F471360

General Info

Members Datasets Scaffolds Average Seq Length
636 274 1272 159

Family's Representative Sequence

Representative Sequence 3300038741|Ga0400488_46387|Ga0400488_46387_757_1245
Length 162
Sequence MIGMGERMEREQNDERLFKVINDMFNEKIPFNKVLGLKVASIGYQRVKVRFDMRDELIGNYIRGALHGGVISSVVDVTGGLAAFMGIQEKIFDRDLDAKLERFGRLGTIDLRVDYLRPGIGESFVSTGYTLRTGNKVAVARIELINDRDDLIAVGTGSYVVA

Samples

Sample ID Description Type Environment
1 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
163 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
164 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
165 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
166 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
171 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
180 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
181 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
185 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
190 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
195 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
196 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
197 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
198 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
199 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
203 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
204 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
205 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
206 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
207 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
208 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
209 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
210 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
211 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
212 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
213 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
214 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
215 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
216 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
217 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
218 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
219 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
220 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
230 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
231 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
232 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
260 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
261 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
262 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
263 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
265 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
266 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
269 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
274 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.16
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.89
Nodule 0
Rhizoplane 3.62
Rhizosphere 91.35
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400488_46387 3300038741 Bacteria 1522
2 Ga0055540_1004095 3300003792 Bacteria 6752
3 Ga0070658_10039717 3300005327 Bacteria 3797
4 Ga0070658_10138924 3300005327 Bacteria 2029
5 Ga0070658_10537937 3300005327 Bacteria 1011
6 Ga0070676_10006485 3300005328 Bacteria 6252
7 Ga0070676_10023281 3300005328 Bacteria 3480
8 Ga0070676_10027180 3300005328 Bacteria 3243
9 Ga0070676_10125192 3300005328 Bacteria 1618
10 Ga0070676_10266583 3300005328 Bacteria 1149
11 Ga0070683_100137139 3300005329 Bacteria 2317
12 Ga0070683_100162158 3300005329 Bacteria 2121
13 Ga0070690_100008044 3300005330 Bacteria 6054
14 Ga0070690_100049047 3300005330 Bacteria 2690
15 Ga0070690_100197915 3300005330 Bacteria 1397
16 Ga0070670_100013736 3300005331 Bacteria 6939
17 Ga0070670_100074055 3300005331 Bacteria 2925
18 Ga0070670_100088289 3300005331 Bacteria 2665
19 Ga0070670_100183217 3300005331 Bacteria 1818
20 Ga0070670_100200468 3300005331 Bacteria 1734
21 Ga0070670_100315299 3300005331 Bacteria 1369
22 Ga0070670_100352243 3300005331 Bacteria 1293
23 Ga0070670_100397374 3300005331 Bacteria 1216
24 Ga0070670_100411174 3300005331 Bacteria 1195
25 Ga0070677_10024396 3300005333 Bacteria 2248
26 Ga0070677_10095018 3300005333 Bacteria 1304
27 Ga0070677_10110841 3300005333 Bacteria 1225
28 Ga0068869_100010577 3300005334 Bacteria 6022
29 Ga0068869_100069669 3300005334 Bacteria 2601
30 Ga0068869_100246308 3300005334 Bacteria 1426
31 Ga0068869_100248795 3300005334 Bacteria 1419
32 Ga0068869_100822545 3300005334 Bacteria 800
33 Ga0070666_10003031 3300005335 Bacteria 10191
34 Ga0070666_10044715 3300005335 Bacteria 2967
35 Ga0070680_100015316 3300005336 Bacteria 6008
36 Ga0070682_100353937 3300005337 Bacteria 1096
37 Ga0068868_100012611 3300005338 Bacteria 6181
38 Ga0068868_100015421 3300005338 Bacteria 5652
39 Ga0068868_100137482 3300005338 Bacteria 2004
40 Ga0068868_101012219 3300005338 Bacteria 761
41 Ga0068868_101060814 3300005338 Bacteria 744
42 Ga0070660_100011152 3300005339 Bacteria 6375
43 Ga0070660_100142198 3300005339 Bacteria 1926
44 Ga0070689_100049166 3300005340 Bacteria 3255
45 Ga0070689_100465582 3300005340 Bacteria 1078
46 Ga0070687_100023337 3300005343 Bacteria 2939
47 Ga0070687_100264834 3300005343 Bacteria 1074
48 Ga0070661_100133441 3300005344 Bacteria 1866
49 Ga0070661_100155924 3300005344 Bacteria 1727
50 Ga0070661_100268433 3300005344 Bacteria 1321
51 Ga0070661_100298369 3300005344 Bacteria 1254
52 Ga0070661_100563800 3300005344 Bacteria 918
53 Ga0070661_100686322 3300005344 Bacteria 833
54 Ga0070661_100894367 3300005344 Bacteria 733
55 Ga0070692_10196880 3300005345 Bacteria 1178
56 Ga0070668_100030426 3300005347 Bacteria 4104
57 Ga0070668_100049242 3300005347 Bacteria 3242
58 Ga0070668_100243751 3300005347 Bacteria 1490
59 Ga0070669_100010855 3300005353 Bacteria 6465
60 Ga0070669_100012281 3300005353 Bacteria 6077
61 Ga0070669_100020857 3300005353 Bacteria 4681
62 Ga0070669_100107813 3300005353 Bacteria 2110
63 Ga0070669_100240948 3300005353 Bacteria 1437
64 Ga0070675_100000999 3300005354 Bacteria 20281
65 Ga0070675_100001451 3300005354 Bacteria 17451
66 Ga0070675_100007384 3300005354 Bacteria 8488
