22 | 3300035083 | Ga0373926_0054062 | Ga0373926_0054062_824_1357 | 170 |
| 23 | 3300035089 | Ga0373944_0006361 | Ga0373944_0006361_926_1459 | 170 |
| 24 | 3300035111 | Ga0373923_0028731 | Ga0373923_0028731_1060_1593 | 170 |
| 25 | 3300035170 | Ga0373943_0204756 | Ga0373943_0204756_348_881 | 170 |
| 26 | 3300035171 | Ga0373946_0029660 | Ga0373946_0029660_54_587 | 170 |
| 27 | 3300035692 | Ga0373935_0117540 | Ga0373935_0117540_783_1316 | 170 |
| 28 | 3300035695 | Ga0373927_0056189 | Ga0373927_0056189_722_1255 | 170 |
| 29 | 3300035725 | Ga0373947_0085267 | Ga0373947_0085267_817_1350 | 170 |
| 30 | 3300037068 | Ga0373925_0047403 | Ga0373925_0047403_2162_2695 | 170 |
| 31 | 3300009094 | Ga0111539_10163484 | Ga0111539_101634846 | 171 |
| 32 | 3300041460 | Ga0451802_1450534 | Ga0451802_1450534_60_674 | 171 |
| 33 | 3300047472 | Ga0495686_0001008 | Ga0495686_0001008_10439_10972 | 172 |
| 34 | iso_pu_bacteria | 2513237087 | 2513594037 | 173 |
| 35 | iso_pu_bacteria | 2582581305 | 2585262476 | 173 |
| 36 | iso_pu_bacteria | 2595698237 | 2596377143 | 173 |
| 37 | iso_pu_bacteria | 2643221541 | 2643729031 | 173 |
| 38 | iso_pu_bacteria | 2643221606 | 2644045044 | 173 |
| 39 | iso_pu_bacteria | 2643221671 | 2644391217 | 173 |
| 40 | iso_pu_bacteria | 2643221733 | 2644729066 | 173 |
| 41 | iso_pu_bacteria | 2643221734 | 2644735422 | 173 |
| 42 | iso_pu_bacteria | 2738541281 | 2738745691 | 173 |
| 43 | iso_pu_bacteria | 2738543032 | 2739354921 | 173 |
| 44 | iso_pu_bacteria | 2841760612 | 2841761391 | 173 |
| 45 | iso_pu_bacteria | 2841911363 | 2841913394 | 173 |
| 46 | iso_pu_bacteria | 2841917233 | 2841919141 | 173 |
| 47 | iso_pu_bacteria | 2842698319 | 2842701705 | 173 |
| 48 | iso_pu_bacteria | 2844104063 | 2844104416 | 173 |
| 49 | iso_pu_bacteria | 2851246043 | 2851247404 | 173 |
| 50 | iso_pu_bacteria | 2889306138 | 2889311586 | 173 |
| 51 | iso_pu_bacteria | 2891088606 | 2891092902 | 173 |
| 52 | iso_pu_bacteria | 2902405164 | 2902410519 | 173 |
| 53 | iso_pu_bacteria | 2917699015 | 2917699280 | 173 |
| 54 | iso_pu_bacteria | 2919138771 | 2919141398 | 173 |
| 55 | iso_pu_bacteria | 2928125067 | 2928130706 | 173 |
| 56 | iso_pu_bacteria | 8057529695 | 8057530426 | 173 |
| 57 | 3300039447 | Ga0436361_0327700 | Ga0436361_0327700_1524_2048 | 174 |
| 58 | 3300039450 | Ga0436363_1571548 | Ga0436363_1571548_2507_3031 | 174 |
| 59 | 3300001977 | JGI24746J21847_1042367 | JGI24746J21847_10423671 | 177 |
| 60 | 3300001979 | JGI24740J21852_10076260 | JGI24740J21852_100762601 | 177 |
| 61 | 3300001989 | JGI24739J22299_10045863 | JGI24739J22299_100458632 | 177 |
| 62 | 3300001991 | JGI24743J22301_10003130 | JGI24743J22301_100031304 | 177 |
| 63 | 3300002075 | JGI24738J21930_10008307 | JGI24738J21930_100083075 | 177 |
| 64 | 3300002075 | JGI24738J21930_10020059 | JGI24738J21930_100200592 | 177 |
| 65 | 3300002076 | JGI24749J21850_1000052 | JGI24749J21850_100005220 | 177 |
| 66 | 3300002077 | JGI24744J21845_10000585 | JGI24744J21845_100005853 | 177 |
| 67 | 3300002459 | JGI24751J29686_10000379 | JGI24751J29686_1000037915 | 177 |
| 68 | 3300003187 | JGI25151J46595_10000038 | JGI25151J46595_1000003818 | 177 |
| 69 | 3300003762 | Ga0055542_1002777 | Ga0055542_10027773 | 177 |
| 70 | 3300003771 | Ga0055526_1012008 | Ga0055526_10120084 | 177 |
| 71 | 3300003775 | Ga0055524_1006440 | Ga0055524_10064404 | 177 |
| 72 | 3300003784 | Ga0055534_1028384 | Ga0055534_10283841 | 177 |
| 73 | 3300005327 | Ga0070658_10010598 | Ga0070658_100105989 | 177 |
| 74 | 3300005327 | Ga0070658_10073690 | Ga0070658_100736903 | 177 |
| 75 | 3300005327 | Ga0070658_10097669 | Ga0070658_100976696 | 177 |
| 76 | 3300005327 | Ga0070658_10225012 | Ga0070658_102250123 | 177 |
| 77 | 3300005328 | Ga0070676_10092152 | Ga0070676_100921522 | 177 |
| 78 | 3300005329 | Ga0070683_100037799 | Ga0070683_1000377995 | 177 |
| 79 | 3300005329 | Ga0070683_100429364 | Ga0070683_1004293642 | 177 |
| 80 | 3300005331 | Ga0070670_100000093 | Ga0070670_1000000936 | 177 |
| 81 | 3300005331 | Ga0070670_100030580 | Ga0070670_1000305806 | 177 |
| 82 | 3300005334 | Ga0068869_100000029 | Ga0068869_10000002939 | 177 |
| 83 | 3300005336 | Ga0070680_100005733 | Ga0070680_10000573310 | 177 |
| 84 | 3300005336 | Ga0070680_100024886 | Ga0070680_1000248864 | 177 |
| 85 | 3300005336 | Ga0070680_100063787 | Ga0070680_1000637872 | 177 |
| 86 | 3300005336 | Ga0070680_100082947 | Ga0070680_1000829472 | 177 |
| 87 | 3300005336 | Ga0070680_101147667 | Ga0070680_1011476671 | 177 |
| 88 | 3300005338 | Ga0068868_100003973 | Ga0068868_10000397311 | 177 |
| 89 | 3300005339 | Ga0070660_100049574 | Ga0070660_1000495744 | 177 |
| 90 | 3300005339 | Ga0070660_100126597 | Ga0070660_1001265973 | 177 |
| 91 | 3300005339 | Ga0070660_100459877 | Ga0070660_1004598772 | 177 |
| 92 | 3300005339 | Ga0070660_100968203 | Ga0070660_1009682031 | 177 |
| 93 | 3300005344 | Ga0070661_100069740 | Ga0070661_1000697403 | 177 |
| 94 | 3300005347 | Ga0070668_100010274 | Ga0070668_1000102743 | 177 |
| 95 | 3300005347 | Ga0070668_100205915 | Ga0070668_1002059152 | 177 |
| 96 | 3300005353 | Ga0070669_100000115 | Ga0070669_1000001156 | 177 |
| 97 | 3300005354 | Ga0070675_101754841 | Ga0070675_1017548411 | 177 |
| 98 | 3300005355 | Ga0070671_100135894 | Ga0070671_1001358943 | 177 |
| 99 | 3300005355 | Ga0070671_100141969 | Ga0070671_1001419693 | 177 |
| 100 | 3300005355 | Ga0070671_101094875 | Ga0070671_1010948751 | 177 |
| 101 | 3300005356 | Ga0070674_100056384 | Ga0070674_1000563842 | 177 |
| 102 | 3300005364 | Ga0070673_100000019 | Ga0070673_100000019116 | 177 |
| 103 | 3300005366 | Ga0070659_100183076 | Ga0070659_1001830762 | 177 |
| 104 | 3300005366 | Ga0070659_101162815 | Ga0070659_1011628151 | 177 |
| 105 | 3300005367 | Ga0070667_100000088 | Ga0070667_10000008871 | 177 |
| 106 | 3300005367 | Ga0070667_100013671 | Ga0070667_1000136716 | 177 |
| 107 | 3300005434 | Ga0070709_10048001 | Ga0070709_100480012 | 177 |
| 108 | 3300005435 | Ga0070714_100448914 | Ga0070714_1004489142 | 177 |
| 109 | 3300005435 | Ga0070714_100511011 | Ga0070714_1005110112 | 177 |
| 110 | 3300005436 | Ga0070713_100017903 | Ga0070713_1000179032 | 177 |
| 111 | 3300005436 | Ga0070713_101125750 | Ga0070713_1011257501 | 177 |
| 112 | 3300005439 | Ga0070711_100044999 | Ga0070711_1000449994 | 177 |
| 113 | 3300005439 | Ga0070711_100158971 | Ga0070711_1001589711 | 177 |
| 114 | 3300005455 | Ga0070663_100016226 | Ga0070663_1000162263 | 177 |
| 115 | 3300005456 | Ga0070678_100006601 | Ga0070678_10000660112 | 177 |
| 116 | 3300005457 | Ga0070662_100202310 | Ga0070662_1002023103 | 177 |
| 117 | 3300005457 | Ga0070662_100515479 | Ga0070662_1005154791 | 177 |
| 118 | 3300005458 | Ga0070681_10063895 | Ga0070681_100638959 | 177 |
| 119 | 3300005458 | Ga0070681_10128718 | Ga0070681_101287184 | 177 |
| 120 | 3300005458 | Ga0070681_10400379 | Ga0070681_104003792 | 177 |
| 121 | 3300005458 | Ga0070681_10485858 | Ga0070681_104858582 | 177 |
| 122 | 3300005458 | Ga0070681_10952663 | Ga0070681_109526632 | 177 |
| 123 | 3300005459 | Ga0068867_100000014 | Ga0068867_100000014120 | 177 |
| 124 | 3300005459 | Ga0068867_100772215 | Ga0068867_1007722152 | 177 |
| 125 | 3300005530 | Ga0070679_100068171 | Ga0070679_1000681714 | 177 |
| 126 | 3300005530 | Ga0070679_100083578 | Ga0070679_1000835787 | 177 |
| 127 | 3300005530 | Ga0070679_100200073 | Ga0070679_1002000733 | 177 |
| 128 | 3300005530 | Ga0070679_100242821 | Ga0070679_1002428214 | 177 |
| 129 | 3300005530 | Ga0070679_100366118 | Ga0070679_1003661182 | 177 |
| 130 | 3300005530 | Ga0070679_100696567 | Ga0070679_1006965672 | 177 |
| 131 | 3300005530 | Ga0070679_101099268 | Ga0070679_1010992682 | 177 |
| 132 | 3300005535 | Ga0070684_100431540 | Ga0070684_1004315402 | 177 |
| 133 | 3300005536 | Ga0070697_100005582 | Ga0070697_1000055826 | 177 |
| 134 | 3300005539 | Ga0068853_100892512 | Ga0068853_1008925122 | 177 |
| 135 | 3300005543 | Ga0070672_101170263 | Ga0070672_1011702632 | 177 |
| 136 | 3300005545 | Ga0070695_100007388 | Ga0070695_1000073884 | 177 |
| 137 | 3300005547 | Ga0070693_100171905 | Ga0070693_1001719051 | 177 |
| 138 | 3300005547 | Ga0070693_100272386 | Ga0070693_1002723862 | 177 |
| 139 | 3300005548 | Ga0070665_100255950 | Ga0070665_1002559502 | 177 |
| 140 | 3300005549 | Ga0070704_100880415 | Ga0070704_1008804152 | 177 |
| 141 | 3300005563 | Ga0068855_100027910 | Ga0068855_10002791010 | 177 |
| 142 | 3300005563 | Ga0068855_100447267 | Ga0068855_1004472673 | 177 |
| 143 | 3300005563 | Ga0068855_100810457 | Ga0068855_1008104572 | 177 |
| 144 | 3300005563 | Ga0068855_100913885 | Ga0068855_1009138852 | 177 |
| 145 | 3300005564 | Ga0070664_100122298 | Ga0070664_1001222985 | 177 |
| 146 | 3300005577 | Ga0068857_100066375 | Ga0068857_1000663752 | 177 |
| 147 | 3300005577 | Ga0068857_100324060 | Ga0068857_1003240603 | 177 |
| 148 | 3300005577 | Ga0068857_100885056 | Ga0068857_1008850561 | 177 |
| 149 | 3300005577 | Ga0068857_101070198 | Ga0068857_1010701981 | 177 |
| 150 | 3300005578 | Ga0068854_100449464 | Ga0068854_1004494642 | 177 |
| 151 | 3300005614 | Ga0068856_100060779 | Ga0068856_1000607793 | 177 |
| 152 | 3300005614 | Ga0068856_100484785 | Ga0068856_1004847853 | 177 |
| 153 | 3300005616 | Ga0068852_100166080 | Ga0068852_1001660804 | 177 |
| 154 | 3300005616 | Ga0068852_100247205 | Ga0068852_1002472053 | 177 |
| 155 | 3300005616 | Ga0068852_100383315 | Ga0068852_1003833153 | 177 |
| 156 | 3300005616 | Ga0068852_101768801 | Ga0068852_1017688011 | 177 |
| 157 | 3300005617 | Ga0068859_100009835 | Ga0068859_1000098353 | 177 |
| 158 | 3300005617 | Ga0068859_100096701 | Ga0068859_1000967012 | 177 |
| 159 | 3300005618 | Ga0068864_100000087 | Ga0068864_1000000876 | 177 |
| 160 | 3300005618 | Ga0068864_100754039 | Ga0068864_1007540392 | 177 |
| 161 | 3300005719 | Ga0068861_100006640 | Ga0068861_10000664010 | 177 |
| 162 | 3300005834 | Ga0068851_10070267 | Ga0068851_100702672 | 177 |
| 163 | 3300005841 | Ga0068863_100008669 | Ga0068863_10000866916 | 177 |
| 164 | 3300005843 | Ga0068860_100000220 | Ga0068860_10000022023 | 177 |
| 165 | 3300005843 | Ga0068860_101008131 | Ga0068860_1010081311 | 177 |
| 166 | 3300005844 | Ga0068862_100000466 | Ga0068862_1000004666 | 177 |
| 167 | 3300005844 | Ga0068862_100122633 | Ga0068862_1001226333 | 177 |
| 168 | 3300005937 | Ga0081455_10004023 | Ga0081455_1000402322 | 177 |
| 169 | 3300005937 | Ga0081455_10041960 | Ga0081455_100419604 | 177 |
| 170 | 3300005983 | Ga0081540_1006488 | Ga0081540_10064883 | 177 |
| 171 | 3300005983 | Ga0081540_1051990 | Ga0081540_10519904 | 177 |
| 172 | 3300005985 | Ga0081539_10057536 | Ga0081539_100575364 | 177 |
| 173 | 3300006038 | Ga0075365_10164955 | Ga0075365_101649554 | 177 |
| 174 | 3300006038 | Ga0075365_10448116 | Ga0075365_104481162 | 177 |
| 175 | 3300006038 | Ga0075365_10596615 | Ga0075365_105966152 | 177 |
| 176 | 3300006175 | Ga0070712_100040629 | Ga0070712_1000406296 | 177 |
| 177 | 3300006186 | Ga0075369_10014440 | Ga0075369_100144403 | 177 |
| 178 | 3300006195 | Ga0075366_10011613 | Ga0075366_1001161312 | 177 |
| 179 | 3300006195 | Ga0075366_10181683 | Ga0075366_101816832 | 177 |
| 180 | 3300006195 | Ga0075366_10794142 | Ga0075366_107941421 | 177 |
| 181 | 3300006237 | Ga0097621_100377578 | Ga0097621_1003775782 | 177 |
| 182 | 3300006353 | Ga0075370_10211943 | Ga0075370_102119432 | 177 |
| 183 | 3300006358 | Ga0068871_100041983 | Ga0068871_1000419833 | 177 |
| 184 | 3300006847 | Ga0075431_100013939 | Ga0075431_1000139394 | 177 |
| 185 | 3300006852 | Ga0075433_10327457 | Ga0075433_103274573 | 177 |
| 186 | 3300006871 | Ga0075434_100185510 | Ga0075434_1001855103 | 177 |
| 187 | 3300006881 | Ga0068865_100030870 | Ga0068865_1000308702 | 177 |