67 Ga0070675_100018860 3300005354 Bacteria 5493
68 Ga0070675_100027238 3300005354 Bacteria 4591
69 Ga0070675_100107255 3300005354 Bacteria 2358
70 Ga0070675_100229652 3300005354 Bacteria 1618
71 Ga0070675_100327379 3300005354 Bacteria 1354
72 Ga0070675_100390623 3300005354 Bacteria 1240
73 Ga0070671_100002875 3300005355 Bacteria 13400
74 Ga0070671_100006189 3300005355 Bacteria 9536
75 Ga0070671_100081289 3300005355 Bacteria 2709
76 Ga0070671_100133250 3300005355 Bacteria 2093
77 Ga0070671_100157216 3300005355 Bacteria 1921
78 Ga0070671_100180741 3300005355 Bacteria 1785
79 Ga0070671_100221354 3300005355 Bacteria 1605
80 Ga0070671_100324759 3300005355 Bacteria 1312
81 Ga0070671_100362437 3300005355 Bacteria 1238
82 Ga0070671_100584902 3300005355 Bacteria 964
83 Ga0070671_101271561 3300005355 Bacteria 649
84 Ga0070674_100011541 3300005356 Bacteria 5384
85 Ga0070674_100087517 3300005356 Bacteria 2240
86 Ga0070674_100218436 3300005356 Bacteria 1482
87 Ga0070674_100723081 3300005356 Bacteria 853
88 Ga0070673_100002945 3300005364 Bacteria 10493
89 Ga0070673_100006013 3300005364 Bacteria 7856
90 Ga0070673_100028410 3300005364 Bacteria 4159
91 Ga0070673_100558590 3300005364 Bacteria 1040
92 Ga0070673_101702736 3300005364 Bacteria 597
93 Ga0070688_100100208 3300005365 Bacteria 1909
94 Ga0070659_100014656 3300005366 Bacteria 5862
95 Ga0070659_100190956 3300005366 Bacteria 1683
96 Ga0070659_100383821 3300005366 Bacteria 1183
97 Ga0070667_100004597 3300005367 Bacteria 11595
98 Ga0070667_100019155 3300005367 Bacteria 5676
99 Ga0070667_100025606 3300005367 Bacteria 4905
100 Ga0070667_100027275 3300005367 Bacteria 4752
101 Ga0070667_100040940 3300005367 Bacteria 3886
102 Ga0070667_100252237 3300005367 Bacteria 1578
103 Ga0070714_100880960 3300005435 Bacteria 869
104 Ga0070701_10903856 3300005438 Bacteria 610
105 Ga0070700_100019405 3300005441 Bacteria 3923
106 Ga0070700_100072458 3300005441 Bacteria 2202
107 Ga0070700_100267746 3300005441 Bacteria 1233
108 Ga0070700_100313515 3300005441 Bacteria 1150
109 Ga0070694_100985529 3300005444 Bacteria 699
110 Ga0070663_100019366 3300005455 Bacteria 4483
111 Ga0070663_100430672 3300005455 Bacteria 1084
112 Ga0070663_100550196 3300005455 Bacteria 965
113 Ga0070663_100580178 3300005455 Bacteria 941
114 Ga0070663_100684241 3300005455 Bacteria 870
115 Ga0070678_100039063 3300005456 Bacteria 3346
116 Ga0070678_100070416 3300005456 Bacteria 2614
117 Ga0070678_100188782 3300005456 Bacteria 1693
118 Ga0070678_100443771 3300005456 Bacteria 1135
119 Ga0070678_100880464 3300005456 Bacteria 817
120 Ga0070678_100953786 3300005456 Bacteria 786
121 Ga0070678_101221607 3300005456 Bacteria 697
122 Ga0070678_101432775 3300005456 Bacteria 645
123 Ga0070662_100000852 3300005457 Bacteria 18755
124 Ga0070662_100014068 3300005457 Bacteria 5336
125 Ga0070662_100168196 3300005457 Bacteria 1720
126 Ga0070662_100833976 3300005457 Bacteria 785
127 Ga0070681_10057209 3300005458 Bacteria 3880
128 Ga0068867_100003473 3300005459 Bacteria 11082
129 Ga0068867_100025105 3300005459 Bacteria 4275
130 Ga0068867_100051313 3300005459 Bacteria 3042
131 Ga0068867_100181071 3300005459 Bacteria 1676
132 Ga0068867_100214348 3300005459 Bacteria 1548
133 Ga0068867_101290704 3300005459 Bacteria 674
134 Ga0068867_101315084 3300005459 Bacteria 668
135 Ga0070685_10103017 3300005466 Bacteria 1746
136 Ga0070706_101673541 3300005467 Bacteria 580
137 Ga0070679_100003657 3300005530 Bacteria 14078
138 Ga0070684_100055767 3300005535 Bacteria 3446
139 Ga0068853_100009156 3300005539 Bacteria 7975
140 Ga0068853_100145163 3300005539 Bacteria 2132
141 Ga0068853_100800339 3300005539 Bacteria 903
142 Ga0070672_100011872 3300005543 Bacteria 6088
143 Ga0070672_100013081 3300005543 Bacteria 5849
144 Ga0070672_100053576 3300005543 Bacteria 3154
145 Ga0070672_100066161 3300005543 Bacteria 2861
146 Ga0070672_100071715 3300005543 Bacteria 2756
147 Ga0070672_100151197 3300005543 Bacteria 1920
148 Ga0070672_100181014 3300005543 Bacteria 1756
149 Ga0070672_100187738 3300005543 Bacteria 1725
150 Ga0070672_100233006 3300005543 Bacteria 1547
151 Ga0070672_100612787 3300005543 Bacteria 949
152 Ga0070672_100965111 3300005543 Bacteria 754
153 Ga0070672_101152926 3300005543 Bacteria 690
154 Ga0070686_100044562 3300005544 Bacteria 2789
155 Ga0070686_100046826 3300005544 Bacteria 2731
156 Ga0070686_100139345 3300005544 Bacteria 1687
157 Ga0070693_100028199 3300005547 Bacteria 3050
158 Ga0070665_100783313 3300005548 Bacteria 967
159 Ga0070665_101785079 3300005548 Bacteria 622
160 Ga0068855_100191742 3300005563 Bacteria 2305
161 Ga0068855_100710558 3300005563 Bacteria 1075
162 Ga0070664_100063745 3300005564 Bacteria 3142
163 Ga0070664_100202359 3300005564 Bacteria 1772
164 Ga0070664_100224804 3300005564 Bacteria 1680
165 Ga0070664_100729028 3300005564 Bacteria 924
166 Ga0070664_100772570 3300005564 Bacteria 897
167 Ga0070664_101386265 3300005564 Bacteria 664
168 Ga0068857_100130785 3300005577 Bacteria 2264
169 Ga0068857_100522742 3300005577 Bacteria 1115
170 Ga0068857_101082619 3300005577 Bacteria 773
171 Ga0068854_100121749 3300005578 Bacteria 1982
172 Ga0068854_100174935 3300005578 Bacteria 1673
173 Ga0068856_100101394 3300005614 Bacteria 2871
174 Ga0068856_100254403 3300005614 Bacteria 1771
175 Ga0068856_101332555 3300005614 Bacteria 733
176 Ga0070702_100144182 3300005615 Bacteria 1521
177 Ga0070702_100589186 3300005615 Bacteria 832
178 Ga0068852_100007738 3300005616 Bacteria 7859
179 Ga0068852_100034224 3300005616 Bacteria 4225
180 Ga0068852_100096398 3300005616 Bacteria 2659
181 Ga0068852_100116682 3300005616 Bacteria 2436
182 Ga0068852_100118914 3300005616 Bacteria 2415
183 Ga0068852_100558415 3300005616 Bacteria 1146
184 Ga0068852_101818274 3300005616 Bacteria 631
185 Ga0068859_100000664 3300005617 Bacteria 34524
186 Ga0068859_100266119 3300005617 Bacteria 1806
187 Ga0068864_100000649 3300005618 Bacteria 29069
188 Ga0068864_100086390 3300005618 Bacteria 2759
189 Ga0068864_100161277 3300005618 Bacteria 2038
190 Ga0068864_100186310 3300005618 Bacteria 1900
191 Ga0068864_100852769 3300005618 Bacteria 898
192 Ga0068866_10002567 3300005718 Bacteria 7491
193 Ga0068861_100003388 3300005719 Bacteria 10574
194 Ga0068861_100036004 3300005719 Bacteria 3670
195 Ga0068851_10003642 3300005834 Bacteria 6878
196 Ga0068851_10012471 3300005834 Bacteria 4008