| 188 | 3300006914 | Ga0075436_100014756 | Ga0075436_10001475611 | 177 |
| 189 | 3300006931 | Ga0097620_100009835 | Ga0097620_10000983512 | 177 |
| 190 | 3300006931 | Ga0097620_100096701 | Ga0097620_1000967012 | 177 |
| 191 | 3300007076 | Ga0075435_100026460 | Ga0075435_1000264604 | 177 |
| 192 | 3300007076 | Ga0075435_100388871 | Ga0075435_1003888712 | 177 |
| 193 | 3300009093 | Ga0105240_10015848 | Ga0105240_100158489 | 177 |
| 194 | 3300009093 | Ga0105240_10038434 | Ga0105240_100384346 | 177 |
| 195 | 3300009093 | Ga0105240_10337173 | Ga0105240_103371733 | 177 |
| 196 | 3300009094 | Ga0111539_10483254 | Ga0111539_104832541 | 177 |
| 197 | 3300009098 | Ga0105245_10005275 | Ga0105245_100052752 | 177 |
| 198 | 3300009101 | Ga0105247_10804080 | Ga0105247_108040802 | 177 |
| 199 | 3300009147 | Ga0114129_10001848 | Ga0114129_1000184818 | 177 |
| 200 | 3300009147 | Ga0114129_10227354 | Ga0114129_102273545 | 177 |
| 201 | 3300009147 | Ga0114129_11835813 | Ga0114129_118358131 | 177 |
| 202 | 3300009148 | Ga0105243_10000076 | Ga0105243_100000769 | 177 |
| 203 | 3300009148 | Ga0105243_10245578 | Ga0105243_102455782 | 177 |
| 204 | 3300009148 | Ga0105243_10477166 | Ga0105243_104771662 | 177 |
| 205 | 3300009176 | Ga0105242_10009804 | Ga0105242_100098049 | 177 |
| 206 | 3300009177 | Ga0105248_10003987 | Ga0105248_1000398712 | 177 |
| 207 | 3300009177 | Ga0105248_10008689 | Ga0105248_1000868910 | 177 |
| 208 | 3300009545 | Ga0105237_10045964 | Ga0105237_100459644 | 177 |
| 209 | 3300009545 | Ga0105237_10268995 | Ga0105237_102689952 | 177 |
| 210 | 3300009545 | Ga0105237_10553704 | Ga0105237_105537042 | 177 |
| 211 | 3300009551 | Ga0105238_10084340 | Ga0105238_100843406 | 177 |
| 212 | 3300009551 | Ga0105238_10164963 | Ga0105238_101649634 | 177 |
| 213 | 3300009551 | Ga0105238_10226631 | Ga0105238_102266313 | 177 |
| 214 | 3300009551 | Ga0105238_10271223 | Ga0105238_102712231 | 177 |
| 215 | 3300009551 | Ga0105238_11105398 | Ga0105238_111053982 | 177 |
| 216 | 3300009553 | Ga0105249_10020004 | Ga0105249_100200042 | 177 |
| 217 | 3300009553 | Ga0105249_10123325 | Ga0105249_101233256 | 177 |
| 218 | 3300009978 | Ga0105148_100340 | Ga0105148_1003404 | 177 |
| 219 | 3300010375 | Ga0105239_10343307 | Ga0105239_103433074 | 177 |
| 220 | 3300010375 | Ga0105239_10557218 | Ga0105239_105572182 | 177 |
| 221 | 3300010375 | Ga0105239_11006974 | Ga0105239_110069742 | 177 |
| 222 | 3300011119 | Ga0105246_10052677 | Ga0105246_100526777 | 177 |
| 223 | 3300012513 | Ga0157326_1000064 | Ga0157326_100006410 | 177 |
| 224 | 3300013100 | Ga0157373_10069320 | Ga0157373_100693201 | 177 |
| 225 | 3300013100 | Ga0157373_10147610 | Ga0157373_101476103 | 177 |
| 226 | 3300013100 | Ga0157373_10159167 | Ga0157373_101591673 | 177 |
| 227 | 3300013100 | Ga0157373_10737579 | Ga0157373_107375792 | 177 |
| 228 | 3300013102 | Ga0157371_10042695 | Ga0157371_100426957 | 177 |
| 229 | 3300013102 | Ga0157371_10206362 | Ga0157371_102063622 | 177 |
| 230 | 3300013102 | Ga0157371_10659969 | Ga0157371_106599692 | 177 |
| 231 | 3300013102 | Ga0157371_10886225 | Ga0157371_108862251 | 177 |
| 232 | 3300013104 | Ga0157370_10011636 | Ga0157370_100116366 | 177 |
| 233 | 3300013104 | Ga0157370_10108530 | Ga0157370_101085306 | 177 |
| 234 | 3300013104 | Ga0157370_10494637 | Ga0157370_104946372 | 177 |
| 235 | 3300013104 | Ga0157370_10776460 | Ga0157370_107764602 | 177 |
| 236 | 3300013104 | Ga0157370_11330686 | Ga0157370_113306861 | 177 |
| 237 | 3300013105 | Ga0157369_10077891 | Ga0157369_100778916 | 177 |
| 238 | 3300013105 | Ga0157369_10129027 | Ga0157369_101290274 | 177 |
| 239 | 3300013105 | Ga0157369_10337199 | Ga0157369_103371992 | 177 |
| 240 | 3300013105 | Ga0157369_10444632 | Ga0157369_104446322 | 177 |
| 241 | 3300013296 | Ga0157374_10044615 | Ga0157374_100446152 | 177 |
| 242 | 3300013296 | Ga0157374_10094106 | Ga0157374_100941063 | 177 |
| 243 | 3300013297 | Ga0157378_10000504 | Ga0157378_1000050442 | 177 |
| 244 | 3300013306 | Ga0163162_10504833 | Ga0163162_105048332 | 177 |
| 245 | 3300013307 | Ga0157372_10234957 | Ga0157372_102349574 | 177 |
| 246 | 3300013307 | Ga0157372_10519019 | Ga0157372_105190191 | 177 |
| 247 | 3300013307 | Ga0157372_11075511 | Ga0157372_110755112 | 177 |
| 248 | 3300014325 | Ga0163163_10002310 | Ga0163163_1000231013 | 177 |
| 249 | 3300014325 | Ga0163163_10024251 | Ga0163163_100242516 | 177 |
| 250 | 3300014325 | Ga0163163_10204491 | Ga0163163_102044913 | 177 |
| 251 | 3300014326 | Ga0157380_10000157 | Ga0157380_1000015712 | 177 |
| 252 | 3300014745 | Ga0157377_10145480 | Ga0157377_101454803 | 177 |
| 253 | 3300014968 | Ga0157379_10446478 | Ga0157379_104464782 | 177 |
| 254 | 3300014969 | Ga0157376_10000092 | Ga0157376_1000009247 | 177 |
| 255 | 3300017792 | Ga0163161_10189654 | Ga0163161_101896542 | 177 |
| 256 | 3300021384 | Ga0213876_10013852 | Ga0213876_100138523 | 177 |
| 257 | 3300021388 | Ga0213875_10241366 | Ga0213875_102413662 | 177 |
| 258 | 3300025231 | Ga0207427_104233 | Ga0207427_1042334 | 177 |
| 259 | 3300025233 | Ga0209437_109865 | Ga0209437_1098652 | 177 |
| 260 | 3300025250 | Ga0209026_1000352 | Ga0209026_100035234 | 177 |
| 261 | 3300025254 | Ga0209148_1004350 | Ga0209148_10043506 | 177 |
| 262 | 3300025261 | Ga0209233_1000003 | Ga0209233_1000003951 | 177 |
| 263 | 3300025261 | Ga0209233_1003903 | Ga0209233_10039033 | 177 |
| 264 | 3300025272 | Ga0209455_1002555 | Ga0209455_10025552 | 177 |
| 265 | 3300025273 | Ga0209673_1037691 | Ga0209673_10376912 | 177 |
| 266 | 3300025291 | Ga0209675_1002527 | Ga0209675_100252715 | 177 |
| 267 | 3300025292 | Ga0209676_1028639 | Ga0209676_10286393 | 177 |
| 268 | 3300025294 | Ga0209025_1000014 | Ga0209025_100001412 | 177 |
| 269 | 3300025294 | Ga0209025_1065919 | Ga0209025_10659192 | 177 |
| 270 | 3300025295 | Ga0209564_1002872 | Ga0209564_100287213 | 177 |
| 271 | 3300025299 | Ga0209256_1000108 | Ga0209256_1000108184 | 177 |
| 272 | 3300025321 | Ga0207656_10023826 | Ga0207656_100238263 | 177 |
| 273 | 3300025901 | Ga0207688_10030543 | Ga0207688_100305432 | 177 |
| 274 | 3300025904 | Ga0207647_10389004 | Ga0207647_103890041 | 177 |
| 275 | 3300025906 | Ga0207699_10302236 | Ga0207699_103022361 | 177 |
| 276 | 3300025907 | Ga0207645_10028915 | Ga0207645_100289159 | 177 |
| 277 | 3300025909 | Ga0207705_10000243 | Ga0207705_1000024320 | 177 |
| 278 | 3300025909 | Ga0207705_10002954 | Ga0207705_1000295419 | 177 |
| 279 | 3300025909 | Ga0207705_10005544 | Ga0207705_100055449 | 177 |
| 280 | 3300025909 | Ga0207705_10040855 | Ga0207705_100408556 | 177 |
| 281 | 3300025909 | Ga0207705_10752239 | Ga0207705_107522391 | 177 |
| 282 | 3300025911 | Ga0207654_10135541 | Ga0207654_101355412 | 177 |
| 283 | 3300025912 | Ga0207707_10009792 | Ga0207707_100097929 | 177 |
| 284 | 3300025912 | Ga0207707_10073118 | Ga0207707_100731186 | 177 |
| 285 | 3300025912 | Ga0207707_10261591 | Ga0207707_102615912 | 177 |
| 286 | 3300025912 | Ga0207707_10452187 | Ga0207707_104521872 | 177 |
| 287 | 3300025913 | Ga0207695_10012684 | Ga0207695_1001268410 | 177 |
| 288 | 3300025913 | Ga0207695_10159517 | Ga0207695_101595174 | 177 |
| 289 | 3300025914 | Ga0207671_10068421 | Ga0207671_100684215 | 177 |
| 290 | 3300025914 | Ga0207671_10342326 | Ga0207671_103423262 | 177 |
| 291 | 3300025915 | Ga0207693_10004752 | Ga0207693_100047526 | 177 |
| 292 | 3300025915 | Ga0207693_10338978 | Ga0207693_103389782 | 177 |
| 293 | 3300025917 | Ga0207660_10033759 | Ga0207660_100337592 | 177 |
| 294 | 3300025917 | Ga0207660_10073946 | Ga0207660_100739465 | 177 |
| 295 | 3300025917 | Ga0207660_10109315 | Ga0207660_101093153 | 177 |
| 296 | 3300025917 | Ga0207660_10234972 | Ga0207660_102349724 | 177 |
| 297 | 3300025917 | Ga0207660_10238397 | Ga0207660_102383973 | 177 |
| 298 | 3300025917 | Ga0207660_10266788 | Ga0207660_102667883 | 177 |
| 299 | 3300025919 | Ga0207657_10039829 | Ga0207657_100398291 | 177 |
| 300 | 3300025919 | Ga0207657_10057078 | Ga0207657_100570786 | 177 |
| 301 | 3300025919 | Ga0207657_10098911 | Ga0207657_100989111 | 177 |
| 302 | 3300025919 | Ga0207657_10441080 | Ga0207657_104410802 | 177 |
| 303 | 3300025920 | Ga0207649_10670647 | Ga0207649_106706472 | 177 |
| 304 | 3300025921 | Ga0207652_10022634 | Ga0207652_100226349 | 177 |
| 305 | 3300025921 | Ga0207652_10237592 | Ga0207652_102375922 | 177 |
| 306 | 3300025921 | Ga0207652_10259630 | Ga0207652_102596303 | 177 |
| 307 | 3300025921 | Ga0207652_10266174 | Ga0207652_102661743 | 177 |
| 308 | 3300025921 | Ga0207652_10414093 | Ga0207652_104140933 | 177 |
| 309 | 3300025923 | Ga0207681_10000005 | Ga0207681_1000000557 | 177 |
| 310 | 3300025923 | Ga0207681_10138373 | Ga0207681_101383731 | 177 |
| 311 | 3300025924 | Ga0207694_10010694 | Ga0207694_100106947 | 177 |
| 312 | 3300025924 | Ga0207694_10161581 | Ga0207694_101615814 | 177 |
| 313 | 3300025924 | Ga0207694_10231602 | Ga0207694_102316023 | 177 |
| 314 | 3300025924 | Ga0207694_10258839 | Ga0207694_102588393 | 177 |
| 315 | 3300025925 | Ga0207650_10000004 | Ga0207650_10000004664 | 177 |
| 316 | 3300025925 | Ga0207650_10014747 | Ga0207650_100147475 | 177 |
| 317 | 3300025926 | Ga0207659_10009064 | Ga0207659_100090646 | 177 |
| 318 | 3300025927 | Ga0207687_10079745 | Ga0207687_100797455 | 177 |
| 319 | 3300025928 | Ga0207700_10110657 | Ga0207700_101106574 | 177 |
| 320 | 3300025929 | Ga0207664_10006275 | Ga0207664_1000627510 | 177 |
| 321 | 3300025929 | Ga0207664_10033079 | Ga0207664_100330796 | 177 |
| 322 | 3300025931 | Ga0207644_10082298 | Ga0207644_100822983 | 177 |
| 323 | 3300025931 | Ga0207644_10176989 | Ga0207644_101769893 | 177 |
| 324 | 3300025931 | Ga0207644_10370336 | Ga0207644_103703362 | 177 |
| 325 | 3300025931 | Ga0207644_10994302 | Ga0207644_109943021 | 177 |
| 326 | 3300025932 | Ga0207690_10675799 | Ga0207690_106757991 | 177 |
| 327 | 3300025933 | Ga0207706_10041508 | Ga0207706_100415085 | 177 |
| 328 | 3300025933 | Ga0207706_10543457 | Ga0207706_105434572 | 177 |
| 329 | 3300025934 | Ga0207686_10004287 | Ga0207686_100042878 | 177 |
| 330 | 3300025935 | Ga0207709_10000114 | Ga0207709_1000011426 | 177 |
| 331 | 3300025935 | Ga0207709_10341562 | Ga0207709_103415622 | 177 |
| 332 | 3300025935 | Ga0207709_10360916 | Ga0207709_103609163 | 177 |
| 333 | 3300025937 | Ga0207669_10017734 | Ga0207669_100177342 | 177 |
| 334 | 3300025937 | Ga0207669_10278908 | Ga0207669_102789082 | 177 |
| 335 | 3300025938 | Ga0207704_10000008 | Ga0207704_10000008116 | 177 |
| 336 | 3300025939 | Ga0207665_10140403 | Ga0207665_101404032 | 177 |
| 337 | 3300025940 | Ga0207691_10130675 | Ga0207691_101306752 | 177 |
| 338 | 3300025941 | Ga0207711_10001472 | Ga0207711_1000147215 | 177 |
| 339 | 3300025941 | Ga0207711_10221727 | Ga0207711_102217272 | 177 |
| 340 | 3300025941 | Ga0207711_10492350 | Ga0207711_104923502 | 177 |
| 341 | 3300025942 | Ga0207689_10000608 | Ga0207689_1000060840 | 177 |
| 342 | 3300025944 | Ga0207661_10038656 | Ga0207661_100386566 | 177 |
| 343 | 3300025945 | Ga0207679_10095607 | Ga0207679_100956074 | 177 |
| 344 | 3300025945 | Ga0207679_10098523 | Ga0207679_100985232 | 177 |
| 345 | 3300025949 | Ga0207667_10004001 | Ga0207667_1000400112 | 177 |
| 346 | 3300025949 | Ga0207667_10033512 | Ga0207667_100335123 | 177 |
| 347 | 3300025960 | Ga0207651_10000008 | Ga0207651_10000008108 | 177 |
| 348 | 3300025961 | Ga0207712_10077729 | Ga0207712_100777292 | 177 |
| 349 | 3300025961 | Ga0207712_10346030 | Ga0207712_103460303 | 177 |
| 350 | 3300025961 | Ga0207712_10868134 | Ga0207712_108681342 | 177 |
| 351 | 3300025981 | Ga0207640_10026471 | Ga0207640_100264713 | 177 |
| 352 | 3300025981 | Ga0207640_10338594 | Ga0207640_103385942 | 177 |
| 353 | 3300025986 | Ga0207658_10000064 | Ga0207658_1000006446 | 177 |