197 Ga0068851_10197061 3300005834 Bacteria 1122
198 Ga0068851_10236942 3300005834 Bacteria 1030
199 Ga0068870_10084860 3300005840 Bacteria 1759
200 Ga0068870_10290826 3300005840 Bacteria 1028
201 Ga0068870_10477665 3300005840 Bacteria 827
202 Ga0068863_100011555 3300005841 Bacteria 8541
203 Ga0068863_100022728 3300005841 Bacteria 5990
204 Ga0068863_100031107 3300005841 Bacteria 5096
205 Ga0068863_100309810 3300005841 Bacteria 1532
206 Ga0068863_100674172 3300005841 Bacteria 1026
207 Ga0068863_101843569 3300005841 Bacteria 615
208 Ga0068858_100000753 3300005842 Bacteria 33946
209 Ga0068858_100001308 3300005842 Bacteria 25722
210 Ga0068858_100305711 3300005842 Bacteria 1518
211 Ga0068860_100002605 3300005843 Bacteria 18875
212 Ga0068860_100052369 3300005843 Bacteria 3883
213 Ga0068860_100205061 3300005843 Bacteria 1912
214 Ga0068860_100271939 3300005843 Bacteria 1654
215 Ga0068862_100017186 3300005844 Bacteria 6019
216 Ga0068862_100026912 3300005844 Bacteria 4837
217 Ga0068862_100121260 3300005844 Bacteria 2305
218 Ga0070716_100063737 3300006173 Bacteria 2141
219 Ga0075366_10014779 3300006195 Bacteria 4466
220 Ga0075366_10088228 3300006195 Bacteria 1857
221 Ga0097621_100004218 3300006237 Bacteria 9979
222 Ga0097621_100079703 3300006237 Bacteria 2722
223 Ga0097621_100212893 3300006237 Bacteria 1682
224 Ga0097621_101746952 3300006237 Bacteria 593
225 Ga0075370_10001723 3300006353 Bacteria 9730
226 Ga0075370_10109748 3300006353 Bacteria 1601
227 Ga0068871_100023571 3300006358 Bacteria 4764
228 Ga0068871_100159240 3300006358 Bacteria 1930
229 Ga0068871_100305409 3300006358 Bacteria 1398
230 Ga0075433_11288914 3300006852 Bacteria 633
231 Ga0068865_100101647 3300006881 Bacteria 2105
232 Ga0068865_100380685 3300006881 Bacteria 1151
233 Ga0068865_100709182 3300006881 Bacteria 860
234 Ga0097620_100000664 3300006931 Bacteria 34524
235 Ga0097620_100266098 3300006931 Bacteria 1806
236 Ga0105240_10549003 3300009093 Bacteria 1279
237 Ga0111539_11551126 3300009094 Bacteria 768
238 Ga0105245_10020852 3300009098 Bacteria 5745
239 Ga0105245_10109296 3300009098 Bacteria 2569
240 Ga0105245_10314858 3300009098 Bacteria 1540
241 Ga0105245_10651317 3300009098 Bacteria 1083
242 Ga0105243_10011881 3300009148 Bacteria 6585
243 Ga0105243_10012526 3300009148 Bacteria 6413
244 Ga0105243_10261012 3300009148 Bacteria 1551
245 Ga0105241_10091785 3300009174 Bacteria 2397
246 Ga0105242_10016505 3300009176 Bacteria 5741
247 Ga0105242_10045722 3300009176 Bacteria 3549
248 Ga0105242_10173819 3300009176 Bacteria 1895
249 Ga0105242_10328119 3300009176 Bacteria 1406
250 Ga0105248_10080416 3300009177 Bacteria 3663
251 Ga0105248_10100021 3300009177 Bacteria 3267
252 Ga0105248_10113075 3300009177 Bacteria 3062
253 Ga0105248_10283924 3300009177 Bacteria 1864
254 Ga0105237_10056104 3300009545 Bacteria 3944
255 Ga0105238_10074550 3300009551 Bacteria 3386
256 Ga0105238_10201265 3300009551 Bacteria 1967
257 Ga0105249_10012789 3300009553 Bacteria 7401
258 Ga0105249_10105621 3300009553 Bacteria 2655
259 Ga0105249_10120839 3300009553 Bacteria 2489
260 Ga0105249_12910368 3300009553 Bacteria 549
261 Ga0105239_10376885 3300010375 Bacteria 1604
262 Ga0105246_10063324 3300011119 Bacteria 2579
263 Ga0105246_10750515 3300011119 Bacteria 861
264 Ga0105246_11630540 3300011119 Bacteria 611
265 Ga0157317_1017324 3300012475 Bacteria 614
266 Ga0157371_10559238 3300013102 Bacteria 848
267 Ga0157369_10049402 3300013105 Bacteria 4560
268 Ga0157369_10065854 3300013105 Bacteria 3899
269 Ga0157374_10018229 3300013296 Bacteria 6193
270 Ga0157374_10285007 3300013296 Bacteria 1631
271 Ga0157374_10290901 3300013296 Bacteria 1615
272 Ga0157374_10458210 3300013296 Bacteria 1277
273 Ga0157378_10248406 3300013297 Bacteria 1702
274 Ga0157378_10271551 3300013297 Bacteria 1631
275 Ga0163162_10018322 3300013306 Bacteria 6858
276 Ga0163162_10074898 3300013306 Bacteria 3444
277 Ga0163162_10139933 3300013306 Bacteria 2533
278 Ga0157372_10024729 3300013307 Bacteria 6527
279 Ga0157372_10091806 3300013307 Bacteria 3453
280 Ga0157375_10022318 3300013308 Bacteria 5824
281 Ga0157375_10154770 3300013308 Bacteria 2431
282 Ga0157375_10294961 3300013308 Bacteria 1784
283 Ga0157375_10604457 3300013308 Bacteria 1256
284 Ga0163163_10003252 3300014325 Bacteria 13780
285 Ga0163163_10297986 3300014325 Bacteria 1665
286 Ga0163163_10321280 3300014325 Bacteria 1602
287 Ga0163163_10566048 3300014325 Bacteria 1199
288 Ga0163163_12155392 3300014325 Bacteria 617
289 Ga0157380_10010424 3300014326 Bacteria 6687
290 Ga0157380_10054878 3300014326 Bacteria 3163
291 Ga0182008_10482293 3300014497 Bacteria 679
292 Ga0157377_10034628 3300014745 Bacteria 2763
293 Ga0157377_10242385 3300014745 Bacteria 1164
294 Ga0157379_10002549 3300014968 Bacteria 15283
295 Ga0157379_10058087 3300014968 Bacteria 3458
296 Ga0157379_10106286 3300014968 Bacteria 2519
297 Ga0157379_10156596 3300014968 Bacteria 2055
298 Ga0157376_10028465 3300014969 Bacteria 4441
299 Ga0182007_10067358 3300015262 Bacteria 1173
300 Ga0163161_10010050 3300017792 Bacteria 6552
301 Ga0163161_10017188 3300017792 Bacteria 5058
302 Ga0163161_10066104 3300017792 Bacteria 2640
303 Ga0206353_10251169 3300020082 Bacteria 958
304 Ga0213872_10038817 3300021361 Bacteria 2173
305 Ga0213876_10044797 3300021384 Bacteria 2339
306 Ga0207666_1009857 3300025271 Bacteria 1297
307 Ga0209673_1031468 3300025273 Bacteria 1650
308 Ga0209051_1000025 3300025303 Bacteria 415397
309 Ga0209257_1000039 3300025304 Bacteria 591694
310 Ga0207697_10007754 3300025315 Bacteria 4756
311 Ga0207656_10013485 3300025321 Bacteria 3126
312 Ga0207656_10076243 3300025321 Bacteria 1499
313 Ga0207656_10095159 3300025321 Bacteria 1358
314 Ga0207656_10110331 3300025321 Bacteria 1270
315 Ga0207682_10091403 3300025893 Bacteria 1320
316 Ga0207642_10066878 3300025899 Bacteria 1694
317 Ga0207680_10005208 3300025903 Bacteria 6203
318 Ga0207680_10752375 3300025903 Bacteria 699
319 Ga0207647_10376897 3300025904 Bacteria 801
320 Ga0207645_10003699 3300025907 Bacteria 11527
321 Ga0207645_10003718 3300025907 Bacteria 11487
322 Ga0207645_10016192 3300025907 Bacteria 4940
323 Ga0207645_10057363 3300025907 Bacteria 2486
324 Ga0207645_10151849 3300025907 Bacteria 1512
325 Ga0207645_10363394 3300025907 Bacteria 970
326 Ga0207643_10032364 3300025908 Bacteria 2920