| 354 | 3300025986 | Ga0207658_10009141 | Ga0207658_100091416 | 177 |
| 355 | 3300026023 | Ga0207677_10000091 | Ga0207677_1000009189 | 177 |
| 356 | 3300026035 | Ga0207703_10890785 | Ga0207703_108907852 | 177 |
| 357 | 3300026041 | Ga0207639_10491719 | Ga0207639_104917192 | 177 |
| 358 | 3300026041 | Ga0207639_11053564 | Ga0207639_110535642 | 177 |
| 359 | 3300026067 | Ga0207678_10045992 | Ga0207678_100459922 | 177 |
| 360 | 3300026078 | Ga0207702_10006302 | Ga0207702_100063027 | 177 |
| 361 | 3300026078 | Ga0207702_10247187 | Ga0207702_102471872 | 177 |
| 362 | 3300026078 | Ga0207702_10967111 | Ga0207702_109671112 | 177 |
| 363 | 3300026088 | Ga0207641_10003244 | Ga0207641_1000324413 | 177 |
| 364 | 3300026089 | Ga0207648_10000009 | Ga0207648_10000009108 | 177 |
| 365 | 3300026095 | Ga0207676_10000006 | Ga0207676_1000000648 | 177 |
| 366 | 3300026116 | Ga0207674_10066644 | Ga0207674_100666446 | 177 |
| 367 | 3300026116 | Ga0207674_10071868 | Ga0207674_100718685 | 177 |
| 368 | 3300026116 | Ga0207674_10373507 | Ga0207674_103735072 | 177 |
| 369 | 3300026116 | Ga0207674_10404168 | Ga0207674_104041683 | 177 |
| 370 | 3300026118 | Ga0207675_100001117 | Ga0207675_10000111718 | 177 |
| 371 | 3300026121 | Ga0207683_10006500 | Ga0207683_1000650016 | 177 |
| 372 | 3300026142 | Ga0207698_10230088 | Ga0207698_102300883 | 177 |
| 373 | 3300026142 | Ga0207698_10525453 | Ga0207698_105254532 | 177 |
| 374 | 3300026142 | Ga0207698_10833795 | Ga0207698_108337952 | 177 |
| 375 | 3300028379 | Ga0268266_10400280 | Ga0268266_104002803 | 177 |
| 376 | 3300028379 | Ga0268266_10534549 | Ga0268266_105345492 | 177 |
| 377 | 3300028379 | Ga0268266_10624098 | Ga0268266_106240982 | 177 |
| 378 | 3300028380 | Ga0268265_10000001 | Ga0268265_100000011130 | 177 |
| 379 | 3300028380 | Ga0268265_10058458 | Ga0268265_100584583 | 177 |
| 380 | 3300028381 | Ga0268264_10000277 | Ga0268264_1000027790 | 177 |
| 381 | 3300028556 | Ga0265337_1007309 | Ga0265337_10073095 | 177 |
| 382 | 3300028666 | Ga0265336_10052787 | Ga0265336_100527871 | 177 |
| 383 | 3300028794 | Ga0307515_10099360 | Ga0307515_100993606 | 177 |
| 384 | 3300028800 | Ga0265338_10169152 | Ga0265338_101691522 | 177 |
| 385 | 3300028800 | Ga0265338_10534408 | Ga0265338_105344082 | 177 |
| 386 | 3300031238 | Ga0265332_10081675 | Ga0265332_100816751 | 177 |
| 387 | 3300031241 | Ga0265325_10003961 | Ga0265325_1000396116 | 177 |
| 388 | 3300031241 | Ga0265325_10007856 | Ga0265325_100078564 | 177 |
| 389 | 3300031241 | Ga0265325_10075997 | Ga0265325_100759971 | 177 |
| 390 | 3300031247 | Ga0265340_10167086 | Ga0265340_101670861 | 177 |
| 391 | 3300031249 | Ga0265339_10001408 | Ga0265339_1000140816 | 177 |
| 392 | 3300031249 | Ga0265339_10052488 | Ga0265339_100524882 | 177 |
| 393 | 3300031250 | Ga0265331_10014930 | Ga0265331_100149307 | 177 |
| 394 | 3300031250 | Ga0265331_10235677 | Ga0265331_102356771 | 177 |
| 395 | 3300031251 | Ga0265327_10072293 | Ga0265327_100722932 | 177 |
| 396 | 3300031344 | Ga0265316_10050124 | Ga0265316_100501245 | 177 |
| 397 | 3300031344 | Ga0265316_10091372 | Ga0265316_100913723 | 177 |
| 398 | 3300031595 | Ga0265313_10001884 | Ga0265313_1000188423 | 177 |
| 399 | 3300031595 | Ga0265313_10009717 | Ga0265313_100097175 | 177 |
| 400 | 3300031595 | Ga0265313_10041399 | Ga0265313_100413995 | 177 |
| 401 | 3300031711 | Ga0265314_10235211 | Ga0265314_102352112 | 177 |
| 402 | 3300031712 | Ga0265342_10000677 | Ga0265342_1000067726 | 177 |
| 403 | 3300031712 | Ga0265342_10085476 | Ga0265342_100854761 | 177 |
| 404 | 3300031712 | Ga0265342_10087093 | Ga0265342_100870933 | 177 |
| 405 | 3300031901 | Ga0307406_10090266 | Ga0307406_100902664 | 177 |
| 406 | 3300031995 | Ga0307409_100481191 | Ga0307409_1004811912 | 177 |
| 407 | 3300031995 | Ga0307409_100533681 | Ga0307409_1005336812 | 177 |
| 408 | 3300035086 | Ga0373934_0008632 | Ga0373934_0008632_2520_3053 | 177 |
| 409 | 3300035092 | Ga0373952_0069892 | Ga0373952_0069892_122_655 | 177 |
| 410 | 3300035115 | Ga0373941_0182888 | Ga0373941_0182888_128_661 | 177 |
| 411 | 3300035117 | Ga0373953_0031007 | Ga0373953_0031007_36_569 | 177 |
| 412 | 3300035118 | Ga0373954_0082396 | Ga0373954_0082396_256_789 | 177 |
| 413 | 3300035118 | Ga0373954_0464403 | Ga0373954_0464403_19_552 | 177 |
| 414 | 3300035119 | Ga0373956_0125127 | Ga0373956_0125127_573_1106 | 177 |
| 415 | 3300035120 | Ga0373957_0034795 | Ga0373957_0034795_397_930 | 177 |
| 416 | 3300035120 | Ga0373957_0167166 | Ga0373957_0167166_31_564 | 177 |
| 417 | 3300035170 | Ga0373943_0147879 | Ga0373943_0147879_656_1189 | 177 |
| 418 | 3300035171 | Ga0373946_0126645 | Ga0373946_0126645_595_1128 | 177 |
| 419 | 3300035171 | Ga0373946_0278477 | Ga0373946_0278477_26_559 | 177 |
| 420 | 3300035172 | Ga0373955_0001179 | Ga0373955_0001179_8149_8682 | 177 |
| 421 | 3300035241 | Ga0373961_0288663 | Ga0373961_0288663_40_573 | 177 |
| 422 | 3300035410 | Ga0373924_0029520 | Ga0373924_0029520_1063_1596 | 177 |
| 423 | 3300035691 | Ga0373931_0183942 | Ga0373931_0183942_629_1162 | 177 |
| 424 | 3300035692 | Ga0373935_0154285 | Ga0373935_0154285_960_1493 | 177 |
| 425 | 3300035692 | Ga0373935_0197109 | Ga0373935_0197109_844_1377 | 177 |
| 426 | 3300035692 | Ga0373935_0312809 | Ga0373935_0312809_17_550 | 177 |
| 427 | 3300035695 | Ga0373927_0041187 | Ga0373927_0041187_639_1172 | 177 |
| 428 | 3300035695 | Ga0373927_0106806 | Ga0373927_0106806_491_1024 | 177 |
| 429 | 3300035724 | Ga0373933_0183204 | Ga0373933_0183204_49_582 | 177 |
| 430 | 3300035724 | Ga0373933_0390031 | Ga0373933_0390031_102_635 | 177 |
| 431 | 3300035725 | Ga0373947_0058372 | Ga0373947_0058372_1390_1923 | 177 |
| 432 | 3300035725 | Ga0373947_0188861 | Ga0373947_0188861_162_695 | 177 |
| 433 | 3300036401 | Ga0373937_0021580 | Ga0373937_0021580_3643_4176 | 177 |
| 434 | 3300036401 | Ga0373937_0040264 | Ga0373937_0040264_1440_1973 | 177 |
| 435 | 3300037068 | Ga0373925_0502642 | Ga0373925_0502642_348_881 | 177 |
| 436 | 3300037068 | Ga0373925_0630749 | Ga0373925_0630749_234_767 | 177 |
| 437 | 3300037068 | Ga0373925_1267021 | Ga0373925_1267021_49_582 | 177 |
| 438 | 3300037312 | Ga0395899_0000406 | Ga0395899_0000406_49312_49845 | 177 |
| 439 | 3300037312 | Ga0395899_0066694 | Ga0395899_0066694_966_1499 | 177 |
| 440 | 3300037418 | Ga0395900_0021199 | Ga0395900_0021199_1192_1725 | 177 |
| 441 | 3300037418 | Ga0395900_0056306 | Ga0395900_0056306_242_775 | 177 |
| 442 | 3300037418 | Ga0395900_0506830 | Ga0395900_0506830_345_878 | 177 |
| 443 | 3300037466 | Ga0395898_0126504 | Ga0395898_0126504_1221_1754 | 177 |
| 444 | 3300037466 | Ga0395898_0137366 | Ga0395898_0137366_1414_1947 | 177 |
| 445 | 3300037466 | Ga0395898_0222452 | Ga0395898_0222452_289_822 | 177 |
| 446 | 3300037853 | Ga0436364_0163040 | Ga0436364_0163040_70_603 | 177 |
| 447 | 3300037853 | Ga0436364_0471401 | Ga0436364_0471401_668_1201 | 177 |
| 448 | 3300038443 | Ga0395901_0097542 | Ga0395901_0097542_2151_2684 | 177 |
| 449 | 3300038443 | Ga0395901_0177540 | Ga0395901_0177540_1188_1721 | 177 |
| 450 | 3300038443 | Ga0395901_0978377 | Ga0395901_0978377_34_567 | 177 |
| 451 | 3300038726 | Ga0400490_23185 | Ga0400490_23185_213_749 | 177 |
| 452 | 3300038742 | Ga0400486_03338 | Ga0400486_03338_512_1048 | 177 |
| 453 | 3300038742 | Ga0400486_26153 | Ga0400486_26153_534_1070 | 177 |
| 454 | 3300039437 | Ga0436365_0802220 | Ga0436365_0802220_861_1394 | 177 |
| 455 | 3300039437 | Ga0436365_1609996 | Ga0436365_1609996_1821_2354 | 177 |
| 456 | 3300039438 | Ga0436360_0447412 | Ga0436360_0447412_534_1067 | 177 |
| 457 | 3300039450 | Ga0436363_1616367 | Ga0436363_1616367_717_1250 | 177 |
| 458 | 3300039453 | Ga0436362_0662105 | Ga0436362_0662105_359_892 | 177 |
| 459 | 3300039453 | Ga0436362_0857492 | Ga0436362_0857492_160_696 | 177 |
| 460 | 3300041411 | Ga0439466_0074454 | Ga0439466_0074454_471_1004 | 177 |
| 461 | 3300041462 | Ga0451806_367681 | Ga0451806_367681_1288_1821 | 177 |
| 462 | 3300041486 | Ga0451807_1991054 | Ga0451807_1991054_1003_1536 | 177 |
| 463 | 3300041512 | Ga0451853_0019999 | Ga0451853_0019999_101_634 | 177 |
| 464 | 3300042006 | Ga0439432_096371 | Ga0439432_096371_310_843 | 177 |
| 465 | 3300042012 | Ga0439455_0006431 | Ga0439455_0006431_928_1461 | 177 |
| 466 | 3300042157 | Ga0439458_0004227 | Ga0439458_0004227_1010_1543 | 177 |
| 467 | 3300042435 | Ga0439434_0017101 | Ga0439434_0017101_1432_1965 | 177 |
| 468 | 3300044656 | Ga0466969_0095238 | Ga0466969_0095238_795_1328 | 177 |
| 469 | 3300044658 | Ga0466972_0022049 | Ga0466972_0022049_2575_3108 | 177 |
| 470 | 3300044683 | Ga0466965_0245619 | Ga0466965_0245619_96_629 | 177 |
| 471 | 3300044684 | Ga0466966_0032002 | Ga0466966_0032002_2574_3107 | 177 |
| 472 | 3300044684 | Ga0466966_0175993 | Ga0466966_0175993_213_746 | 177 |
| 473 | 3300044693 | Ga0466961_0078638 | Ga0466961_0078638_899_1432 | 177 |
| 474 | 3300044693 | Ga0466961_0116483 | Ga0466961_0116483_744_1277 | 177 |
| 475 | 3300044694 | Ga0466963_0015793 | Ga0466963_0015793_624_1157 | 177 |
| 476 | 3300044694 | Ga0466963_0021397 | Ga0466963_0021397_1277_1810 | 177 |
| 477 | 3300044706 | Ga0466964_0045974 | Ga0466964_0045974_177_710 | 177 |
| 478 | 3300044719 | Ga0466971_0204777 | Ga0466971_0204777_214_747 | 177 |
| 479 | 3300044842 | Ga0466957_0059645 | Ga0466957_0059645_440_973 | 177 |
| 480 | 3300044842 | Ga0466957_0090325 | Ga0466957_0090325_172_705 | 177 |
| 481 | 3300044842 | Ga0466957_0133264 | Ga0466957_0133264_306_839 | 177 |
| 482 | 3300044842 | Ga0466957_0213535 | Ga0466957_0213535_314_847 | 177 |
| 483 | 3300044901 | Ga0466960_0025122 | Ga0466960_0025122_1135_1668 | 177 |
| 484 | 3300045049 | Ga0466959_0030393 | Ga0466959_0030393_1077_1610 | 177 |
| 485 | 3300045049 | Ga0466959_0123080 | Ga0466959_0123080_465_998 | 177 |
| 486 | 3300045049 | Ga0466959_0131651 | Ga0466959_0131651_817_1350 | 177 |
| 487 | 3300045836 | Ga0466958_0159500 | Ga0466958_0159500_592_1125 | 177 |
| 488 | 3300046455 | Ga0495603_0346918 | Ga0495603_0346918_247_780 | 177 |
| 489 | 3300046459 | Ga0495629_0453662 | Ga0495629_0453662_222_755 | 177 |
| 490 | 3300046462 | Ga0495651_0123417 | Ga0495651_0123417_118_651 | 177 |
| 491 | 3300046477 | Ga0495664_0221638 | Ga0495664_0221638_205_738 | 177 |
| 492 | 3300046499 | Ga0495594_0339772 | Ga0495594_0339772_215_748 | 177 |
| 493 | 3300046512 | Ga0495610_0018183 | Ga0495610_0018183_700_1233 | 177 |
| 494 | 3300046520 | Ga0495637_0020520 | Ga0495637_0020520_1787_2320 | 177 |
| 495 | 3300046529 | Ga0495652_0178964 | Ga0495652_0178964_240_773 | 177 |
| 496 | 3300046533 | Ga0495640_0284484 | Ga0495640_0284484_22_555 | 177 |
| 497 | 3300046536 | Ga0495587_0067952 | Ga0495587_0067952_501_1034 | 177 |
| 498 | 3300046559 | Ga0495667_0062276 | Ga0495667_0062276_1231_1764 | 177 |
| 499 | 3300046559 | Ga0495667_0111752 | Ga0495667_0111752_1136_1669 | 177 |
| 500 | 3300046559 | Ga0495667_0494739 | Ga0495667_0494739_217_750 | 177 |
| 501 | 3300046642 | Ga0495634_0076021 | Ga0495634_0076021_346_879 | 177 |
| 502 | 3300046648 | Ga0495611_0020624 | Ga0495611_0020624_92_625 | 177 |
| 503 | 3300046660 | Ga0495625_0237448 | Ga0495625_0237448_272_805 | 177 |
| 504 | 3300046663 | Ga0495635_0060092 | Ga0495635_0060092_1491_2024 | 177 |
| 505 | 3300046663 | Ga0495635_0404725 | Ga0495635_0404725_28_561 | 177 |
| 506 | 3300046675 | Ga0495657_0061609 | Ga0495657_0061609_783_1316 | 177 |
| 507 | 3300046675 | Ga0495657_0323554 | Ga0495657_0323554_247_780 | 177 |
| 508 | 3300046683 | Ga0495658_0173008 | Ga0495658_0173008_172_705 | 177 |
| 509 | 3300046689 | Ga0495613_0539447 | Ga0495613_0539447_14_547 | 177 |
| 510 | 3300047317 | Ga0495604_0072755 | Ga0495604_0072755_1252_1785 | 177 |