327 Ga0207643_10207301 3300025908 Bacteria 1195
328 Ga0207705_10736931 3300025909 Bacteria 766
329 Ga0207705_10754235 3300025909 Bacteria 756
330 Ga0207707_10061737 3300025912 Bacteria 3261
331 Ga0207707_11089540 3300025912 Bacteria 651
332 Ga0207695_10598320 3300025913 Bacteria 984
333 Ga0207671_10027166 3300025914 Bacteria 4280
334 Ga0207660_10015775 3300025917 Bacteria 4993
335 Ga0207662_10070691 3300025918 Bacteria 2112
336 Ga0207662_10073022 3300025918 Bacteria 2080
337 Ga0207657_10010690 3300025919 Bacteria 9142
338 Ga0207657_10033876 3300025919 Bacteria 4599
339 Ga0207649_10048906 3300025920 Bacteria 2609
340 Ga0207649_10079404 3300025920 Bacteria 2120
341 Ga0207649_10095346 3300025920 Bacteria 1958
342 Ga0207649_10146565 3300025920 Bacteria 1621
343 Ga0207652_10026465 3300025921 Bacteria 4832
344 Ga0207652_10110956 3300025921 Bacteria 2432
345 Ga0207652_11014146 3300025921 Bacteria 729
346 Ga0207681_10006563 3300025923 Bacteria 7142
347 Ga0207681_10013198 3300025923 Bacteria 5108
348 Ga0207694_10159243 3300025924 Bacteria 1823
349 Ga0207650_10003675 3300025925 Bacteria 10491
350 Ga0207650_10016007 3300025925 Bacteria 5233
351 Ga0207650_10048889 3300025925 Bacteria 3121
352 Ga0207650_10140785 3300025925 Bacteria 1896
353 Ga0207650_10365580 3300025925 Bacteria 1189
354 Ga0207650_10793842 3300025925 Bacteria 802
355 Ga0207659_10000413 3300025926 Bacteria 25819
356 Ga0207659_10009586 3300025926 Bacteria 6056
357 Ga0207659_10029249 3300025926 Bacteria 3753
358 Ga0207659_10135255 3300025926 Bacteria 1907
359 Ga0207659_10228308 3300025926 Bacteria 1500
360 Ga0207659_10360957 3300025926 Bacteria 1207
361 Ga0207659_10466437 3300025926 Bacteria 1065
362 Ga0207687_10077883 3300025927 Bacteria 2385
363 Ga0207687_10117163 3300025927 Bacteria 1986
364 Ga0207687_10162140 3300025927 Bacteria 1717
365 Ga0207664_10698680 3300025929 Bacteria 912
366 Ga0207644_10002107 3300025931 Bacteria 12896
367 Ga0207644_10012266 3300025931 Bacteria 5689
368 Ga0207644_10080234 3300025931 Bacteria 2409
369 Ga0207644_10099794 3300025931 Bacteria 2179
370 Ga0207644_10132449 3300025931 Bacteria 1910
371 Ga0207644_10226108 3300025931 Bacteria 1485
372 Ga0207644_10336531 3300025931 Bacteria 1223
373 Ga0207644_10914526 3300025931 Bacteria 735
374 Ga0207644_11253418 3300025931 Bacteria 623
375 Ga0207690_10046749 3300025932 Bacteria 2868
376 Ga0207690_10053817 3300025932 Bacteria 2703
377 Ga0207690_10151966 3300025932 Bacteria 1717
378 Ga0207706_10000416 3300025933 Bacteria 45659
379 Ga0207706_10000833 3300025933 Bacteria 32010
380 Ga0207706_10017712 3300025933 Bacteria 6417
381 Ga0207706_10026620 3300025933 Bacteria 5176
382 Ga0207706_10184823 3300025933 Bacteria 1830
383 Ga0207706_10993784 3300025933 Bacteria 705
384 Ga0207686_10023247 3300025934 Bacteria 3577
385 Ga0207686_10023817 3300025934 Bacteria 3539
386 Ga0207686_10062680 3300025934 Bacteria 2362
387 Ga0207709_10017558 3300025935 Bacteria 3995
388 Ga0207709_10123980 3300025935 Bacteria 1749
389 Ga0207709_10359318 3300025935 Bacteria 1102
390 Ga0207670_10088183 3300025936 Bacteria 2188
391 Ga0207670_10203259 3300025936 Bacteria 1506
392 Ga0207669_10006340 3300025937 Bacteria 5398
393 Ga0207669_10024884 3300025937 Bacteria 3225
394 Ga0207669_10219784 3300025937 Bacteria 1393
395 Ga0207704_10289240 3300025938 Bacteria 1250
396 Ga0207691_10015399 3300025940 Bacteria 7276
397 Ga0207691_10075901 3300025940 Bacteria 3029
398 Ga0207691_10097618 3300025940 Bacteria 2626
399 Ga0207691_10139631 3300025940 Bacteria 2136
400 Ga0207691_10196415 3300025940 Bacteria 1758
401 Ga0207691_10231954 3300025940 Bacteria 1598
402 Ga0207711_10058254 3300025941 Bacteria 3323
403 Ga0207711_10138451 3300025941 Bacteria 2188
404 Ga0207711_10151465 3300025941 Bacteria 2093
405 Ga0207711_10164097 3300025941 Bacteria 2013
406 Ga0207711_10185020 3300025941 Bacteria 1896
407 Ga0207689_10000220 3300025942 Bacteria 50583
408 Ga0207689_10025297 3300025942 Bacteria 4974
409 Ga0207689_10040227 3300025942 Bacteria 3870
410 Ga0207661_10780824 3300025944 Bacteria 879
411 Ga0207679_10152932 3300025945 Bacteria 1880
412 Ga0207679_10209180 3300025945 Bacteria 1635
413 Ga0207679_10316544 3300025945 Bacteria 1350
414 Ga0207667_10782595 3300025949 Bacteria 952
415 Ga0207667_10921555 3300025949 Bacteria 865
416 Ga0207651_10003649 3300025960 Bacteria 7593
417 Ga0207651_10030243 3300025960 Bacteria 3445
418 Ga0207651_10225304 3300025960 Bacteria 1518
419 Ga0207712_10022630 3300025961 Bacteria 4141
420 Ga0207712_10029574 3300025961 Bacteria 3677
421 Ga0207712_10162305 3300025961 Bacteria 1738
422 Ga0207668_10191621 3300025972 Bacteria 1620
423 Ga0207640_10482768 3300025981 Bacteria 1028
424 Ga0207640_11236072 3300025981 Bacteria 665
425 Ga0207658_10001221 3300025986 Bacteria 20333
426 Ga0207658_10002977 3300025986 Bacteria 12111
427 Ga0207658_10040967 3300025986 Bacteria 3351
428 Ga0207658_10048590 3300025986 Bacteria 3112
429 Ga0207658_10111858 3300025986 Bacteria 2160
430 Ga0207658_10932252 3300025986 Bacteria 791
431 Ga0207677_10011481 3300026023 Bacteria 5056
432 Ga0207677_10030736 3300026023 Bacteria 3432
433 Ga0207677_10076965 3300026023 Bacteria 2377
434 Ga0207677_10088101 3300026023 Bacteria 2249
435 Ga0207703_10003611 3300026035 Bacteria 12912
436 Ga0207703_10004844 3300026035 Bacteria 10952
437 Ga0207703_10109003 3300026035 Bacteria 2359
438 Ga0207639_10004716 3300026041 Bacteria 9181
439 Ga0207639_10136591 3300026041 Bacteria 2037
440 Ga0207639_10679987 3300026041 Bacteria 954
441 Ga0207639_11046843 3300026041 Bacteria 765
442 Ga0207678_10001252 3300026067 Bacteria 23430
443 Ga0207678_10248046 3300026067 Bacteria 1525
444 Ga0207678_10258217 3300026067 Bacteria 1493
445 Ga0207678_10363529 3300026067 Bacteria 1249
446 Ga0207678_10388887 3300026067 Bacteria 1206
447 Ga0207678_10565846 3300026067 Bacteria 995
448 Ga0207678_11404381 3300026067 Bacteria 617
449 Ga0207708_10041527 3300026075 Bacteria 3506
450 Ga0207708_10121659 3300026075 Bacteria 2034
451 Ga0207641_10003058 3300026088 Bacteria 15079
452 Ga0207641_10180600 3300026088 Bacteria 1932
453 Ga0207641_10923087 3300026088 Bacteria 867
454 Ga0207641_11251465 3300026088 Bacteria 742
455 Ga0207648_10005956 3300026089 Bacteria 12195
456 Ga0207648_10013664 3300026089 Bacteria 7538
457 Ga0207648_10070958 3300026089 Bacteria 3036
458 Ga0207648_10209921 3300026089 Bacteria 1728
459 Ga0207676_10000325 3300026095 Bacteria 41139
460 Ga0207676_10160825 3300026095 Bacteria 1945
461 Ga0207676_10196920 3300026095 Bacteria 1777
462 Ga0207676_10259405 3300026095 Bacteria 1568
463 Ga0207676_10561330 3300026095 Bacteria 1092
464 Ga0207674_10071362 3300026116 Bacteria 3489
465 Ga0207674_10080968 3300026116 Bacteria 3250
466 Ga0207675_100009898 3300026118 Bacteria 8920
467 Ga0207675_100027562 3300026118 Bacteria 5291
468 Ga0207675_100074427 3300026118 Bacteria 3178
469 Ga0207675_100924947 3300026118 Bacteria 889
470 Ga0207683_10017478 3300026121 Bacteria 6113
471 Ga0207683_10074370 3300026121 Bacteria 3006
472 Ga0207683_10216095 3300026121 Bacteria 1746
473 Ga0207683_10310935 3300026121 Bacteria 1442
474 Ga0207698_10010192 3300026142 Bacteria 6024
475 Ga0207698_10015524 3300026142 Bacteria 5102
476 Ga0207698_10021119 3300026142 Bacteria 4496
477 Ga0207698_10057527 3300026142 Bacteria 3009
478 Ga0207698_10083825 3300026142 Bacteria 2581
479 Ga0207698_10200298 3300026142 Bacteria 1787
480 Ga0207698_10734102 3300026142 Bacteria 985
481 Ga0207698_10808988 3300026142 Bacteria 940
482 Ga0207698_12412152 3300026142 Bacteria 537
483 Ga0268265_10022789 3300028380 Bacteria 4405
484 Ga0268265_10292946 3300028380 Bacteria 1462
485 Ga0268265_11010125 3300028380 Bacteria 822
486 Ga0268264_10013259 3300028381 Bacteria 6785
487 Ga0268264_10350760 3300028381 Bacteria 1404
488 Ga0268264_10713510 3300028381 Bacteria 997
489 Ga0307515_10018614 3300028794 Bacteria 12549
490 Ga0265330_10000116 3300031235 Bacteria 64622
491 Ga0265332_10000012 3300031238 Bacteria 272641
492 Ga0265325_10007177 3300031241 Bacteria 6702
493 Ga0265340_10326039 3300031247 Bacteria 679
494 Ga0307509_10106943 3300031507 Bacteria 2815
495 Ga0307408_101586038 3300031548 Bacteria 621
496 Ga0265314_10000029 3300031711 Bacteria 272506
497 Ga0316576_10535194 3300031727 Bacteria 859
498 Ga0316578_10222013 3300031728 Unclassified 1136
499 Ga0307405_10044723 3300031731 Bacteria 2709
500 Ga0307412_10022617 3300031911 Bacteria 3857
501 Ga0307412_11086825 3300031911 Bacteria 711
502 Ga0307409_100003485 3300031995 Bacteria 8558
503 Ga0307416_100018538 3300032002 Bacteria 4906
504 Ga0307414_10426292 3300032004 Bacteria 1158
505 Ga0307411_10186577 3300032005 Bacteria 1579
506 Ga0307415_100013104 3300032126 Bacteria 4825
507 Ga0307510_10329158 3300033180 Bacteria 983
508 Ga0373959_0135336 3300034820 Bacteria 613
509 Ga0373928_0035261 3300035084 Bacteria 1126
510 Ga0373957_0142052 3300035120 Bacteria 982
511 Ga0373957_0333581 3300035120 Bacteria 646
512 Ga0373943_0190845 3300035170 Bacteria 1130
513 Ga0373962_0055706 3300035242 Bacteria 1149
514 Ga0316574_0256073 3300035398 Bacteria 1118
515 Ga0316574_0587731 3300035398 Bacteria 689
516 Ga0373931_0006039 3300035691 Bacteria 5637
517 Ga0373931_0231723 3300035691 Bacteria 1116
518 Ga0373935_0431528 3300035692 Bacteria 950
519 Ga0373937_0391357 3300036401 Bacteria 1318
520 Ga0316582_0910520 3300036647 Bacteria 601
521 Ga0316584_0407156 3300036712 Unclassified 968
522 Ga0373925_0010781 3300037068 Bacteria 6627
523 Ga0373925_0024638 3300037068 Bacteria 4394
524 Ga0395905_0000027 3300037471 Bacteria 297239
525 Ga0395905_0013696 3300037471 Bacteria 7766
526 Ga0395905_0156481 3300037471 Bacteria 2143
527 Ga0395905_0354482 3300037471 Bacteria 1359
528 Ga0395901_1244140 3300038443 Bacteria 708
529 Ga0400484_28074 3300038725 Bacteria 11434
530 Ga0400490_11291 3300038726 Bacteria 2354
531 Ga0400490_13057 3300038726 Bacteria 1075
532 Ga0400490_25619 3300038726 Bacteria 2922
533 Ga0400491_04306 3300038727 Bacteria 3589
534 Ga0400488_17531 3300038741 Bacteria 8262
535 Ga0400486_01438 3300038742 Bacteria 1236
536 Ga0400483_081394 3300039062 Bacteria 1229
537 Ga0400483_231854 3300039062 Bacteria 3428
538 Ga0400489_18926 3300039093 Bacteria 26490
539 Ga0436365_1265272 3300039437 Bacteria 1274
540 Ga0436361_0371412 3300039447 Bacteria 22181
541 Ga0439436_0030259 3300041404 Bacteria 1574
542 Ga0439436_0133327 3300041404 Bacteria 697
543 Ga0439433_0011562 3300041999 Bacteria 1935
544 Ga0439433_0019357 3300041999 Bacteria 1517
545 Ga0439437_011895 3300042000 Bacteria 1001
546 Ga0439449_0009948 3300042007 Bacteria 3598
547 Ga0439449_0167794 3300042007 Bacteria 820
548 Ga0439450_045112 3300042008 Bacteria 1034
549 Ga0439456_048514 3300042013 Bacteria 927
550 Ga0439462_0135613 3300042015 Bacteria 688
551 Ga0450921_007300 3300042123 Bacteria 876
552 Ga0450897_000851 3300042128 Bacteria 1873
553 Ga0450898_001903 3300042134 Bacteria 2835
554 Ga0439446_0059666 3300042156 Bacteria 1151
555 Ga0450909_007161 3300042185 Bacteria 1612
556 Ga0450909_029956 3300042185 Bacteria 824
557 Ga0451577_0320034 3300042876 Bacteria 1407
558 Ga0453683_0049514 3300044673 Bacteria 2634
559 Ga0453683_0072911 3300044673 Bacteria 2149
560 Ga0453683_0270317 3300044673 Bacteria 1085
561 Ga0453683_0583582 3300044673 Bacteria 728
562 Ga0466965_0021284 3300044683 Bacteria 3120
563 Ga0466966_0025665 3300044684 Bacteria 3848
564 Ga0466966_0074260 3300044684 Bacteria 2126
565 Ga0466961_0000675 3300044693 Bacteria 21455
566 Ga0466961_0213413 3300044693 Bacteria 1191
567 Ga0466963_0167763 3300044694 Bacteria 1529
568 Ga0466964_0009736 3300044706 Bacteria 3620
569 Ga0453684_0031532 3300044712 Bacteria 7446
570 Ga0466971_0196011 3300044719 Bacteria 952
571 Ga0466959_0000285 3300045049 Bacteria 30873
572 Ga0451576_0013497 3300045051 Bacteria 9138
573 Ga0451576_0273709 3300045051 Bacteria 1765
574 Ga0466958_0018991 3300045836 Bacteria 3996
575 Ga0466967_0083639 3300045976 Bacteria 2886
576 Ga0495603_0462226 3300046455 Bacteria 727
577 Ga0495629_0104045 3300046459 Bacteria 1980
578 Ga0495651_0820775 3300046462 Bacteria 573
579 Ga0495586_0560473 3300046535 Bacteria 660
580 Ga0495587_0555126 3300046536 Bacteria 634
581 Ga0495598_0050011 3300046537 Bacteria 1255
582 Ga0495598_0078141 3300046537 Bacteria 1056
583 Ga0495645_0258759 3300046543 Bacteria 1154
584 Ga0495656_0067225 3300046615 Bacteria 1581
585 Ga0495635_0574470 3300046663 Bacteria 738
586 Ga0495647_0041312 3300046681 Bacteria 1756
587 Ga0495658_0056182 3300046683 Bacteria 2244
588 Ga0495658_0797021 3300046683 Bacteria 605
589 Ga0495613_0300745 3300046689 Bacteria 1111
590 Ga0495624_0745519 3300046690 Bacteria 580
591 Ga0495600_0649357 3300046809 Bacteria 638
592 Ga0495675_0240939 3300047444 Bacteria 1089
593 Ga0495684_0212035 3300047471 Bacteria 1424
594 Ga0495602_0286895 3300048088 Bacteria 1210
595 Ga0495615_0019917 3300048090 Bacteria 1496
596 Ga0496101_0049833 3300048904 Bacteria 3013
597 Ga0496102_0124696 3300048905 Bacteria 2407
598 Ga0496104_0046575 3300048907 Bacteria 4084
599 Ga0496105_0100803 3300048908 Bacteria 2385
600 Ga0496105_0175389 3300048908 Bacteria 1756
601 Ga0496106_0060885 3300048909 Bacteria 2862
602 Ga0496107_0009725 3300048910 Bacteria 6668
603 Ga0496108_0015900 3300048911 Bacteria 6134
604 Ga0496108_0071801 3300048911 Bacteria 2922
605 Ga0496108_0127776 3300048911 Bacteria 2183
606 Ga0496108_0132029 3300048911 Bacteria 2146
607 Ga0496108_0676648 3300048911 Bacteria 896
608 Ga0496109_0085859 3300048912 Bacteria 2906
609 Ga0496109_0255244 3300048912 Bacteria 1651
610 Ga0496109_0833206 3300048912 Bacteria 860
611 Ga0496110_0156794 3300048913 Bacteria 2062
612 Ga0496110_1257689 3300048913 Bacteria 649
613 Ga0496111_0361814 3300048914 Bacteria 1074
614 Ga0496112_0534790 3300048915 Bacteria 1106
615 Ga0496113_0023730 3300048916 Bacteria 4352
616 Ga0496114_0022525 3300048917 Bacteria 5135
617 Ga0496114_0066587 3300048917 Bacteria 3020
618 Ga0496115_0015067 3300048918 Bacteria 5860
619 Ga0496122_0007705 3300048925 Bacteria 11863
620 Ga0496124_0368725 3300048927 Bacteria 1009
621 Ga0496125_0001094 3300048928 Bacteria 41763
622 Ga0496126_0030598 3300048929 Bacteria 5096
623 Ga0501037_0417133 3300049573 Bacteria 919
624 Ga0501073_0647553 3300049589 Bacteria 729
625 Ga0501074_0297415 3300049590 Bacteria 1147
626 Ga0501257_086408 3300049686 Bacteria 813
627 Ga0501035_0856779 3300049822 Bacteria 722
628 nmdc:mga0k408_13648_c1 3300050493 Bacteria 4459
629 nmdc:mga0k408_314246_c1 3300050493 Bacteria 935
630 nmdc:mga07m45_224605_c1 3300050496 Bacteria 1093
631 nmdc:mga07m45_7495_c1 3300050496 Bacteria 5577
632 nmdc:mga0qj67_1116501_c1 3300050509 Bacteria 615
633 nmdc:mga08y16_152166_c1 3300050511 Bacteria 2404
634 Ga0495619_0761034 3300053085 Bacteria 656
635 Ga0466962_0008037 3300061719 Bacteria 5057
636 2886848805 2886848708 Bacteria 5632523
637 Ga0400488_46387
638 Ga0055540_1004095
639 Ga0070658_10039717
640 Ga0070658_10138924
641 Ga0070658_10537937
642 Ga0070676_10006485
643 Ga0070676_10023281
644 Ga0070676_10027180
645 Ga0070676_10125192
646 Ga0070676_10266583
647 Ga0070683_100137139
648 Ga0070683_100162158
649 Ga0070690_100008044
650 Ga0070690_100049047
651 Ga0070690_100197915
652 Ga0070670_100013736
653 Ga0070670_100074055
654 Ga0070670_100088289
655 Ga0070670_100183217
656 Ga0070670_100200468
657 Ga0070670_100315299
658 Ga0070670_100352243
659 Ga0070670_100397374
660 Ga0070670_100411174
661 Ga0070677_10024396
662 Ga0070677_10095018
663 Ga0070677_10110841
664 Ga0068869_100010577
665 Ga0068869_100069669
666 Ga0068869_100246308
667 Ga0068869_100248795
668 Ga0068869_100822545
669 Ga0070666_10003031
670 Ga0070666_10044715
671 Ga0070680_100015316
672 Ga0070682_100353937
673 Ga0068868_100012611
674 Ga0068868_100015421
675 Ga0068868_100137482
676 Ga0068868_101012219
677 Ga0068868_101060814
678 Ga0070660_100011152
679 Ga0070660_100142198
680 Ga0070689_100049166
681 Ga0070689_100465582
682 Ga0070687_100023337
683 Ga0070687_100264834
684 Ga0070661_100133441
685 Ga0070661_100155924
686 Ga0070661_100268433
687 Ga0070661_100298369
688 Ga0070661_100563800
689 Ga0070661_100686322
690 Ga0070661_100894367
691 Ga0070692_10196880
692 Ga0070668_100030426
693 Ga0070668_100049242
694 Ga0070668_100243751
695 Ga0070669_100010855
696 Ga0070669_100012281
697 Ga0070669_100020857
698 Ga0070669_100107813
699 Ga0070669_100240948
700 Ga0070675_100000999
701 Ga0070675_100001451
702 Ga0070675_100007384
703 Ga0070675_100018860
704 Ga0070675_100027238
705 Ga0070675_100107255
706 Ga0070675_100229652
707 Ga0070675_100327379
708 Ga0070675_100390623
709 Ga0070671_100002875
710 Ga0070671_100006189
711 Ga0070671_100081289
712 Ga0070671_100133250
713 Ga0070671_100157216
714 Ga0070671_100180741
715 Ga0070671_100221354
716 Ga0070671_100324759
717 Ga0070671_100362437
718 Ga0070671_100584902
719 Ga0070671_101271561
720 Ga0070674_100011541
721 Ga0070674_100087517
722 Ga0070674_100218436
723 Ga0070674_100723081
724 Ga0070673_100002945
725 Ga0070673_100006013
726 Ga0070673_100028410
727 Ga0070673_100558590
728 Ga0070673_101702736
729 Ga0070688_100100208
730 Ga0070659_100014656
731 Ga0070659_100190956
732 Ga0070659_100383821
733 Ga0070667_100004597
734 Ga0070667_100019155
735 Ga0070667_100025606
736 Ga0070667_100027275
737 Ga0070667_100040940
738 Ga0070667_100252237
739 Ga0070714_100880960
740 Ga0070701_10903856
741 Ga0070700_100019405
742 Ga0070700_100072458
743 Ga0070700_100267746
744 Ga0070700_100313515
745 Ga0070694_100985529
746 Ga0070663_100019366
747 Ga0070663_100430672
748 Ga0070663_100550196
749 Ga0070663_100580178
750 Ga0070663_100684241
751 Ga0070678_100039063
752 Ga0070678_100070416
753 Ga0070678_100188782
754 Ga0070678_100443771
755 Ga0070678_100880464
756 Ga0070678_100953786
757 Ga0070678_101221607
758 Ga0070678_101432775
759 Ga0070662_100000852
760 Ga0070662_100014068
761 Ga0070662_100168196
762 Ga0070662_100833976
763 Ga0070681_10057209
764 Ga0068867_100003473
765 Ga0068867_100025105
766 Ga0068867_100051313
767 Ga0068867_100181071
768 Ga0068867_100214348
769 Ga0068867_101290704
770 Ga0068867_101315084
771 Ga0070685_10103017
772 Ga0070706_101673541
773 Ga0070679_100003657
774 Ga0070684_100055767
775 Ga0068853_100009156
776 Ga0068853_100145163
777 Ga0068853_100800339
778 Ga0070672_100011872
779 Ga0070672_100013081
780 Ga0070672_100053576
781 Ga0070672_100066161
782 Ga0070672_100071715
783 Ga0070672_100151197
784 Ga0070672_100181014
785 Ga0070672_100187738
786 Ga0070672_100233006
787 Ga0070672_100612787
788 Ga0070672_100965111
789 Ga0070672_101152926
790 Ga0070686_100044562
791 Ga0070686_100046826
792 Ga0070686_100139345
793 Ga0070693_100028199
794 Ga0070665_100783313
795 Ga0070665_101785079
796 Ga0068855_100191742
797 Ga0068855_100710558
798 Ga0070664_100063745
799 Ga0070664_100202359
800 Ga0070664_100224804
801 Ga0070664_100729028
802 Ga0070664_100772570
803 Ga0070664_101386265
804 Ga0068857_100130785
805 Ga0068857_100522742
806 Ga0068857_101082619
807 Ga0068854_100121749
808 Ga0068854_100174935
809 Ga0068856_100101394
810 Ga0068856_100254403
811 Ga0068856_101332555
812 Ga0070702_100144182
813 Ga0070702_100589186
814 Ga0068852_100007738
815 Ga0068852_100034224
816 Ga0068852_100096398
817 Ga0068852_100116682
818 Ga0068852_100118914
819 Ga0068852_100558415
820 Ga0068852_101818274
821 Ga0068859_100000664
822 Ga0068859_100266119
823 Ga0068864_100000649
824 Ga0068864_100086390
825 Ga0068864_100161277
826 Ga0068864_100186310
827 Ga0068864_100852769
828 Ga0068866_10002567
829 Ga0068861_100003388
830 Ga0068861_100036004
831 Ga0068851_10003642
832 Ga0068851_10012471
833 Ga0068851_10197061
834 Ga0068851_10236942
835 Ga0068870_10084860
836 Ga0068870_10290826
837 Ga0068870_10477665
838 Ga0068863_100011555
839 Ga0068863_100022728
840 Ga0068863_100031107
841 Ga0068863_100309810
842 Ga0068863_100674172
843 Ga0068863_101843569
844 Ga0068858_100000753
845 Ga0068858_100001308
846 Ga0068858_100305711
847 Ga0068860_100002605
848 Ga0068860_100052369
849 Ga0068860_100205061
850 Ga0068860_100271939
851 Ga0068862_100017186
852 Ga0068862_100026912
853 Ga0068862_100121260
854 Ga0070716_100063737
855 Ga0075366_10014779
856 Ga0075366_10088228
857 Ga0097621_100004218
858 Ga0097621_100079703
859 Ga0097621_100212893
860 Ga0097621_101746952
861 Ga0075370_10001723
862 Ga0075370_10109748
863 Ga0068871_100023571
864 Ga0068871_100159240
865 Ga0068871_100305409
866 Ga0075433_11288914
867 Ga0068865_100101647
868 Ga0068865_100380685
869 Ga0068865_100709182
870 Ga0097620_100000664
871 Ga0097620_100266098
872 Ga0105240_10549003
873 Ga0111539_11551126
874 Ga0105245_10020852
875 Ga0105245_10109296
876 Ga0105245_10314858
877 Ga0105245_10651317
878 Ga0105243_10011881
879 Ga0105243_10012526
880 Ga0105243_10261012
881 Ga0105241_10091785
882 Ga0105242_10016505
883 Ga0105242_10045722
884 Ga0105242_10173819
885 Ga0105242_10328119
886 Ga0105248_10080416
887 Ga0105248_10100021
888 Ga0105248_10113075
889 Ga0105248_10283924
890 Ga0105237_10056104
891 Ga0105238_10074550
892 Ga0105238_10201265
893 Ga0105249_10012789
894 Ga0105249_10105621
895 Ga0105249_10120839
896 Ga0105249_12910368
897 Ga0105239_10376885
898 Ga0105246_10063324
899 Ga0105246_10750515
900 Ga0105246_11630540
901 Ga0157317_1017324
902 Ga0157371_10559238
903 Ga0157369_10049402
904 Ga0157369_10065854
905 Ga0157374_10018229
906 Ga0157374_10285007
907 Ga0157374_10290901
908 Ga0157374_10458210
909 Ga0157378_10248406
910 Ga0157378_10271551
911 Ga0163162_10018322
912 Ga0163162_10074898
913 Ga0163162_10139933
914 Ga0157372_10024729
915 Ga0157372_10091806
916 Ga0157375_10022318
917 Ga0157375_10154770
918 Ga0157375_10294961
919 Ga0157375_10604457
920 Ga0163163_10003252
921 Ga0163163_10297986
922 Ga0163163_10321280
923 Ga0163163_10566048
924 Ga0163163_12155392
925 Ga0157380_10010424
926 Ga0157380_10054878
927 Ga0182008_10482293
928 Ga0157377_10034628
929 Ga0157377_10242385
930 Ga0157379_10002549
931 Ga0157379_10058087
932 Ga0157379_10106286
933 Ga0157379_10156596
934 Ga0157376_10028465
935 Ga0182007_10067358
936 Ga0163161_10010050
937 Ga0163161_10017188
938 Ga0163161_10066104
939 Ga0206353_10251169
940 Ga0213872_10038817
941 Ga0213876_10044797
942 Ga0207666_1009857
943 Ga0209673_1031468
944 Ga0209051_1000025
945 Ga0209257_1000039
946 Ga0207697_10007754
947 Ga0207656_10013485
948 Ga0207656_10076243
949 Ga0207656_10095159
950 Ga0207656_10110331
951 Ga0207682_10091403
952 Ga0207642_10066878
953 Ga0207680_10005208
954 Ga0207680_10752375
955 Ga0207647_10376897
956 Ga0207645_10003699
957 Ga0207645_10003718
958 Ga0207645_10016192
959 Ga0207645_10057363
960 Ga0207645_10151849
961 Ga0207645_10363394
962 Ga0207643_10032364
963 Ga0207643_10207301
964 Ga0207705_10736931
965 Ga0207705_10754235
966 Ga0207707_10061737
967 Ga0207707_11089540
968 Ga0207695_10598320
969 Ga0207671_10027166
970 Ga0207660_10015775
971 Ga0207662_10070691
972 Ga0207662_10073022
973 Ga0207657_10010690
974 Ga0207657_10033876
975 Ga0207649_10048906
976 Ga0207649_10079404
977 Ga0207649_10095346
978 Ga0207649_10146565
979 Ga0207652_10026465
980 Ga0207652_10110956
981 Ga0207652_11014146
982 Ga0207681_10006563
983 Ga0207681_10013198
984 Ga0207694_10159243
985 Ga0207650_10003675
986 Ga0207650_10016007
987 Ga0207650_10048889
988 Ga0207650_10140785
989 Ga0207650_10365580
990 Ga0207650_10793842
991 Ga0207659_10000413
992 Ga0207659_10009586
993 Ga0207659_10029249
994 Ga0207659_10135255
995 Ga0207659_10228308
996 Ga0207659_10360957
997 Ga0207659_10466437
998 Ga0207687_10077883
999 Ga0207687_10117163
1000 Ga0207687_10162140
1001 Ga0207664_10698680
1002 Ga0207644_10002107
1003 Ga0207644_10012266
1004 Ga0207644_10080234
1005 Ga0207644_10099794
1006 Ga0207644_10132449
1007 Ga0207644_10226108
1008 Ga0207644_10336531
1009 Ga0207644_10914526
1010 Ga0207644_11253418
1011 Ga0207690_10046749
1012 Ga0207690_10053817
1013 Ga0207690_10151966
1014 Ga0207706_10000416
1015 Ga0207706_10000833
1016 Ga0207706_10017712
1017 Ga0207706_10026620
1018 Ga0207706_10184823
1019 Ga0207706_10993784
1020 Ga0207686_10023247
1021 Ga0207686_10023817
1022 Ga0207686_10062680
1023 Ga0207709_10017558
1024 Ga0207709_10123980
1025 Ga0207709_10359318
1026 Ga0207670_10088183
1027 Ga0207670_10203259
1028 Ga0207669_10006340
1029 Ga0207669_10024884
1030 Ga0207669_10219784
1031 Ga0207704_10289240
1032 Ga0207691_10015399
1033 Ga0207691_10075901
1034 Ga0207691_10097618
1035 Ga0207691_10139631
1036 Ga0207691_10196415
1037 Ga0207691_10231954
1038 Ga0207711_10058254
1039 Ga0207711_10138451
1040 Ga0207711_10151465
1041 Ga0207711_10164097
1042 Ga0207711_10185020
1043 Ga0207689_10000220
1044 Ga0207689_10025297
1045 Ga0207689_10040227
1046 Ga0207661_10780824
1047 Ga0207679_10152932
1048 Ga0207679_10209180
1049 Ga0207679_10316544
1050 Ga0207667_10782595
1051 Ga0207667_10921555
1052 Ga0207651_10003649
1053 Ga0207651_10030243
1054 Ga0207651_10225304
1055 Ga0207712_10022630
1056 Ga0207712_10029574
1057 Ga0207712_10162305
1058 Ga0207668_10191621
1059 Ga0207640_10482768
1060 Ga0207640_11236072
1061 Ga0207658_10001221
1062 Ga0207658_10002977
1063 Ga0207658_10040967
1064 Ga0207658_10048590
1065 Ga0207658_10111858
1066 Ga0207658_10932252
1067 Ga0207677_10011481
1068 Ga0207677_10030736
1069 Ga0207677_10076965
1070 Ga0207677_10088101
1071 Ga0207703_10003611
1072 Ga0207703_10004844
1073 Ga0207703_10109003
1074 Ga0207639_10004716
1075 Ga0207639_10136591
1076 Ga0207639_10679987
1077 Ga0207639_11046843
1078 Ga0207678_10001252
1079 Ga0207678_10248046
1080 Ga0207678_10258217
1081 Ga0207678_10363529
1082 Ga0207678_10388887
1083 Ga0207678_10565846
1084 Ga0207678_11404381
1085 Ga0207708_10041527
1086 Ga0207708_10121659
1087 Ga0207641_10003058
1088 Ga0207641_10180600
1089 Ga0207641_10923087
1090 Ga0207641_11251465
1091 Ga0207648_10005956
1092 Ga0207648_10013664
1093 Ga0207648_10070958
1094 Ga0207648_10209921
1095 Ga0207676_10000325
1096 Ga0207676_10160825
1097 Ga0207676_10196920
1098 Ga0207676_10259405
1099 Ga0207676_10561330
1100 Ga0207674_10071362
1101 Ga0207674_10080968
1102 Ga0207675_100009898
1103 Ga0207675_100027562
1104 Ga0207675_100074427
1105 Ga0207675_100924947
1106 Ga0207683_10017478
1107 Ga0207683_10074370
1108 Ga0207683_10216095
1109 Ga0207683_10310935
1110 Ga0207698_10010192
1111 Ga0207698_10015524
1112 Ga0207698_10021119
1113 Ga0207698_10057527
1114 Ga0207698_10083825
1115 Ga0207698_10200298
1116 Ga0207698_10734102
1117 Ga0207698_10808988
1118 Ga0207698_12412152
1119 Ga0268265_10022789
1120 Ga0268265_10292946
1121 Ga0268265_11010125
1122 Ga0268264_10013259
1123 Ga0268264_10350760
1124 Ga0268264_10713510
1125 Ga0307515_10018614
1126 Ga0265330_10000116
1127 Ga0265332_10000012
1128 Ga0265325_10007177
1129 Ga0265340_10326039
1130 Ga0307509_10106943
1131 Ga0307408_101586038
1132 Ga0265314_10000029
1133 Ga0316576_10535194
1134 Ga0316578_10222013
1135 Ga0307405_10044723
1136 Ga0307412_10022617
1137 Ga0307412_11086825
1138 Ga0307409_100003485
1139 Ga0307416_100018538
1140 Ga0307414_10426292
1141 Ga0307411_10186577
1142 Ga0307415_100013104
1143 Ga0307510_10329158
1144 Ga0373959_0135336
1145 Ga0373928_0035261
1146 Ga0373957_0142052
1147 Ga0373957_0333581
1148 Ga0373943_0190845
1149 Ga0373962_0055706
1150 Ga0316574_0256073
1151 Ga0316574_0587731
1152 Ga0373931_0006039
1153 Ga0373931_0231723
1154 Ga0373935_0431528
1155 Ga0373937_0391357
1156 Ga0316582_0910520
1157 Ga0316584_0407156
1158 Ga0373925_0010781
1159 Ga0373925_0024638
1160 Ga0395905_0000027
1161 Ga0395905_0013696
1162 Ga0395905_0156481
1163 Ga0395905_0354482
1164 Ga0395901_1244140
1165 Ga0400484_28074
1166 Ga0400490_11291
1167 Ga0400490_13057
1168 Ga0400490_25619
1169 Ga0400491_04306
1170 Ga0400488_17531
1171 Ga0400486_01438
1172 Ga0400483_081394
1173 Ga0400483_231854
1174 Ga0400489_18926
1175 Ga0436365_1265272
1176 Ga0436361_0371412
1177 Ga0439436_0030259
1178 Ga0439436_0133327
1179 Ga0439433_0011562
1180 Ga0439433_0019357
1181 Ga0439437_011895
1182 Ga0439449_0009948
1183 Ga0439449_0167794
1184 Ga0439450_045112
1185 Ga0439456_048514
1186 Ga0439462_0135613
1187 Ga0450921_007300
1188 Ga0450897_000851
1189 Ga0450898_001903
1190 Ga0439446_0059666
1191 Ga0450909_007161
1192 Ga0450909_029956
1193 Ga0451577_0320034
1194 Ga0453683_0049514
1195 Ga0453683_0072911
1196 Ga0453683_0270317
1197 Ga0453683_0583582
1198 Ga0466965_0021284
1199 Ga0466966_0025665
1200 Ga0466966_0074260
1201 Ga0466961_0000675
1202 Ga0466961_0213413
1203 Ga0466963_0167763
1204 Ga0466964_0009736
1205 Ga0453684_0031532
1206 Ga0466971_0196011
1207 Ga0466959_0000285
1208 Ga0451576_0013497
1209 Ga0451576_0273709
1210 Ga0466958_0018991
1211 Ga0466967_0083639
1212 Ga0495603_0462226
1213 Ga0495629_0104045
1214 Ga0495651_0820775
1215 Ga0495586_0560473
1216 Ga0495587_0555126
1217 Ga0495598_0050011
1218 Ga0495598_0078141
1219 Ga0495645_0258759
1220 Ga0495656_0067225
1221 Ga0495635_0574470
1222 Ga0495647_0041312
1223 Ga0495658_0056182
1224 Ga0495658_0797021
1225 Ga0495613_0300745
1226 Ga0495624_0745519
1227 Ga0495600_0649357
1228 Ga0495675_0240939
1229 Ga0495684_0212035
1230 Ga0495602_0286895
1231 Ga0495615_0019917
1232 Ga0496101_0049833
1233 Ga0496102_0124696
1234 Ga0496104_0046575
1235 Ga0496105_0100803
1236 Ga0496105_0175389
1237 Ga0496106_0060885
1238 Ga0496107_0009725
1239 Ga0496108_0015900
1240 Ga0496108_0071801
1241 Ga0496108_0127776
1242 Ga0496108_0132029
1243 Ga0496108_0676648
1244 Ga0496109_0085859
1245 Ga0496109_0255244
1246 Ga0496109_0833206
1247 Ga0496110_0156794
1248 Ga0496110_1257689
1249 Ga0496111_0361814
1250 Ga0496112_0534790
1251 Ga0496113_0023730
1252 Ga0496114_0022525
1253 Ga0496114_0066587
1254 Ga0496115_0015067
1255 Ga0496122_0007705
1256 Ga0496124_0368725
1257 Ga0496125_0001094
1258 Ga0496126_0030598
1259 Ga0501037_0417133
1260 Ga0501073_0647553
1261 Ga0501074_0297415
1262 Ga0501257_086408
1263 Ga0501035_0856779
1264 nmdc:mga0k408_13648_c1
1265 nmdc:mga0k408_314246_c1
1266 nmdc:mga07m45_224605_c1
1267 nmdc:mga07m45_7495_c1
1268 nmdc:mga0qj67_1116501_c1
1269 nmdc:mga08y16_152166_c1
1270 Ga0495619_0761034
1271 Ga0466962_0008037
1272 2886848805

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

63

153

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lbe-assembly1.cif.gz_B the crystal structure of smu.793 from streptococcus mutans ua159 bound to acetyl coa 0.9197 36 161
3e8p-assembly1.cif.gz_D crystal structure of the protein q8e9m7 from shewanella oneidensis related to thioesterase superfamily. northeast structural genomics consortium target sor246. 0.9132 15 161
1zki-assembly1.cif.gz_B structure of conserved protein pa5202 from pseudomonas aeruginosa 0.9113 30 159
3s4k-assembly1.cif.gz_A structure of a putative esterase rv1847/mt1895 from mycobacterium tuberculosis 0.9112 28 161
3e29-assembly1.cif.gz_D x-ray structure of the protein q7we92_borbr from thioesterase superfamily. northeast structural genomics consortium target bor214a. 0.909 19 161
ID Description Score Start End Superfamily
4xmhA00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.929 123 159 2.40.128.20
af_P0ADP2_3_154_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9272 16 160 3.10.129.10
3s4kB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9109 28 161 3.10.129.10
3e29D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9046 24 161 3.10.129.10
4xy5A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9031 36 160 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A373FNZ3-F1-model_v4 Thioesterase family protein 0.9852 10 161 GO:0016790
AF-A0A3C0Y8G0-F1-model_v4 Thioesterase family protein 0.9822 9 161 GO:0016289
AF-A0A2M6VKI3-F1-model_v4 Thioesterase 0.9756 1 161 GO:0047617
AF-A0A315B7V6-F1-model_v4 Thioesterase 0.9715 1 161 GO:0047617
AF-A0A5C7NZM4-F1-model_v4 Thioesterase family protein 0.9711 24 161 GO:0016289

Map