| 511 | 3300047320 | Ga0495672_0068822 | Ga0495672_0068822_959_1492 | 177 |
| 512 | 3300047320 | Ga0495672_0117197 | Ga0495672_0117197_22_555 | 177 |
| 513 | 3300047322 | Ga0495680_0036997 | Ga0495680_0036997_1521_2054 | 177 |
| 514 | 3300047323 | Ga0495683_0108972 | Ga0495683_0108972_700_1233 | 177 |
| 515 | 3300047444 | Ga0495675_0041019 | Ga0495675_0041019_2202_2735 | 177 |
| 516 | 3300047444 | Ga0495675_0058272 | Ga0495675_0058272_1536_2069 | 177 |
| 517 | 3300047471 | Ga0495684_0139724 | Ga0495684_0139724_741_1274 | 177 |
| 518 | 3300047471 | Ga0495684_0184135 | Ga0495684_0184135_331_864 | 177 |
| 519 | 3300047472 | Ga0495686_0274513 | Ga0495686_0274513_346_879 | 177 |
| 520 | 3300047673 | Ga0495593_0035371 | Ga0495593_0035371_343_876 | 177 |
| 521 | 3300048088 | Ga0495602_0092509 | Ga0495602_0092509_1162_1695 | 177 |
| 522 | 3300048903 | Ga0496100_0027698 | Ga0496100_0027698_412_945 | 177 |
| 523 | 3300048904 | Ga0496101_0114970 | Ga0496101_0114970_910_1443 | 177 |
| 524 | 3300048905 | Ga0496102_0033525 | Ga0496102_0033525_250_783 | 177 |
| 525 | 3300048905 | Ga0496102_0099939 | Ga0496102_0099939_1764_2297 | 177 |
| 526 | 3300048907 | Ga0496104_0002521 | Ga0496104_0002521_6597_7130 | 177 |
| 527 | 3300048907 | Ga0496104_0017958 | Ga0496104_0017958_3003_3536 | 177 |
| 528 | 3300048907 | Ga0496104_0050054 | Ga0496104_0050054_846_1379 | 177 |
| 529 | 3300048908 | Ga0496105_0006441 | Ga0496105_0006441_4556_5089 | 177 |
| 530 | 3300048908 | Ga0496105_0021595 | Ga0496105_0021595_4346_4879 | 177 |
| 531 | 3300048908 | Ga0496105_0360202 | Ga0496105_0360202_150_683 | 177 |
| 532 | 3300048910 | Ga0496107_0135875 | Ga0496107_0135875_815_1348 | 177 |
| 533 | 3300048910 | Ga0496107_0179092 | Ga0496107_0179092_898_1431 | 177 |
| 534 | 3300048911 | Ga0496108_0001133 | Ga0496108_0001133_6958_7491 | 177 |
| 535 | 3300048911 | Ga0496108_0015644 | Ga0496108_0015644_1898_2431 | 177 |
| 536 | 3300048911 | Ga0496108_0027712 | Ga0496108_0027712_985_1518 | 177 |
| 537 | 3300048912 | Ga0496109_0000583 | Ga0496109_0000583_5371_5904 | 177 |
| 538 | 3300048912 | Ga0496109_0013351 | Ga0496109_0013351_5089_5622 | 177 |
| 539 | 3300048913 | Ga0496110_0004757 | Ga0496110_0004757_4641_5174 | 177 |
| 540 | 3300048913 | Ga0496110_0013967 | Ga0496110_0013967_5616_6149 | 177 |
| 541 | 3300048913 | Ga0496110_0033920 | Ga0496110_0033920_573_1106 | 177 |
| 542 | 3300048914 | Ga0496111_0002980 | Ga0496111_0002980_7237_7770 | 177 |
| 543 | 3300048914 | Ga0496111_0541575 | Ga0496111_0541575_25_558 | 177 |
| 544 | 3300048915 | Ga0496112_0000884 | Ga0496112_0000884_20595_21128 | 177 |
| 545 | 3300048915 | Ga0496112_0002152 | Ga0496112_0002152_4001_4534 | 177 |
| 546 | 3300048916 | Ga0496113_0000351 | Ga0496113_0000351_300_833 | 177 |
| 547 | 3300048916 | Ga0496113_0001829 | Ga0496113_0001829_121_654 | 177 |
| 548 | 3300048916 | Ga0496113_0005226 | Ga0496113_0005226_1420_1953 | 177 |
| 549 | 3300048917 | Ga0496114_0077198 | Ga0496114_0077198_1663_2196 | 177 |
| 550 | 3300048917 | Ga0496114_0139896 | Ga0496114_0139896_848_1381 | 177 |
| 551 | 3300048917 | Ga0496114_0313078 | Ga0496114_0313078_194_727 | 177 |
| 552 | 3300048917 | Ga0496114_0447658 | Ga0496114_0447658_567_1100 | 177 |
| 553 | 3300048918 | Ga0496115_0009751 | Ga0496115_0009751_5970_6503 | 177 |
| 554 | 3300048918 | Ga0496115_0129762 | Ga0496115_0129762_1023_1556 | 177 |
| 555 | 3300048918 | Ga0496115_0361216 | Ga0496115_0361216_56_589 | 177 |
| 556 | 3300048918 | Ga0496115_0520969 | Ga0496115_0520969_189_722 | 177 |
| 557 | 3300048920 | Ga0496117_0077019 | Ga0496117_0077019_777_1310 | 177 |
| 558 | 3300048921 | Ga0496118_0017136 | Ga0496118_0017136_5277_5810 | 177 |
| 559 | 3300048921 | Ga0496118_0040427 | Ga0496118_0040427_2064_2597 | 177 |
| 560 | 3300048921 | Ga0496118_0089244 | Ga0496118_0089244_395_928 | 177 |
| 561 | 3300048923 | Ga0496120_0155211 | Ga0496120_0155211_446_979 | 177 |
| 562 | 3300048924 | Ga0496121_0373689 | Ga0496121_0373689_395_928 | 177 |
| 563 | 3300048925 | Ga0496122_0055074 | Ga0496122_0055074_1459_1992 | 177 |
| 564 | 3300048926 | Ga0496123_0074841 | Ga0496123_0074841_673_1206 | 177 |
| 565 | 3300048928 | Ga0496125_0052234 | Ga0496125_0052234_1653_2186 | 177 |
| 566 | 3300049570 | Ga0501033_0224530 | Ga0501033_0224530_377_910 | 177 |
| 567 | 3300049571 | Ga0501034_0132045 | Ga0501034_0132045_51_584 | 177 |
| 568 | 3300049571 | Ga0501034_0277504 | Ga0501034_0277504_684_1217 | 177 |
| 569 | 3300049571 | Ga0501034_0285152 | Ga0501034_0285152_621_1154 | 177 |
| 570 | 3300049572 | Ga0501036_0311249 | Ga0501036_0311249_202_735 | 177 |
| 571 | 3300049573 | Ga0501037_0069329 | Ga0501037_0069329_1941_2474 | 177 |
| 572 | 3300049579 | Ga0501043_0251795 | Ga0501043_0251795_677_1210 | 177 |
| 573 | 3300049581 | Ga0501047_0000235 | Ga0501047_0000235_56298_56831 | 177 |
| 574 | 3300049581 | Ga0501047_0074415 | Ga0501047_0074415_1219_1752 | 177 |
| 575 | 3300049581 | Ga0501047_0466122 | Ga0501047_0466122_270_803 | 177 |
| 576 | 3300049582 | Ga0501048_0093362 | Ga0501048_0093362_244_777 | 177 |
| 577 | 3300049586 | Ga0501070_0199045 | Ga0501070_0199045_412_945 | 177 |
| 578 | 3300049589 | Ga0501073_0494686 | Ga0501073_0494686_259_792 | 177 |
| 579 | 3300049590 | Ga0501074_0002757 | Ga0501074_0002757_6709_7242 | 177 |
| 580 | 3300049590 | Ga0501074_0338521 | Ga0501074_0338521_59_592 | 177 |
| 581 | 3300049591 | Ga0501075_0070033 | Ga0501075_0070033_110_643 | 177 |
| 582 | 3300049592 | Ga0501076_0097296 | Ga0501076_0097296_810_1343 | 177 |
| 583 | 3300049592 | Ga0501076_0166011 | Ga0501076_0166011_1239_1772 | 177 |
| 584 | 3300049741 | Ga0501079_0102385 | Ga0501079_0102385_1492_2025 | 177 |
| 585 | 3300049742 | Ga0501080_0013397 | Ga0501080_0013397_1610_2143 | 177 |
| 586 | 3300049742 | Ga0501080_0360541 | Ga0501080_0360541_113_646 | 177 |
| 587 | 3300049744 | Ga0501083_0004993 | Ga0501083_0004993_5380_5913 | 177 |
| 588 | 3300049822 | Ga0501035_0351152 | Ga0501035_0351152_61_594 | 177 |
| 589 | 3300049822 | Ga0501035_0985448 | Ga0501035_0985448_120_653 | 177 |
| 590 | 3300049823 | Ga0501044_0055624 | Ga0501044_0055624_3198_3731 | 177 |
| 591 | 3300049823 | Ga0501044_0061936 | Ga0501044_0061936_1180_1713 | 177 |
| 592 | 3300049823 | Ga0501044_0076620 | Ga0501044_0076620_884_1417 | 177 |
| 593 | 3300049823 | Ga0501044_0122636 | Ga0501044_0122636_1947_2480 | 177 |
| 594 | 3300049823 | Ga0501044_0288837 | Ga0501044_0288837_328_861 | 177 |
| 595 | 3300049824 | Ga0501045_0077461 | Ga0501045_0077461_509_1042 | 177 |
| 596 | 3300050489 | nmdc:mga03683_382221_c1 | nmdc:mga03683_382221_c1_85_618 | 177 |
| 597 | 3300050493 | nmdc:mga0k408_161964_c1 | nmdc:mga0k408_161964_c1_150_683 | 177 |
| 598 | 3300050507 | nmdc:mga05p37_193059_c1 | nmdc:mga05p37_193059_c1_968_1501 | 177 |
| 599 | 3300050507 | nmdc:mga05p37_208661_c1 | nmdc:mga05p37_208661_c1_1425_1958 | 177 |
| 600 | 3300050507 | nmdc:mga05p37_41651_c1 | nmdc:mga05p37_41651_c1_4501_5034 | 177 |
| 601 | 3300050508 | nmdc:mga09592_134808_c1 | nmdc:mga09592_134808_c1_532_1065 | 177 |
| 602 | 3300050509 | nmdc:mga0qj67_398999_c1 | nmdc:mga0qj67_398999_c1_280_813 | 177 |
| 603 | 3300050510 | nmdc:mga06r32_388937_c1 | nmdc:mga06r32_388937_c1_258_791 | 177 |
| 604 | 3300050511 | nmdc:mga08y16_96065_c1 | nmdc:mga08y16_96065_c1_463_996 | 177 |
| 605 | 3300050512 | nmdc:mga0n895_78493_c1 | nmdc:mga0n895_78493_c1_29_562 | 177 |
| 606 | 3300050513 | nmdc:mga0rr50_433776_c1 | nmdc:mga0rr50_433776_c1_208_741 | 177 |
| 607 | 3300050514 | nmdc:mga08x19_23_c1 | nmdc:mga08x19_23_c1_108755_109288 | 177 |
| 608 | 3300050515 | nmdc:mga0a205_185339_c1 | nmdc:mga0a205_185339_c1_1127_1660 | 177 |
| 609 | 3300053077 | Ga0495601_0509942 | Ga0495601_0509942_46_579 | 177 |
| 610 | 3300053078 | Ga0495612_0022709 | Ga0495612_0022709_1220_1753 | 177 |
| 611 | 3300053084 | Ga0495595_0012728 | Ga0495595_0012728_2315_2848 | 177 |
| 612 | 3300053084 | Ga0495595_0017179 | Ga0495595_0017179_29_562 | 177 |
| 613 | 3300053085 | Ga0495619_0008778 | Ga0495619_0008778_5830_6363 | 177 |
| 614 | 3300053085 | Ga0495619_0097132 | Ga0495619_0097132_715_1248 | 177 |
| 615 | 3300053085 | Ga0495619_0115427 | Ga0495619_0115427_577_1110 | 177 |
| 616 | 3300053096 | Ga0500641_0007663 | Ga0500641_0007663_1791_2324 | 177 |
| 617 | 3300053117 | Ga0500593_000058 | Ga0500593_000058_7621_8154 | 177 |
| 618 | 3300053122 | Ga0500608_041046 | Ga0500608_041046_1208_1741 | 177 |
| 619 | 3300053130 | Ga0500642_0080296 | Ga0500642_0080296_748_1281 | 177 |
| 620 | 3300053133 | Ga0500655_000265 | Ga0500655_000265_8504_9037 | 177 |
| 621 | 3300053139 | Ga0500568_0000001 | Ga0500568_0000001_8353_8886 | 177 |
| 622 | 3300053142 | Ga0500577_0040810 | Ga0500577_0040810_191_724 | 177 |
| 623 | 3300053142 | Ga0500577_0094396 | Ga0500577_0094396_246_779 | 177 |
| 624 | 3300053148 | Ga0500590_015132 | Ga0500590_015132_2564_3097 | 177 |
| 625 | 3300053153 | Ga0500616_0050068 | Ga0500616_0050068_708_1241 | 177 |
| 626 | 3300053156 | Ga0500622_0039247 | Ga0500622_0039247_801_1334 | 177 |
| 627 | 3300053177 | Ga0500636_0029625 | Ga0500636_0029625_927_1460 | 177 |
| 628 | 3300054114 | Ga0501084_0275420 | Ga0501084_0275420_517_1050 | 177 |
| 629 | 3300059477 | Ga0587084_004230 | Ga0587084_004230_969_1502 | 177 |
| 630 | 3300059623 | Ga0587101_021594 | Ga0587101_021594_256_789 | 177 |
| 631 | 3300059641 | Ga0587068_000630 | Ga0587068_000630_339_872 | 177 |
| 632 | 3300059642 | Ga0587069_011022 | Ga0587069_011022_194_727 | 177 |
| 633 | 3300059647 | Ga0587079_002261 | Ga0587079_002261_37_570 | 177 |
| 634 | 3300061719 | Ga0466962_0043530 | Ga0466962_0043530_1275_1808 | 177 |
| 635 | 3300061719 | Ga0466962_0078938 | Ga0466962_0078938_251_784 | 177 |
| 636 | 3300061719 | Ga0466962_0248959 | Ga0466962_0248959_44_577 | 177 |
| 637 | 3300061734 | Ga0530510_0097213 | Ga0530510_0097213_236_769 | 177 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6v3b-assembly1.cif.gz_G | cryo-em structure of the acinetobacter baumannii ribosome: 70s in empty state | 0.9647 | 7 | 175 |
| 6yef-assembly1.cif.gz_H | 70s initiation complex with assigned rrna modifications from staphylococcus aureus | 0.9643 | 9 | 169 |
| 5li0-assembly1.cif.gz_H | 70s ribosome from staphylococcus aureus | 0.9619 | 9 | 171 |
| 5x8t-assembly1.cif.gz_G | structure of the 50s large subunit of chloroplast ribosome from spinach | 0.9596 | 3 | 174 |
| 7nhn-assembly1.cif.gz_K | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9593 | 9 | 173 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6AU10_7_103_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9551 | 85 | 177 | 3.90.930.12 |
| 3knmH02 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9538 | 83 | 167 | 3.90.930.12 |
| af_O21037_77_170_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9524 | 83 | 177 | 3.90.930.12 |
| af_Q25814_82_167_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9492 | 83 | 164 | 3.90.930.12 |
| 4g5lH02 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9491 | 83 | 169 | 3.90.930.12 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2J1D431-F1-model_v4 | deleted | 0.9914 | 74 | 168 |
|
| AF-Q7Y029-F1-model_v4 | Ribosomal protein CtrL6e, 5'-partial | 0.987 | 71 | 175 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A453I2C9-F1-model_v4 | Large ribosomal subunit protein uL6 alpha-beta domain-containing protein | 0.9868 | 66 | 175 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A5K0W5Y2-F1-model_v4 | Large ribosomal subunit protein uL6 alpha-beta domain-containing protein | 0.9846 | 71 | 175 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A645DGU1-F1-model_v4 | 50S ribosomal protein L6 | 0.9835 | 55 | 175 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar