F471306

General Info

Members Datasets Scaffolds Average Seq Length
636 366 570 305

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10074345|Ga0065714_100743453
Length 359
Sequence MPNCASSHKFFTENHVSSIPRANVGKGPLRPRHRNTIPRPDGPDFPELRTISFIFQPMPAPDLSSRQLRAFTALAEQRNFTRAAETCHLSQPAFSALIRTLEETLGARLFDRDTRSVQLTPEGRLFEPSARRLLDDMQGAIGDLADHTQRRKGRVSVAALPSLAAGWLPAILAEFMQAWPGITVELHDALSDACIAQLRSHQADFALAATGAGAAAASDLRGRKLCDDRFHLVCRKDHALATVPRLTAKQLAPWPFIQMARNSSVRQSLDVALHPLRLNAVFEVEHLATVMGLVEAGIGISVVPELTLFHFRRDTLVTRPLPLPGLTRTIYLVQRREGSLSVAAQTLHDLILARLGTLN

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
3 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
4 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
5 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
6 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
7 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
8 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
9 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
10 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
11 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
12 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
13 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
14 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
15 2643221658 Variovorax sp. Root411 Isolate Unclassified
16 2643221672 Variovorax sp. Root434 Isolate Unclassified
17 2643221683 Variovorax sp. Root473 Isolate Unclassified
18 2738541277 Variovorax sp. GV051 Isolate Unclassified
19 2738541307 Variovorax sp. GV008 Isolate Unclassified
20 2738543013 Variovorax sp. BT01 Isolate Unclassified
21 2738543019 Variovorax sp. GV040 Isolate Unclassified
22 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
23 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
24 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
25 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
26 2818991436 Collimonas arenae 515 Isolate Unclassified
27 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
28 2818991446 Variovorax sp. 1180 Isolate Unclassified
29 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
30 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
31 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
32 2842677519 Variovorax sp. R-72495 Isolate Unclassified
33 2842733646 Variovorax sp. R-72446 Isolate Unclassified
34 2842747753 Variovorax sp. R-72060 Isolate Unclassified
35 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
36 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
37 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
38 2855730933 Achromobacter sp. HZ28 Isolate Nodule
39 2855767633 Achromobacter sp. HZ34 Isolate Nodule
40 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
41 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
42 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
43 2885198086 Variovorax sp. 679 Isolate Unclassified
44 2885211737 Variovorax sp. 553 Isolate Unclassified
45 2885266251 Ralstonia sp. SET104 Isolate Nodule
46 2899924645 Variovorax sp. 369 Isolate Unclassified
47 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
48 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
49 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
50 2904456579 Variovorax sp. 2002 Isolate Unclassified
51 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
52 2928037797 Variovorax sp. 1126 Isolate Unclassified
53 2928044640 Variovorax sp. 1128 Isolate Unclassified
54 2928051484 Variovorax sp. 1133 Isolate Unclassified
55 2928058823 Ralstonia sp. 1138 Isolate Unclassified
56 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
57 2928070936 Variovorax gossypii 1167 Isolate Unclassified
58 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
59 2929520902 Variovorax beijingensis 502 Isolate Unclassified
60 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
61 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
62 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
63 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
64 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
65 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
66 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
67 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
68 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
69 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
70 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
71 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
72 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
73 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
74 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
75 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
76 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
77 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
78 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
79 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
80 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
81 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
82 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
83 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
84 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
85 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
86 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
87 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
88 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
89 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
90 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
91 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
92 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
93 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
94 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
95 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
96 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
97 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
98 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
99 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
100 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
101 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
102 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
103 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
104 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
105 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
106 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
107 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
108 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
109 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
110 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
111 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
112 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
113 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
114 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
115 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
116 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
117 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
118 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
119 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
120 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
121 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
122 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
123 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
124 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
125 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
126 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
127 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
131 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
137 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
138 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
139 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
140 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
144 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
146 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
153 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
154 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
156 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
157 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
158 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
161 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
162 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
163 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
170 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
172 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
175 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
200 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
201 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
202 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
203 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
204 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
205 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
206 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
207 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
208 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
209 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
212 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
213 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
214 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
221 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
222 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
223 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
224 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
225 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
226 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
227 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
228 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
229 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
230 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
231 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
232 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
233 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
234 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
235 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
236 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
237 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
238 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
239 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
240 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
241 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
242 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
243 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
244 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
245 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
246 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
247 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
248 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
249 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
250 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
251 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
252 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
253 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
254 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
257 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
260 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
261 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
262 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
263 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
264 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
265 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
266 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
267 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
268 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
269 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
270 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
271 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
272 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
273 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
274 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
275 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
276 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
277 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
278 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
279 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
280 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
281 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
282 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
283 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
284 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
285 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
286 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
287 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
288 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
289 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
290 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
291 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
292 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
293 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
294 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
295 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
296 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
297 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
298 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
299 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
300 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
301 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
302 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
303 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
304 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
305 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
306 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
307 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
308 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
309 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
310 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
313 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
314 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
315 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
316 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
317 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
318 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
319 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
320 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
321 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
322 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
323 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
330 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
332 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
333 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
334 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
335 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
336 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
337 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
338 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
339 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
340 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
341 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
342 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
343 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
344 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
345 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
346 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
347 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
348 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
349 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
350 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
351 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
352 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
353 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
354 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
355 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
356 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
357 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
358 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
359 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
360 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
361 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
362 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
363 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
364 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
365 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
366 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.52
Metatranscriptomes 1.1
Isolates 10.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 40.09
Nodule 2.2
Rhizoplane 1.26
Rhizosphere 43.87
Stem 0
Stem Tuber 0.16
Unclassified 12.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000174 3300001915 Bacteria 18584
2 JGI24740J21852_10000852 3300001979 Bacteria 13458
3 JGI24740J21852_10001192 3300001979 Bacteria 11728
4 JGI24740J21852_10004237 3300001979 Bacteria 6182
5 JGI24740J21852_10043788 3300001979 Bacteria 1332
6 JGI25155J39150_1000357 3300002704 Bacteria 14284
7 JGI25156J39149_1000398 3300002705 Bacteria 27303
8 JGI25162J39368_1000026 3300002737 Bacteria 227710
9 JGI25162J39368_1000027 3300002737 Bacteria 223163
10 JGI25154J39366_1000241 3300002738 Bacteria 35875
11 JGI25154J39366_1000349 3300002738 Bacteria 26415
12 JGI25154J39366_1000405 3300002738 Bacteria 23503
13 JGI25154J39366_1001245 3300002738 Bacteria 9581
14 JGI25158J39367_1001439 3300002739 Bacteria 4171
15 JGI25157J39369_1000105 3300002741 Bacteria 71453
16 JGI25152J39213_1014378 3300002773 Bacteria 1608
17 JGI25150J39212_1000679 3300002774 Bacteria 12436
18 JGI25150J39212_1003302 3300002774 Bacteria 3798
19 JGI25159J45721_1005058 3300002987 Bacteria 4203
20 JGI25159J45721_1006953 3300002987 Bacteria 3307
21 JGI25159J45721_1017845 3300002987 Bacteria 1451
22 JGI25151J46595_10000045 3300003187 Bacteria 169207
23 JGI25151J46595_10000285 3300003187 Bacteria 57259
24 JGI25151J46595_10000412 3300003187 Bacteria 43739
25 JGI25151J46595_10001901 3300003187 Bacteria 13275
26 JGI25165J46597_1000031 3300003214 Bacteria 296858
27 JGI25153J46596_10010430 3300003215 Bacteria 4203
28 JGI25153J46596_10021547 3300003215 Bacteria 2399
29 rootL2_10070966 3300003322 Bacteria 8408
30 rootL2_10112703 3300003322 Bacteria 3205
31 JGI25160J50197_1007660 3300003354 Bacteria 4203
32 JGI25160J50197_1009350 3300003354 Bacteria 3645
33 JGI25160J50197_1014814 3300003354 Bacteria 2588
34 Ga0006562J51391_1047816 3300003578 Bacteria 2920
35 Ga0006562J51391_1047817 3300003578 Bacteria 1970
36 Ga0006562J51391_1126290 3300003578 Bacteria 1520
37 Ga0006562J51391_1126291 3300003578 Bacteria 1370
38 Ga0006562J51391_1128109 3300003578 Bacteria 1520
39 Ga0006562J51391_1128110 3300003578 Bacteria 1736
40 Ga0055538_1000018 3300003751 Bacteria 296858
41 Ga0055538_1003595 3300003751 Bacteria 1933
42 Ga0055539_1000023 3300003752 Bacteria 296858
43 Ga0055539_1000053 3300003752 Bacteria 165149
44 Ga0055533_1000031 3300003756 Bacteria 296858
45 Ga0055533_1002112 3300003756 Bacteria 4773
46 Ga0055532_1000033 3300003758 Bacteria 214652
47 Ga0055532_1000051 3300003758 Bacteria 165365
48 Ga0055525_1000039 3300003759 Bacteria 296858
49 Ga0055525_1000440 3300003759 Bacteria 24091
50 Ga0055525_1000621 3300003759 Bacteria 14565
51 Ga0055535_1000024 3300003761 Bacteria 214652
52 Ga0055535_1000274 3300003761 Bacteria 54132
53 Ga0055542_1000027 3300003762 Bacteria 254819
54 Ga0055529_1000044 3300003763 Bacteria 214652
55 Ga0055526_1002868 3300003771 Bacteria 11363
56 Ga0055526_1007438 3300003771 Bacteria 5688
57 Ga0055526_1009818 3300003771 Bacteria 4546
58 Ga0055526_1010720 3300003771 Bacteria 4228
59 Ga0055526_1010795 3300003771 Bacteria 4203
60 Ga0055537_1000006 3300003773 Bacteria 147020
61 Ga0055537_1000162 3300003773 Bacteria 50062
62 Ga0055537_1000445 3300003773 Bacteria 26375
63 Ga0055537_1002317 3300003773 Bacteria 6501
64 Ga0055537_1003980 3300003773 Bacteria 4363
65 Ga0055537_1004001 3300003773 Bacteria 4339
66 Ga0055537_1004177 3300003773 Bacteria 4203
67 Ga0055524_1000032 3300003775 Bacteria 182182
68 Ga0055524_1000690 3300003775 Bacteria 23658
69 Ga0055524_1008604 3300003775 Bacteria 4228
70 Ga0055524_1008676 3300003775 Bacteria 4203
71 Ga0055524_1038591 3300003775 Bacteria 1246
72 Ga0055536_1000163 3300003781 Bacteria 56770
73 Ga0055536_1003187 3300003781 Bacteria 8888
74 Ga0055536_1016958 3300003781 Bacteria 2408
75 Ga0055534_1000128 3300003784 Bacteria 56698
76 Ga0055534_1001699 3300003784 Bacteria 8395
77 Ga0055534_1003814 3300003784 Bacteria 4615
78 Ga0055534_1004269 3300003784 Bacteria 4203
79 Ga0055534_1005845 3300003784 Bacteria 3213
80 Ga0055528_1000504 3300003790 Bacteria 30737
81 Ga0055528_1006119 3300003790 Bacteria 5497
82 Ga0055528_1009033 3300003790 Bacteria 4203
83 Ga0055528_1012244 3300003790 Bacteria 3345
84 Ga0055530_10000328 3300003791 Bacteria 42975
85 Ga0055530_10000866 3300003791 Bacteria 24928
86 Ga0055530_10003406 3300003791 Bacteria 9074
87 Ga0055530_10014544 3300003791 Bacteria 2615
88 Ga0055540_1000046 3300003792 Bacteria 148762
89 Ga0055540_1000813 3300003792 Bacteria 21129
90 Ga0055540_1004807 3300003792 Bacteria 5937
91 Ga0055540_1007252 3300003792 Bacteria 4229
92 Ga0055531_10000428 3300003794 Bacteria 39914
93 Ga0055531_10002570 3300003794 Bacteria 12051
94 Ga0055531_10011137 3300003794 Bacteria 4378
95 Ga0055531_10014498 3300003794 Bacteria 3543
96 Ga0055531_10034955 3300003794 Bacteria 1584
97 Ga0055541_1000016 3300003841 Bacteria 296861
98 Ga0055541_1000303 3300003841 Bacteria 16411
99 Ga0055543_1003838 3300004625 Bacteria 4266
100 Ga0055543_1003866 3300004625 Bacteria 4241
101 Ga0065165_1007662 3300005262 Bacteria 5243
102 Ga0065165_1009778 3300005262 Bacteria 4241
103 Ga0065714_10074345 3300005288 Bacteria 3032
104 Ga0070658_10134468 3300005327 Bacteria 2062
105 Ga0070660_100007159 3300005339 Bacteria 7757
106 Ga0070661_100000021 3300005344 Bacteria 128510
107 Ga0070669_100087562 3300005353 Bacteria 2329
108 Ga0070673_100445481 3300005364 Unclassified 1164
109 Ga0070659_100000839 3300005366 Bacteria 22393
110 Ga0070663_100000004 3300005455 Bacteria 254839
111 Ga0070679_100094032 3300005530 Bacteria 2985
112 Ga0068853_100005678 3300005539 Bacteria 9811
113 Ga0068853_100341405 3300005539 Bacteria 1392
114 Ga0068855_100120233 3300005563 Bacteria 3006
115 Ga0068855_100504858 3300005563 Bacteria 1314
116 Ga0068855_100510097 3300005563 Bacteria 1306
117 Ga0070664_100000007 3300005564 Bacteria 176744
118 Ga0068857_100016420 3300005577 Bacteria 6487
119 Ga0068854_100000045 3300005578 Bacteria 91844
120 Ga0068856_100000004 3300005614 Bacteria 233761
121 Ga0068856_100236266 3300005614 Bacteria 1843
122 Ga0075365_10001542 3300006038 Bacteria 10541
123 Ga0075363_100004545 3300006048 Bacteria 6083
124 Ga0075364_10003241 3300006051 Bacteria 9217
125 Ga0075364_10029645 3300006051 Bacteria 3510
126 Ga0075364_10082317 3300006051 Bacteria 2130
127 Ga0075432_10002170 3300006058 Bacteria 6527
128 Ga0075432_10017820 3300006058 Bacteria 2422
129 Ga0075362_10002812 3300006177 Bacteria 5938
130 Ga0075362_10095521 3300006177 Bacteria 1384
131 Ga0075366_10002392 3300006195 Bacteria 9626
132 Ga0075366_10016252 3300006195 Bacteria 4275
133 Ga0075366_10069943 3300006195 Bacteria 2090
134 Ga0075370_10000759 3300006353 Bacteria 12912
135 Ga0075370_10047873 3300006353 Bacteria 2421
136 Ga0079104_1007154 3300006946 Bacteria 4091
137 Ga0079104_1016174 3300006946 Bacteria 2189
138 Ga0079104_1020222 3300006946 Bacteria 1840
139 Ga0099826_10000065 3300006948 Bacteria 60649
140 Ga0099826_10000122 3300006948 Bacteria 35250
141 Ga0105251_10078738 3300009011 Bacteria 1526
142 Ga0105240_10014225 3300009093 Bacteria 10869
143 Ga0105240_10113980 3300009093 Bacteria 3266
144 Ga0105240_10264636 3300009093 Bacteria 1982
145 Ga0105240_10281036 3300009093 Bacteria 1912
146 Ga0105243_10017120 3300009148 Bacteria 5482
147 Ga0105239_10402938 3300010375 Bacteria 1548
148 Ga0157347_1000228 3300012502 Bacteria 3257
149 Ga0157373_10003146 3300013100 Bacteria 12471
150 Ga0157373_10037094 3300013100 Bacteria 3496
151 Ga0157371_10000001 3300013102 Bacteria 1162285
152 Ga0157371_10000028 3300013102 Bacteria 254964
153 Ga0157370_10000002 3300013104 Bacteria 431400
154 Ga0157370_10001308 3300013104 Bacteria 31056
155 Ga0157370_10224212 3300013104 Bacteria 1740
156 Ga0157369_10002517 3300013105 Bacteria 21909
157 Ga0157369_10007328 3300013105 Bacteria 12697
158 Ga0157372_10000619 3300013307 Bacteria 38787
159 Ga0182008_10001266 3300014497 Bacteria 17367
160 Ga0182008_10026396 3300014497 Bacteria 2946
161 Ga0182008_10113687 3300014497 Bacteria 1342
162 Ga0182006_1008186 3300015261 Bacteria 4742
163 Ga0182007_10004904 3300015262 Bacteria 5974
164 Ga0182005_1000252 3300015265 Bacteria 34129
165 Ga0183362_10001 3300015683 Bacteria 2046624
166 Ga0163161_10000079 3300017792 Bacteria 97522
167 Ga0163161_10001508 3300017792 Bacteria 17221
168 Ga0163161_10020413 3300017792 Bacteria 4649
169 Ga0163161_10087750 3300017792 Bacteria 2298
170 Ga0163161_10176756 3300017792 Bacteria 1635
171 Ga0206351_10260248 3300020077 Bacteria 2756
172 Ga0209435_100028 3300025206 Bacteria 182520
173 Ga0209435_100037 3300025206 Bacteria 124928
174 Ga0209760_101921 3300025207 Bacteria 2043
175 Ga0209436_102723 3300025208 Bacteria 5092
176 Ga0209784_100024 3300025224 Bacteria 394613
177 Ga0209784_100027 3300025224 Bacteria 363933
178 Ga0209784_100525 3300025224 Bacteria 14438
179 Ga0209784_101405 3300025224 Bacteria 3266
180 Ga0209566_100018 3300025225 Bacteria 448638
181 Ga0209566_100027 3300025225 Bacteria 363933
182 Ga0209566_100129 3300025225 Bacteria 92878
183 Ga0209674_100044 3300025226 Bacteria 363933
184 Ga0209674_100225 3300025226 Bacteria 51780
185 Ga0209674_100305 3300025226 Bacteria 33309
186 Ga0209674_100775 3300025226 Bacteria 10818
187 Ga0209672_100068 3300025228 Bacteria 175572
188 Ga0209672_104679 3300025228 Bacteria 2493
189 Ga0209147_100004 3300025229 Bacteria 1371850
190 Ga0209147_100008 3300025229 Bacteria 777096
191 Ga0209147_100940 3300025229 Bacteria 12877
192 Ga0209563_100039 3300025230 Bacteria 409717
193 Ga0209563_100048 3300025230 Bacteria 363933
194 Ga0209563_102266 3300025230 Bacteria 4444
195 Ga0207427_100616 3300025231 Bacteria 17528
196 Ga0209437_100053 3300025233 Bacteria 375580
197 Ga0209437_100055 3300025233 Bacteria 363933
198 Ga0209258_100013 3300025242 Bacteria 777096
199 Ga0209258_100048 3300025242 Bacteria 365881
200 Ga0209258_100398 3300025242 Bacteria 54737
201 Ga0207425_1000107 3300025245 Bacteria 77829
202 Ga0209646_1000021 3300025246 Bacteria 461083
203 Ga0209646_1000063 3300025246 Bacteria 248065
204 Ga0209646_1000095 3300025246 Bacteria 182520
205 Ga0209026_1000110 3300025250 Bacteria 141989
206 Ga0209026_1007165 3300025250 Bacteria 2572
207 Ga0209677_100024 3300025253 Bacteria 406035
208 Ga0209677_100028 3300025253 Bacteria 363933
209 Ga0209148_1000019 3300025254 Bacteria 748518
210 Ga0209148_1000040 3300025254 Bacteria 473531
211 Ga0209148_1004104 3300025254 Bacteria 3683
212 Ga0209759_1000080 3300025256 Bacteria 171186
213 Ga0209759_1000115 3300025256 Bacteria 141877
214 Ga0209759_1000155 3300025256 Bacteria 118819
215 Ga0209759_1001910 3300025256 Bacteria 10220
216 Ga0209759_1007204 3300025256 Bacteria 3615
217 Ga0209129_1000007 3300025258 Bacteria 771325
218 Ga0209129_1001384 3300025258 Bacteria 13561
219 Ga0209129_1007676 3300025258 Bacteria 3148
220 Ga0209233_1000070 3300025261 Bacteria 363933
221 Ga0209565_1000016 3300025263 Bacteria 477707
222 Ga0209565_1000178 3300025263 Bacteria 80603
223 Ga0209565_1000196 3300025263 Bacteria 72238
224 Ga0209565_1000229 3300025263 Bacteria 61660
225 Ga0209565_1000336 3300025263 Bacteria 41751
226 Ga0209565_1001871 3300025263 Bacteria 8381
227 Ga0209565_1014648 3300025263 Bacteria 1793
228 Ga0209565_1021622 3300025263 Bacteria 1342
229 Ga0209455_1000042 3300025272 Bacteria 419638
230 Ga0209455_1007520 3300025272 Bacteria 3066
231 Ga0209673_1000073 3300025273 Bacteria 233645
232 Ga0209673_1000463 3300025273 Bacteria 68460
233 Ga0209673_1000764 3300025273 Bacteria 43642
234 Ga0209673_1000884 3300025273 Bacteria 38736
235 Ga0209673_1009344 3300025273 Bacteria 4260
236 Ga0209673_1041756 3300025273 Bacteria 1298
237 Ga0209130_1000210 3300025284 Bacteria 77155
238 Ga0209130_1000263 3300025284 Bacteria 65894
239 Ga0209130_1000580 3300025284 Bacteria 35617
240 Ga0209130_1001148 3300025284 Bacteria 19288
241 Ga0209675_1000080 3300025291 Bacteria 154613
242 Ga0209675_1000092 3300025291 Bacteria 144839
243 Ga0209675_1000186 3300025291 Bacteria 68471
244 Ga0209675_1000361 3300025291 Bacteria 38739
245 Ga0209675_1001704 3300025291 Bacteria 12152
246 Ga0209675_1002302 3300025291 Bacteria 9905
247 Ga0209675_1003136 3300025291 Bacteria 8046
248 Ga0209675_1017016 3300025291 Bacteria 2093
249 Ga0209676_1000004 3300025292 Bacteria 1138360
250 Ga0209676_1000165 3300025292 Bacteria 156709
251 Ga0209676_1000172 3300025292 Bacteria 153664
252 Ga0209676_1000480 3300025292 Bacteria 65842
253 Ga0209676_1008977 3300025292 Bacteria 4381
254 Ga0209676_1011313 3300025292 Bacteria 3612
255 Ga0209025_1000039 3300025294 Bacteria 377396
256 Ga0209025_1000114 3300025294 Bacteria 218921
257 Ga0209025_1000125 3300025294 Bacteria 201444
258 Ga0209025_1000222 3300025294 Bacteria 135688
259 Ga0209025_1000230 3300025294 Bacteria 131131
260 Ga0209025_1000278 3300025294 Bacteria 117718
261 Ga0209025_1000628 3300025294 Bacteria 62542
262 Ga0209025_1005386 3300025294 Bacteria 10474
263 Ga0209025_1011879 3300025294 Bacteria 5669
264 Ga0209564_1000165 3300025295 Bacteria 160244
265 Ga0209564_1000200 3300025295 Bacteria 137503
266 Ga0209564_1000318 3300025295 Bacteria 93851
267 Ga0209564_1000489 3300025295 Bacteria 65860
268 Ga0209564_1000582 3300025295 Bacteria 57908
269 Ga0209564_1002074 3300025295 Bacteria 17227
270 Ga0209564_1012912 3300025295 Bacteria 3597
271 Ga0209758_1000025 3300025297 Bacteria 586687
272 Ga0209758_1002670 3300025297 Bacteria 17613
273 Ga0209758_1012494 3300025297 Bacteria 4747
274 Ga0209758_1042251 3300025297 Bacteria 1693
275 Ga0209050_1000002 3300025298 Bacteria 1792849
276 Ga0209050_1000084 3300025298 Bacteria 263245
277 Ga0209050_1000565 3300025298 Bacteria 60237
278 Ga0209256_1000067 3300025299 Bacteria 246812
279 Ga0209256_1000110 3300025299 Bacteria 182312
280 Ga0209256_1000198 3300025299 Bacteria 113429
281 Ga0209256_1000335 3300025299 Bacteria 78765
282 Ga0209256_1000362 3300025299 Bacteria 73517
283 Ga0209256_1032242 3300025299 Bacteria 1423
284 Ga0207426_1000001 3300025302 Bacteria 1341301
285 Ga0207426_1000178 3300025302 Bacteria 159291
286 Ga0207426_1000264 3300025302 Bacteria 110747
287 Ga0207426_1000436 3300025302 Bacteria 67619
288 Ga0207426_1002104 3300025302 Bacteria 13705
289 Ga0209051_1000002 3300025303 Bacteria 1631846
290 Ga0209051_1000058 3300025303 Bacteria 263137
291 Ga0209051_1000096 3300025303 Bacteria 167399
292 Ga0209051_1000278 3300025303 Bacteria 83769
293 Ga0209051_1000673 3300025303 Bacteria 38238
294 Ga0209051_1001488 3300025303 Bacteria 19623
295 Ga0209051_1010611 3300025303 Bacteria 4626
296 Ga0209051_1015557 3300025303 Bacteria 3492
297 Ga0209051_1022601 3300025303 Bacteria 2643
298 Ga0209257_1000002 3300025304 Bacteria 1767052
299 Ga0209257_1000022 3300025304 Bacteria 765258
300 Ga0209257_1000072 3300025304 Bacteria 332791
301 Ga0209257_1000092 3300025304 Bacteria 263137
302 Ga0209257_1011137 3300025304 Bacteria 4387
303 Ga0207713_1056345 3300025735 Bacteria 1528
304 Ga0207705_10124608 3300025909 Bacteria 1914
305 Ga0207695_10001071 3300025913 Bacteria 47830
306 Ga0207695_10015134 3300025913 Bacteria 9100
307 Ga0207695_10181958 3300025913 Bacteria 2023
308 Ga0207671_10159153 3300025914 Bacteria 1748
309 Ga0207657_10051639 3300025919 Bacteria 3573
310 Ga0207649_10000030 3300025920 Bacteria 154458
311 Ga0207652_10105578 3300025921 Bacteria 2492
312 Ga0207681_10110578 3300025923 Bacteria 1998
313 Ga0207690_10001459 3300025932 Bacteria 14792
314 Ga0207709_10004910 3300025935 Bacteria 7655
315 Ga0207691_10304944 3300025940 Bacteria 1367
316 Ga0207679_10000004 3300025945 Bacteria 589021
317 Ga0207667_10166753 3300025949 Bacteria 2264
318 Ga0207667_10527763 3300025949 Bacteria 1195
319 Ga0207640_10000155 3300025981 Bacteria 49469
320 Ga0207639_10180756 3300026041 Bacteria 1794
321 Ga0207678_10000005 3300026067 Bacteria 193984
322 Ga0207702_10000342 3300026078 Bacteria 53546
323 Ga0207702_10573670 3300026078 Bacteria 1105
324 Ga0207675_100214544 3300026118 Unclassified 1852
325 Ga0207698_10154674 3300026142 Bacteria 1996
326 Ga0209282_1000057 3300027666 Bacteria 99758
327 Ga0209282_1005596 3300027666 Bacteria 7730
328 Ga0207428_10087053 3300027907 Bacteria 2431
329 Ga0268266_10167691 3300028379 Bacteria 1991
330 Ga0316176_1085576 3300030732 Bacteria 6139
331 Ga0314311_1207443 3300030733 Bacteria 5190
332 Ga0316179_1087651 3300030734 Bacteria 4112
333 Ga0316178_1008722 3300030735 Bacteria 6969
334 Ga0316180_1108197 3300030736 Bacteria 3425
335 Ga0316183_1023144 3300030742 Bacteria 13762
336 Ga0316181_1207329 3300030744 Bacteria 3325
337 Ga0316182_1238298 3300030745 Bacteria 2783
338 Ga0265327_10003596 3300031251 Bacteria 14624
339 Ga0307513_10000066 3300031456 Bacteria 141617
340 Ga0307408_100011351 3300031548 Bacteria 5885
341 Ga0307408_100019360 3300031548 Bacteria 4582
342 Ga0307408_100319387 3300031548 Bacteria 1307
343 Ga0307405_10039858 3300031731 Bacteria 2842
344 Ga0307405_10053765 3300031731 Bacteria 2510
345 Ga0307410_10294198 3300031852 Bacteria 1279
346 Ga0307406_10000129 3300031901 Bacteria 44483
347 Ga0307406_10007196 3300031901 Bacteria 6164
348 Ga0307406_10146839 3300031901 Bacteria 1677
349 Ga0307407_10270863 3300031903 Bacteria 1172
350 Ga0307412_10009245 3300031911 Bacteria 5649
351 Ga0307412_10030907 3300031911 Bacteria 3377
352 Ga0307412_10044875 3300031911 Bacteria 2886
353 Ga0307412_10082604 3300031911 Bacteria 2225
354 Ga0307412_10271310 3300031911 Bacteria 1327
355 Ga0307412_10359337 3300031911 Bacteria 1172
356 Ga0307414_10022669 3300032004 Bacteria 3966
357 Ga0307414_10036835 3300032004 Bacteria 3270
358 Ga0307411_10011599 3300032005 Bacteria 4767
359 Ga0307411_10157031 3300032005 Bacteria 1698
360 Ga0307411_10198056 3300032005 Bacteria 1540
361 Ga0307411_10198191 3300032005 Bacteria 1539
362 Ga0395900_0089947 3300037418 Bacteria 3155
363 Ga0395905_0001326 3300037471 Bacteria 30204
364 Ga0395905_0213441 3300037471 Bacteria 1808
365 Ga0395901_0438761 3300038443 Bacteria 1337
366 Ga0439436_0006267 3300041404 Bacteria 3652
367 Ga0439436_0015800 3300041404 Bacteria 2268
368 Ga0439438_040191 3300041405 Bacteria 1216
369 Ga0439447_012885 3300041407 Bacteria 2389
370 Ga0439466_0001839 3300041411 Bacteria 8332
371 Ga0439466_0003263 3300041411 Bacteria 6316
372 Ga0439466_0022118 3300041411 Bacteria 2247
373 Ga0439465_0002729 3300041413 Bacteria 5771
374 Ga0439465_0008377 3300041413 Bacteria 3264
375 Ga0451853_2505844 3300041512 Bacteria 1623
376 Ga0439431_0000602 3300041997 Bacteria 7602
377 Ga0439431_0002506 3300041997 Bacteria 4062
378 Ga0439431_0021968 3300041997 Bacteria 1535
379 Ga0439442_000356 3300042002 Bacteria 10906
380 Ga0439442_007780 3300042002 Bacteria 2162
381 Ga0439432_002354 3300042006 Bacteria 7133
382 Ga0439432_036936 3300042006 Bacteria 1561
383 Ga0439449_0001161 3300042007 Bacteria 10323
384 Ga0439449_0040381 3300042007 Bacteria 1734
385 Ga0439452_001694 3300042010 Bacteria 8661
386 Ga0439452_015968 3300042010 Bacteria 2048
387 Ga0439462_0005665 3300042015 Bacteria 3083
388 Ga0439462_0008376 3300042015 Bacteria 2605
389 Ga0450911_004615 3300042115 Bacteria 2237
390 Ga0450911_009592 3300042115 Bacteria 1354
391 Ga0450921_000059 3300042123 Bacteria 3054
392 Ga0450922_003756 3300042124 Bacteria 1397
393 Ga0450923_000356 3300042125 Bacteria 4755
394 Ga0450898_006207 3300042134 Bacteria 1828
395 Ga0450906_000114 3300042145 Bacteria 14010
396 Ga0450910_001770 3300042147 Bacteria 2777
397 Ga0439446_0001003 3300042156 Bacteria 6164
398 Ga0439446_0003242 3300042156 Bacteria 4014
399 Ga0450908_000411 3300042184 Bacteria 8254
400 Ga0450909_003251 3300042185 Bacteria 2313
401 Ga0439434_0002977 3300042435 Bacteria 4954
402 Ga0439434_0006263 3300042435 Bacteria 3472
403 Ga0450918_001238 3300042531 Bacteria 5188
404 Ga0466986_0022780 3300044650 Bacteria 4163
405 Ga0466972_0005748 3300044658 Bacteria 6210
406 Ga0466982_0004071 3300044672 Bacteria 6527
407 Ga0466965_0007706 3300044683 Bacteria 4954
408 Ga0466966_0117721 3300044684 Bacteria 1634
409 Ga0466961_0000194 3300044693 Bacteria 40839
410 Ga0466971_0012336 3300044719 Bacteria 3744
411 Ga0466970_0002743 3300044765 Bacteria 8504
412 Ga0466970_0106289 3300044765 Bacteria 1531
413 Ga0466957_0018736 3300044842 Bacteria 4066
414 Ga0466957_0176994 3300044842 Bacteria 1392
415 Ga0466960_0028531 3300044901 Bacteria 2554
416 Ga0466959_0000928 3300045049 Bacteria 17381
417 Ga0466967_0026078 3300045976 Bacteria 4834
418 Ga0495627_002599 3300046453 Bacteria 8520
419 Ga0495627_009896 3300046453 Bacteria 3491
420 Ga0495592_0025069 3300046454 Bacteria 4529
421 Ga0495638_0025738 3300046460 Bacteria 3820
422 Ga0495638_0038579 3300046460 Bacteria 3034
423 Ga0495653_0013213 3300046463 Bacteria 6730
424 Ga0495650_0000015 3300046471 Bacteria 557595
425 Ga0495605_0000624 3300046474 Bacteria 27289
426 Ga0495596_0000038 3300046500 Bacteria 95273
427 Ga0495607_0000048 3300046501 Bacteria 121640
428 Ga0495607_0001888 3300046501 Bacteria 17773
429 Ga0495607_0015724 3300046501 Bacteria 4897
430 Ga0495583_0002011 3300046506 Bacteria 18547
431 Ga0495606_0000208 3300046507 Bacteria 103578
432 Ga0495606_0002379 3300046507 Bacteria 22053
433 Ga0495608_0015415 3300046511 Bacteria 5300
434 Ga0495610_0000141 3300046512 Bacteria 79877
435 Ga0495610_0051727 3300046512 Bacteria 1997
436 Ga0495616_0001178 3300046513 Bacteria 18447
437 Ga0495616_0001459 3300046513 Bacteria 16445
438 Ga0495616_0004666 3300046513 Bacteria 8595
439 Ga0495618_0045013 3300046514 Bacteria 2783
440 Ga0495620_0013152 3300046515 Bacteria 4247
441 Ga0495620_0070522 3300046515 Bacteria 1431
442 Ga0495628_0000827 3300046516 Bacteria 28693
443 Ga0495631_0000021 3300046518 Bacteria 92765
444 Ga0495632_0001125 3300046519 Bacteria 22872
445 Ga0495637_0002203 3300046520 Bacteria 10890
446 Ga0495637_0021191 3300046520 Bacteria 2982
447 Ga0495643_0000328 3300046522 Bacteria 65181
448 Ga0495644_0062315 3300046523 Bacteria 1401
449 Ga0495642_0050011 3300046528 Bacteria 1717
450 Ga0495642_0065219 3300046528 Bacteria 1516
451 Ga0495652_0034890 3300046529 Bacteria 4381
452 Ga0495652_0119845 3300046529 Bacteria 2100
453 Ga0495654_0021664 3300046530 Bacteria 3342
454 Ga0495609_0001032 3300046538 Bacteria 19570
455 Ga0495621_0036435 3300046539 Bacteria 1707
456 Ga0495597_0016789 3300046542 Bacteria 3454
457 Ga0495597_0048561 3300046542 Bacteria 1877
458 Ga0495645_0054893 3300046543 Bacteria 2893
459 Ga0495622_0066605 3300046557 Bacteria 1665
460 Ga0495633_0015227 3300046558 Bacteria 3995
461 Ga0495656_0000141 3300046615 Bacteria 26743
462 Ga0495668_0015172 3300046616 Bacteria 4504
463 Ga0495625_0000437 3300046660 Bacteria 62719
464 Ga0495625_0043430 3300046660 Bacteria 3259
465 Ga0495635_0117097 3300046663 Bacteria 1818
466 Ga0495661_0002776 3300046665 Bacteria 13270
467 Ga0495661_0010954 3300046665 Bacteria 6163
468 Ga0495661_0017305 3300046665 Bacteria 4762
469 Ga0495661_0205662 3300046665 Bacteria 1028
470 Ga0495588_0077793 3300046674 Bacteria 1730
471 Ga0495599_0007322 3300046678 Bacteria 6689
472 Ga0495646_0001482 3300046680 Bacteria 13955
473 Ga0495646_0003380 3300046680 Bacteria 9918
474 Ga0495658_0002746 3300046683 Bacteria 8849
475 Ga0495624_0014709 3300046690 Bacteria 5299
476 Ga0495670_0010557 3300046691 Bacteria 4540
477 Ga0495670_0156453 3300046691 Bacteria 1196
478 Ga0495671_0000462 3300046692 Bacteria 31814
479 Ga0495671_0016868 3300046692 Bacteria 3893
480 Ga0495649_0025594 3300046694 Bacteria 3287
481 Ga0495600_0018956 3300046809 Bacteria 4391
482 Ga0495660_0088014 3300046810 Bacteria 1619
483 Ga0495660_0140419 3300046810 Bacteria 1203
484 Ga0495604_0012483 3300047317 Bacteria 6756
485 Ga0495604_0037846 3300047317 Bacteria 3797
486 Ga0495636_0004786 3300047318 Bacteria 5305
487 Ga0495672_0027483 3300047320 Bacteria 3615
488 Ga0495672_0108818 3300047320 Bacteria 1490
489 Ga0495676_0010916 3300047321 Bacteria 8211
490 Ga0495687_014410 3300047443 Bacteria 4073
491 Ga0495687_043789 3300047443 Bacteria 1948
492 Ga0495673_0000113 3300047469 Bacteria 163495
493 Ga0495593_0002373 3300047673 Bacteria 11312
494 Ga0495602_0046578 3300048088 Bacteria 3915
495 Ga0495614_0004046 3300048089 Bacteria 6589
496 Ga0495626_0001224 3300048091 Bacteria 21136
497 Ga0496101_0005734 3300048904 Bacteria 7933
498 Ga0496103_0016925 3300048906 Bacteria 4355
499 Ga0496104_0271876 3300048907 Bacteria 1607
500 Ga0496111_0091360 3300048914 Bacteria 2231
501 Ga0496117_0007805 3300048920 Bacteria 10311
502 Ga0496118_0002845 3300048921 Bacteria 22594
503 Ga0496121_0004379 3300048924 Bacteria 19076
504 Ga0496121_0030981 3300048924 Bacteria 4899
505 Ga0496121_0053672 3300048924 Bacteria 3375
506 Ga0496121_0234345 3300048924 Bacteria 1283
507 Ga0496122_0000238 3300048925 Bacteria 123588
508 Ga0496122_0000676 3300048925 Bacteria 68538
509 Ga0496122_0041484 3300048925 Bacteria 3638
510 Ga0496122_0059464 3300048925 Bacteria 2821
511 Ga0496123_0000262 3300048926 Bacteria 106366
512 Ga0496123_0008328 3300048926 Bacteria 9544
513 Ga0496123_0023727 3300048926 Bacteria 4687
514 Ga0496124_0141563 3300048927 Bacteria 1897
515 Ga0496125_0007020 3300048928 Bacteria 12051
516 Ga0496125_0012129 3300048928 Bacteria 8573
517 Ga0496125_0109544 3300048928 Bacteria 2005
518 Ga0495682_0017433 3300049460 Bacteria 2710
519 Ga0501033_0223522 3300049570 Bacteria 1339
520 Ga0501034_0000022 3300049571 Bacteria 264441
521 Ga0501036_0520420 3300049572 Bacteria 989
522 Ga0501038_0320827 3300049574 Bacteria 1212
523 Ga0501039_0135826 3300049575 Bacteria 1931
524 Ga0501047_0009582 3300049581 Bacteria 9154
525 Ga0501262_000044 3300049759 Bacteria 16463
526 Ga0501035_0023999 3300049822 Bacteria 5596
527 Ga0501044_0013376 3300049823 Bacteria 8874
528 Ga0501044_0027489 3300049823 Bacteria 6011
529 nmdc:mga03683_1355_c1 3300050489 Bacteria 7262
530 nmdc:mga03n38_17203_c1 3300050490 Bacteria 2827
531 nmdc:mga03n38_5412_c1 3300050490 Bacteria 4346
532 nmdc:mga00v17_131904_c1 3300050491 Bacteria 1597
533 nmdc:mga0yw44_473_c1 3300050492 Bacteria 14285
534 nmdc:mga0k408_250629_c1 3300050493 Unclassified 1057
535 nmdc:mga0k408_2986_c1 3300050493 Bacteria 8966
536 nmdc:mga0k408_54798_c1 3300050493 Bacteria 2311
537 nmdc:mga0k408_79253_c1 3300050493 Bacteria 1922
538 nmdc:mga07m45_41256_c1 3300050496 Bacteria 2584
539 Ga0500610_0000115 3300053079 Bacteria 24228
540 Ga0500610_0000411 3300053079 Bacteria 13125
541 Ga0500644_0073158 3300053088 Bacteria 1240
542 Ga0500651_0000360 3300053093 Bacteria 25226
543 Ga0500566_0003903 3300053094 Bacteria 8896
544 Ga0500571_000052 3300053110 Bacteria 35666
545 Ga0500593_000089 3300053117 Bacteria 33327
546 Ga0500594_0008611 3300053118 Bacteria 2329
547 Ga0500594_0014392 3300053118 Bacteria 1894
548 Ga0500595_020459 3300053119 Bacteria 2381
549 Ga0500597_016713 3300053120 Bacteria 2806
550 Ga0500607_000146 3300053121 Bacteria 59939
551 Ga0500608_002675 3300053122 Bacteria 6534
552 Ga0500618_001381 3300053125 Bacteria 10986
553 Ga0500618_019575 3300053125 Bacteria 1664
554 Ga0500626_004619 3300053128 Bacteria 5261
555 Ga0500655_008403 3300053133 Bacteria 1858
556 Ga0500658_0000052 3300053134 Bacteria 61874
557 Ga0500658_0000503 3300053134 Bacteria 16677
558 Ga0500559_0148289 3300053136 Bacteria 1100
559 Ga0500564_019948 3300053138 Bacteria 3067
560 Ga0500568_0001382 3300053139 Bacteria 15727
561 Ga0500573_0047021 3300053140 Bacteria 2486
562 Ga0500574_000444 3300053141 Bacteria 5239
563 Ga0500574_010160 3300053141 Bacteria 2076
564 Ga0500586_000131 3300053145 Bacteria 13729
565 Ga0500616_0013412 3300053153 Bacteria 4759
566 Ga0500619_022509 3300053154 Bacteria 1830
567 Ga0500627_0002112 3300053158 Bacteria 5765
568 Ga0500634_0019577 3300053161 Bacteria 3648
569 Ga0500636_0052460 3300053177 Bacteria 2395
570 Ga0466962_0009891 3300061719 Bacteria 4574

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050493 nmdc:mga0k408_250629_c1 nmdc:mga0k408_250629_c1_23_796 249
2 3300044901 Ga0466960_0028531 Ga0466960_0028531_786_1706 254
3 3300003354 JGI25160J50197_1009350 JGI25160J50197_10093502 261
4 3300025284 Ga0209130_1000263 Ga0209130_10002639 261
5 3300025302 Ga0207426_1000436 Ga0207426_100043642 261
6 3300041997 Ga0439431_0021968 Ga0439431_0021968_588_1502 261
7 3300038443 Ga0395901_0438761 Ga0395901_0438761_513_1325 263
8 3300046539 Ga0495621_0036435 Ga0495621_0036435_837_1688 271
9 3300046663 Ga0495635_0117097 Ga0495635_0117097_959_1792 271
10 3300003187 JGI25151J46595_10000285 JGI25151J46595_1000028512 274
11 3300025294 Ga0209025_1000114 Ga0209025_1000114207 274
12 3300025297 Ga0209758_1002670 Ga0209758_100267019 274
13 3300006195 Ga0075366_10069943 Ga0075366_100699433 281
14 3300049460 Ga0495682_0017433 Ga0495682_0017433_1774_2694 292
15 iso_pu_bacteria 2854601825 2854603607 292
16 iso_pu_bacteria 2855730933 2855735384 292
17 iso_pu_bacteria 2855767633 2855771167 292
18 iso_pu_bacteria 2881412998 2881416961 292
19 3300003187 JGI25151J46595_10000045 JGI25151J46595_1000004530 293
20 3300025294 Ga0209025_1000039 Ga0209025_1000039195 293
21 3300031911 Ga0307412_10082604 Ga0307412_100826042 293
22 3300046501 Ga0495607_0001888 Ga0495607_0001888_753_1688 293
23 3300006058 Ga0075432_10017820 Ga0075432_100178201 294
24 3300006948 Ga0099826_10000065 Ga0099826_1000006522 294
25 3300009011 Ga0105251_10078738 Ga0105251_100787381 294
26 3300025735 Ga0207713_1056345 Ga0207713_10563451 294
27 3300027666 Ga0209282_1000057 Ga0209282_100005763 294
28 3300031456 Ga0307513_10000066 Ga0307513_10000066119 294
29 3300041512 Ga0451853_2505844 Ga0451853_2505844_541_1434 294
30 3300042010 Ga0439452_015968 Ga0439452_015968_938_1828 294
31 3300044765 Ga0466970_0106289 Ga0466970_0106289_278_1201 294
32 3300046474 Ga0495605_0000624 Ga0495605_0000624_25049_25939 294
33 3300046500 Ga0495596_0000038 Ga0495596_0000038_75303_76193 294
34 3300046501 Ga0495607_0015724 Ga0495607_0015724_2459_3349 294
35 3300046507 Ga0495606_0000208 Ga0495606_0000208_81432_82334 294
36 3300046512 Ga0495610_0000141 Ga0495610_0000141_65088_65978 294
37 3300046513 Ga0495616_0001178 Ga0495616_0001178_12325_13215 294
38 3300046538 Ga0495609_0001032 Ga0495609_0001032_18635_19525 294
39 3300046542 Ga0495597_0048561 Ga0495597_0048561_135_1025 294
40 3300046665 Ga0495661_0002776 Ga0495661_0002776_2478_3368 294
41 3300046692 Ga0495671_0000462 Ga0495671_0000462_14202_15092 294
42 3300046694 Ga0495649_0025594 Ga0495649_0025594_2350_3240 294
43 3300046810 Ga0495660_0140419 Ga0495660_0140419_46_936 294
44 3300047320 Ga0495672_0027483 Ga0495672_0027483_261_1151 294
45 3300048924 Ga0496121_0004379 Ga0496121_0004379_7658_8548 294
46 3300048924 Ga0496121_0030981 Ga0496121_0030981_2410_3327 294
47 3300048925 Ga0496122_0000676 Ga0496122_0000676_2443_3333 294
48 3300048926 Ga0496123_0008328 Ga0496123_0008328_1823_2713 294
49 3300048928 Ga0496125_0109544 Ga0496125_0109544_179_1069 294
50 3300049570 Ga0501033_0223522 Ga0501033_0223522_98_1045 294
51 3300049572 Ga0501036_0520420 Ga0501036_0520420_18_965 294
52 3300049574 Ga0501038_0320827 Ga0501038_0320827_242_1189 294
53 3300049575 Ga0501039_0135826 Ga0501039_0135826_375_1322 294
54 3300049581 Ga0501047_0009582 Ga0501047_0009582_7649_8596 294
55 3300049822 Ga0501035_0023999 Ga0501035_0023999_419_1366 294
56 3300049823 Ga0501044_0013376 Ga0501044_0013376_7755_8702 294
57 iso_pu_bacteria 2834641062 2834643728 294
58 iso_pu_bacteria 8003400568 8003405110 294
59 3300042115 Ga0450911_009592 Ga0450911_009592_379_1278 295
60 iso_pu_bacteria 2511231003 2511248642 295
61 iso_pu_bacteria 2511231026 2511386981 295
62 iso_pu_bacteria 2513237150 2513957138 295
63 iso_pu_bacteria 2513237165 2514043300 295
64 iso_pu_bacteria 2596583598 2597028175 295
65 iso_pu_bacteria 2599185178 2599444906 295
66 iso_pu_bacteria 2643221603 2644031592 295
67 iso_pu_bacteria 2643221628 2644161173 295
68 iso_pu_bacteria 2808606386 2808984599 295
69 iso_pu_bacteria 2808606415 2809130856 295
70 iso_pu_bacteria 2808606419 2809150809 295
71 iso_pu_bacteria 2818991445 2819593093 295
72 iso_pu_bacteria 2842677519 2842681411 295
73 iso_pu_bacteria 2852618963 2852622328 295
74 iso_pu_bacteria 2857576091 2857579825 295
75 iso_pu_bacteria 2885266251 2885269775 295
76 iso_pu_bacteria 2900577576 2900581491 295
77 iso_pu_bacteria 2904439833 2904441049 295
78 iso_pu_bacteria 2904449895 2904454202 295
79 iso_pu_bacteria 2904456579 2904461941 295
80 iso_pu_bacteria 2919462493 2919465204 295
81 iso_pu_bacteria 2928058823 2928060048 295
82 iso_pu_bacteria 2929520902 2929521937 295
83 iso_pu_bacteria 2945945610 2945949992 295
84 iso_pu_bacteria 644736347 644750121 295
85 3300003578 Ga0006562J51391_1128109 Ga0006562J51391_11281091 296
86 3300003578 Ga0006562J51391_1128110 Ga0006562J51391_11281103 296
87 3300003773 Ga0055537_1000162 Ga0055537_100016220 296
88 3300003784 Ga0055534_1000128 Ga0055534_100012826 296
89 3300003790 Ga0055528_1006119 Ga0055528_10061193 296
90 3300005288 Ga0065714_10074345 Ga0065714_100743453 296
91 3300006038 Ga0075365_10001542 Ga0075365_100015425 296
92 3300006048 Ga0075363_100004545 Ga0075363_1000045454 296
93 3300006051 Ga0075364_10003241 Ga0075364_100032415 296
94 3300006051 Ga0075364_10082317 Ga0075364_100823172 296
95 3300006058 Ga0075432_10002170 Ga0075432_100021704 296
96 3300006177 Ga0075362_10002812 Ga0075362_100028122 296
97 3300006195 Ga0075366_10002392 Ga0075366_100023922 296
98 3300006353 Ga0075370_10000759 Ga0075370_100007599 296
99 3300006946 Ga0079104_1007154 Ga0079104_10071541 296
100 3300006946 Ga0079104_1016174 Ga0079104_10161741 296
101 3300006946 Ga0079104_1020222 Ga0079104_10202222 296
102 3300006948 Ga0099826_10000122 Ga0099826_100001223 296
103 3300009148 Ga0105243_10017120 Ga0105243_100171204 296
104 3300012502 Ga0157347_1000228 Ga0157347_10002282 296
105 3300013100 Ga0157373_10003146 Ga0157373_100031463 296
106 3300013104 Ga0157370_10001308 Ga0157370_1000130836 296
107 3300017792 Ga0163161_10000079 Ga0163161_1000007947 296
108 3300017792 Ga0163161_10001508 Ga0163161_100015089 296
109 3300025258 Ga0209129_1001384 Ga0209129_10013848 296
110 3300025263 Ga0209565_1000229 Ga0209565_100022927 296
111 3300025263 Ga0209565_1021622 Ga0209565_10216221 296
112 3300025273 Ga0209673_1000463 Ga0209673_100046335 296
113 3300025273 Ga0209673_1009344 Ga0209673_10093445 296
114 3300025273 Ga0209673_1041756 Ga0209673_10417561 296
115 3300025291 Ga0209675_1000186 Ga0209675_100018635 296
116 3300025292 Ga0209676_1011313 Ga0209676_10113133 296
117 3300025294 Ga0209025_1000230 Ga0209025_100023056 296
118 3300025295 Ga0209564_1012912 Ga0209564_10129122 296
119 3300025303 Ga0209051_1000673 Ga0209051_100067325 296
120 3300025935 Ga0207709_10004910 Ga0207709_100049103 296
121 3300027666 Ga0209282_1005596 Ga0209282_10055964 296
122 3300027907 Ga0207428_10087053 Ga0207428_100870532 296
123 3300030732 Ga0316176_1085576 Ga0316176_10855764 296
124 3300030733 Ga0314311_1207443 Ga0314311_12074431 296
125 3300030734 Ga0316179_1087651 Ga0316179_10876513 296
126 3300030735 Ga0316178_1008722 Ga0316178_10087223 296
127 3300030736 Ga0316180_1108197 Ga0316180_11081972 296
128 3300030742 Ga0316183_1023144 Ga0316183_10231444 296
129 3300030744 Ga0316181_1207329 Ga0316181_12073292 296
130 3300030745 Ga0316182_1238298 Ga0316182_12382982 296
131 3300031548 Ga0307408_100011351 Ga0307408_1000113513 296
132 3300031548 Ga0307408_100319387 Ga0307408_1003193872 296
133 3300031731 Ga0307405_10039858 Ga0307405_100398583 296
134 3300031852 Ga0307410_10294198 Ga0307410_102941981 296
135 3300031901 Ga0307406_10000129 Ga0307406_100001292 296
136 3300031901 Ga0307406_10146839 Ga0307406_101468392 296
137 3300031903 Ga0307407_10270863 Ga0307407_102708631 296
138 3300031911 Ga0307412_10009245 Ga0307412_100092452 296
139 3300031911 Ga0307412_10030907 Ga0307412_100309073 296
140 3300031911 Ga0307412_10044875 Ga0307412_100448753 296
141 3300031911 Ga0307412_10271310 Ga0307412_102713101 296
142 3300031911 Ga0307412_10359337 Ga0307412_103593371 296
143 3300032004 Ga0307414_10022669 Ga0307414_100226695 296
144 3300032004 Ga0307414_10036835 Ga0307414_100368351 296
145 3300032005 Ga0307411_10011599 Ga0307411_100115993 296
146 3300032005 Ga0307411_10198056 Ga0307411_101980562 296
147 3300032005 Ga0307411_10198191 Ga0307411_101981912 296
148 3300041404 Ga0439436_0006267 Ga0439436_0006267_1543_2451 296
149 3300041411 Ga0439466_0001839 Ga0439466_0001839_6539_7447 296
150 3300041413 Ga0439465_0008377 Ga0439465_0008377_2260_3168 296
151 3300041997 Ga0439431_0002506 Ga0439431_0002506_2447_3355 296
152 3300042002 Ga0439442_000356 Ga0439442_000356_3344_4252 296
153 3300042115 Ga0450911_004615 Ga0450911_004615_755_1663 296
154 3300042123 Ga0450921_000059 Ga0450921_000059_394_1302 296
155 3300042124 Ga0450922_003756 Ga0450922_003756_41_949 296
156 3300042125 Ga0450923_000356 Ga0450923_000356_3833_4741 296
157 3300042145 Ga0450906_000114 Ga0450906_000114_6467_7375 296
158 3300042147 Ga0450910_001770 Ga0450910_001770_1707_2615 296
159 3300042184 Ga0450908_000411 Ga0450908_000411_5093_6001 296
160 3300042185 Ga0450909_003251 Ga0450909_003251_67_975 296
161 3300042435 Ga0439434_0002977 Ga0439434_0002977_3198_4106 296
162 3300042531 Ga0450918_001238 Ga0450918_001238_178_1086 296
163 3300046453 Ga0495627_002599 Ga0495627_002599_3928_4872 296
164 3300046515 Ga0495620_0013152 Ga0495620_0013152_886_1830 296
165 3300046520 Ga0495637_0002203 Ga0495637_0002203_8711_9622 296
166 3300046523 Ga0495644_0062315 Ga0495644_0062315_429_1328 296
167 3300046660 Ga0495625_0000437 Ga0495625_0000437_19556_20464 296
168 3300046665 Ga0495661_0010954 Ga0495661_0010954_680_1615 296
169 3300046665 Ga0495661_0205662 Ga0495661_0205662_17_961 296
170 3300046674 Ga0495588_0077793 Ga0495588_0077793_744_1688 296
171 3300046691 Ga0495670_0010557 Ga0495670_0010557_1567_2466 296
172 3300046691 Ga0495670_0156453 Ga0495670_0156453_17_928 296
173 3300046692 Ga0495671_0016868 Ga0495671_0016868_1456_2400 296
174 3300046810 Ga0495660_0088014 Ga0495660_0088014_128_1039 296
175 3300047317 Ga0495604_0012483 Ga0495604_0012483_4971_5867 296
176 3300047320 Ga0495672_0108818 Ga0495672_0108818_533_1432 296
177 3300049759 Ga0501262_000044 Ga0501262_000044_1443_2351 296
178 3300050490 nmdc:mga03n38_17203_c1 nmdc:mga03n38_17203_c1_1347_2255 296
179 3300050490 nmdc:mga03n38_5412_c1 nmdc:mga03n38_5412_c1_1133_2041 296
180 3300050492 nmdc:mga0yw44_473_c1 nmdc:mga0yw44_473_c1_12488_13396 296
181 3300050493 nmdc:mga0k408_2986_c1 nmdc:mga0k408_2986_c1_7169_8077 296
182 3300050493 nmdc:mga0k408_54798_c1 nmdc:mga0k408_54798_c1_929_1930 296
183 3300053079 Ga0500610_0000115 Ga0500610_0000115_14042_14986 296
184 3300053079 Ga0500610_0000411 Ga0500610_0000411_9284_10195 296
185 3300053117 Ga0500593_000089 Ga0500593_000089_26929_27873 296
186 3300053121 Ga0500607_000146 Ga0500607_000146_11371_12366 296
187 3300053158 Ga0500627_0002112 Ga0500627_0002112_3635_4630 296
188 iso_pu_bacteria 2511231002 2511242475 296
189 iso_pu_bacteria 2643221683 2644465181 296
190 iso_pu_bacteria 2885192300 2885197401 296
191 iso_pu_bacteria 2945909444 2945911182 296
192 iso_pu_bacteria 2945972063 2945973999 296
193 iso_pu_bacteria 2945984333 2945986524 296
194 iso_pu_bacteria 2954767861 2954770419 296
195 3300001979 JGI24740J21852_10001192 JGI24740J21852_100011928 297
196 3300002704 JGI25155J39150_1000357 JGI25155J39150_10003578 297
197 3300002705 JGI25156J39149_1000398 JGI25156J39149_100039822 297
198 3300002738 JGI25154J39366_1000241 JGI25154J39366_10002417 297
199 3300002738 JGI25154J39366_1000349 JGI25154J39366_100034922 297
200 3300002738 JGI25154J39366_1000405 JGI25154J39366_10004055 297
201 3300002738 JGI25154J39366_1001245 JGI25154J39366_10012457 297
202 3300002741 JGI25157J39369_1000105 JGI25157J39369_100010538 297
203 3300002987 JGI25159J45721_1017845 JGI25159J45721_10178452 297
204 3300003756 Ga0055533_1002112 Ga0055533_10021125 297
205 3300003758 Ga0055532_1000051 Ga0055532_100005145 297
206 3300003771 Ga0055526_1002868 Ga0055526_10028686 297
207 3300003773 Ga0055537_1000006 Ga0055537_10000064 297
208 3300003773 Ga0055537_1000445 Ga0055537_100044518 297
209 3300003773 Ga0055537_1004001 Ga0055537_10040014 297
210 3300003775 Ga0055524_1000032 Ga0055524_1000032140 297
211 3300003784 Ga0055534_1003814 Ga0055534_10038144 297
212 3300003790 Ga0055528_1000504 Ga0055528_100050431 297
213 3300003791 Ga0055530_10003406 Ga0055530_100034063 297
214 3300003792 Ga0055540_1000046 Ga0055540_1000046105 297
215 3300003792 Ga0055540_1004807 Ga0055540_10048074 297
216 3300003794 Ga0055531_10002570 Ga0055531_100025704 297
217 3300003794 Ga0055531_10014498 Ga0055531_100144982 297
218 3300003841 Ga0055541_1000303 Ga0055541_10003036 297
219 3300005262 Ga0065165_1007662 Ga0065165_10076624 297
220 3300005539 Ga0068853_100341405 Ga0068853_1003414052 297
221 3300005563 Ga0068855_100504858 Ga0068855_1005048581 297
222 3300006051 Ga0075364_10029645 Ga0075364_100296453 297
223 3300009093 Ga0105240_10113980 Ga0105240_101139803 297
224 3300014497 Ga0182008_10113687 Ga0182008_101136871 297
225 3300025206 Ga0209435_100028 Ga0209435_10002893 297
226 3300025206 Ga0209435_100037 Ga0209435_10003774 297
227 3300025224 Ga0209784_100525 Ga0209784_10052510 297
228 3300025225 Ga0209566_100129 Ga0209566_10012928 297
229 3300025226 Ga0209674_100305 Ga0209674_10030510 297
230 3300025229 Ga0209147_100004 Ga0209147_100004300 297
231 3300025230 Ga0209563_102266 Ga0209563_1022663 297
232 3300025233 Ga0209437_100053 Ga0209437_100053353 297
233 3300025242 Ga0209258_100398 Ga0209258_10039819 297
234 3300025246 Ga0209646_1000021 Ga0209646_1000021227 297
235 3300025246 Ga0209646_1000063 Ga0209646_100006356 297
236 3300025246 Ga0209646_1000095 Ga0209646_100009593 297
237 3300025250 Ga0209026_1000110 Ga0209026_100011093 297
238 3300025250 Ga0209026_1007165 Ga0209026_10071653 297
239 3300025254 Ga0209148_1000019 Ga0209148_1000019596 297
240 3300025256 Ga0209759_1000080 Ga0209759_100008039 297
241 3300025256 Ga0209759_1000115 Ga0209759_100011593 297
242 3300025256 Ga0209759_1000155 Ga0209759_100015510 297
243 3300025256 Ga0209759_1007204 Ga0209759_10072042 297
244 3300025263 Ga0209565_1000016 Ga0209565_1000016140 297
245 3300025263 Ga0209565_1000336 Ga0209565_100033643 297
246 3300025263 Ga0209565_1014648 Ga0209565_10146482 297
247 3300025272 Ga0209455_1007520 Ga0209455_10075202 297
248 3300025273 Ga0209673_1000073 Ga0209673_1000073138 297
249 3300025284 Ga0209130_1000210 Ga0209130_100021063 297
250 3300025291 Ga0209675_1000080 Ga0209675_100008051 297
251 3300025291 Ga0209675_1002302 Ga0209675_10023027 297
252 3300025292 Ga0209676_1000165 Ga0209676_100016564 297
253 3300025295 Ga0209564_1000165 Ga0209564_100016529 297
254 3300025297 Ga0209758_1042251 Ga0209758_10422512 297
255 3300025298 Ga0209050_1000084 Ga0209050_1000084190 297
256 3300025299 Ga0209256_1000110 Ga0209256_1000110138 297
257 3300025299 Ga0209256_1032242 Ga0209256_10322421 297
258 3300025302 Ga0207426_1002104 Ga0207426_10021048 297
259 3300025303 Ga0209051_1000058 Ga0209051_1000058190 297
260 3300025303 Ga0209051_1001488 Ga0209051_10014882 297
261 3300025304 Ga0209257_1000022 Ga0209257_100002281 297
262 3300025304 Ga0209257_1000092 Ga0209257_1000092190 297
263 3300025913 Ga0207695_10015134 Ga0207695_100151347 297
264 3300026041 Ga0207639_10180756 Ga0207639_101807562 297
265 3300031548 Ga0307408_100019360 Ga0307408_1000193605 297
266 3300031731 Ga0307405_10053765 Ga0307405_100537652 297
267 3300031901 Ga0307406_10007196 Ga0307406_100071967 297
268 3300032005 Ga0307411_10157031 Ga0307411_101570312 297
269 3300041404 Ga0439436_0015800 Ga0439436_0015800_79_990 297
270 3300041405 Ga0439438_040191 Ga0439438_040191_39_950 297
271 3300041407 Ga0439447_012885 Ga0439447_012885_1004_1915 297
272 3300041411 Ga0439466_0003263 Ga0439466_0003263_2223_3134 297
273 3300041411 Ga0439466_0022118 Ga0439466_0022118_308_1219 297
274 3300041413 Ga0439465_0002729 Ga0439465_0002729_3884_4795 297
275 3300041997 Ga0439431_0000602 Ga0439431_0000602_2053_2964 297
276 3300042002 Ga0439442_007780 Ga0439442_007780_919_1830 297
277 3300042006 Ga0439432_002354 Ga0439432_002354_4151_5062 297
278 3300042007 Ga0439449_0040381 Ga0439449_0040381_200_1111 297
279 3300042010 Ga0439452_001694 Ga0439452_001694_4368_5279 297
280 3300042015 Ga0439462_0005665 Ga0439462_0005665_2081_2992 297
281 3300042015 Ga0439462_0008376 Ga0439462_0008376_423_1334 297
282 3300042134 Ga0450898_006207 Ga0450898_006207_427_1338 297
283 3300042156 Ga0439446_0001003 Ga0439446_0001003_4276_5187 297
284 3300042156 Ga0439446_0003242 Ga0439446_0003242_941_1852 297
285 3300042435 Ga0439434_0006263 Ga0439434_0006263_1853_2764 297
286 3300048924 Ga0496121_0053672 Ga0496121_0053672_1012_1917 297
287 3300050489 nmdc:mga03683_1355_c1 nmdc:mga03683_1355_c1_2806_3717 297
288 3300050491 nmdc:mga00v17_131904_c1 nmdc:mga00v17_131904_c1_546_1448 297
289 3300050493 nmdc:mga0k408_79253_c1 nmdc:mga0k408_79253_c1_815_1726 297
290 3300053125 Ga0500618_019575 Ga0500618_019575_603_1538 297
291 iso_pu_bacteria 2818991436 2819543300 297
292 iso_pu_bacteria 2842733646 2842734948 297
293 iso_pu_bacteria 2842747753 2842748027 297
294 iso_pu_bacteria 2844533157 2844538386 297
295 3300001979 JGI24740J21852_10043788 JGI24740J21852_100437882 298
296 3300002739 JGI25158J39367_1001439 JGI25158J39367_10014392 298
297 3300002773 JGI25152J39213_1014378 JGI25152J39213_10143782 298
298 3300002774 JGI25150J39212_1000679 JGI25150J39212_100067915 298
299 3300002774 JGI25150J39212_1003302 JGI25150J39212_10033021 298
300 3300002987 JGI25159J45721_1005058 JGI25159J45721_10050582 298
301 3300002987 JGI25159J45721_1006953 JGI25159J45721_10069532 298
302 3300003187 JGI25151J46595_10000412 JGI25151J46595_1000041230 298
303 3300003187 JGI25151J46595_10001901 JGI25151J46595_100019019 298
304 3300003215 JGI25153J46596_10010430 JGI25153J46596_100104302 298
305 3300003215 JGI25153J46596_10021547 JGI25153J46596_100215472 298
306 3300003322 rootL2_10070966 rootL2_100709662 298
307 3300003322 rootL2_10112703 rootL2_101127032 298
308 3300003354 JGI25160J50197_1007660 JGI25160J50197_10076602 298
309 3300003354 JGI25160J50197_1014814 JGI25160J50197_10148142 298
310 3300003578 Ga0006562J51391_1047816 Ga0006562J51391_10478162 298
311 3300003578 Ga0006562J51391_1047817 Ga0006562J51391_10478172 298
312 3300003761 Ga0055535_1000274 Ga0055535_100027414 298
313 3300003762 Ga0055542_1000027 Ga0055542_1000027226 298
314 3300003771 Ga0055526_1007438 Ga0055526_10074385 298
315 3300003771 Ga0055526_1009818 Ga0055526_10098183 298
316 3300003771 Ga0055526_1010720 Ga0055526_10107202 298
317 3300003771 Ga0055526_1010795 Ga0055526_10107952 298
318 3300003773 Ga0055537_1002317 Ga0055537_10023177 298
319 3300003773 Ga0055537_1003980 Ga0055537_10039803 298
320 3300003773 Ga0055537_1004177 Ga0055537_10041772 298
321 3300003775 Ga0055524_1000690 Ga0055524_100069012 298
322 3300003775 Ga0055524_1008604 Ga0055524_10086042 298
323 3300003775 Ga0055524_1008676 Ga0055524_10086762 298
324 3300003775 Ga0055524_1038591 Ga0055524_10385911 298
325 3300003781 Ga0055536_1000163 Ga0055536_10001635 298
326 3300003781 Ga0055536_1003187 Ga0055536_10031874 298
327 3300003781 Ga0055536_1016958 Ga0055536_10169582 298
328 3300003784 Ga0055534_1001699 Ga0055534_10016999 298
329 3300003784 Ga0055534_1004269 Ga0055534_10042692 298
330 3300003784 Ga0055534_1005845 Ga0055534_10058452 298
331 3300003790 Ga0055528_1009033 Ga0055528_10090332 298
332 3300003790 Ga0055528_1012244 Ga0055528_10122443 298
333 3300003791 Ga0055530_10000328 Ga0055530_1000032811 298
334 3300003791 Ga0055530_10000866 Ga0055530_1000086619 298
335 3300003791 Ga0055530_10014544 Ga0055530_100145442 298
336 3300003792 Ga0055540_1000813 Ga0055540_100081310 298
337 3300003792 Ga0055540_1007252 Ga0055540_10072522 298
338 3300003794 Ga0055531_10000428 Ga0055531_1000042827 298
339 3300003794 Ga0055531_10011137 Ga0055531_100111372 298
340 3300003794 Ga0055531_10034955 Ga0055531_100349551 298
341 3300004625 Ga0055543_1003838 Ga0055543_10038384 298
342 3300004625 Ga0055543_1003866 Ga0055543_10038664 298
343 3300005262 Ga0065165_1009778 Ga0065165_10097784 298
344 3300005353 Ga0070669_100087562 Ga0070669_1000875622 298
345 3300005364 Ga0070673_100445481 Ga0070673_1004454811 298
346 3300005539 Ga0068853_100005678 Ga0068853_1000056785 298
347 3300005563 Ga0068855_100510097 Ga0068855_1005100971 298
348 3300006177 Ga0075362_10095521 Ga0075362_100955212 298
349 3300006195 Ga0075366_10016252 Ga0075366_100162522 298
350 3300006353 Ga0075370_10047873 Ga0075370_100478732 298
351 3300009093 Ga0105240_10264636 Ga0105240_102646362 298
352 3300009093 Ga0105240_10281036 Ga0105240_102810362 298
353 3300010375 Ga0105239_10402938 Ga0105239_104029382 298
354 3300013104 Ga0157370_10224212 Ga0157370_102242122 298
355 3300013105 Ga0157369_10007328 Ga0157369_100073285 298
356 3300014497 Ga0182008_10001266 Ga0182008_100012667 298
357 3300015683 Ga0183362_10001 Ga0183362_10001755 298
358 3300017792 Ga0163161_10020413 Ga0163161_100204134 298
359 3300017792 Ga0163161_10087750 Ga0163161_100877502 298
360 3300025208 Ga0209436_102723 Ga0209436_1027235 298
361 3300025228 Ga0209672_104679 Ga0209672_1046792 298
362 3300025229 Ga0209147_100940 Ga0209147_10094015 298
363 3300025242 Ga0209258_100048 Ga0209258_100048149 298
364 3300025245 Ga0207425_1000107 Ga0207425_100010726 298
365 3300025254 Ga0209148_1000040 Ga0209148_1000040149 298
366 3300025258 Ga0209129_1000007 Ga0209129_100000793 298
367 3300025258 Ga0209129_1007676 Ga0209129_10076762 298
368 3300025263 Ga0209565_1000178 Ga0209565_100017839 298
369 3300025263 Ga0209565_1000196 Ga0209565_100019618 298
370 3300025263 Ga0209565_1001871 Ga0209565_10018713 298
371 3300025273 Ga0209673_1000764 Ga0209673_100076422 298
372 3300025273 Ga0209673_1000884 Ga0209673_10008844 298
373 3300025284 Ga0209130_1000580 Ga0209130_100058016 298
374 3300025284 Ga0209130_1001148 Ga0209130_100114819 298
375 3300025291 Ga0209675_1000092 Ga0209675_100009279 298
376 3300025291 Ga0209675_1000361 Ga0209675_10003614 298
377 3300025291 Ga0209675_1001704 Ga0209675_10017045 298
378 3300025291 Ga0209675_1003136 Ga0209675_10031364 298
379 3300025291 Ga0209675_1017016 Ga0209675_10170162 298
380 3300025292 Ga0209676_1000004 Ga0209676_1000004838 298
381 3300025292 Ga0209676_1000172 Ga0209676_100017294 298
382 3300025292 Ga0209676_1000480 Ga0209676_100048054 298
383 3300025292 Ga0209676_1008977 Ga0209676_10089772 298
384 3300025294 Ga0209025_1000222 Ga0209025_100022252 298
385 3300025294 Ga0209025_1000278 Ga0209025_100027872 298
386 3300025294 Ga0209025_1000628 Ga0209025_10006285 298
387 3300025294 Ga0209025_1005386 Ga0209025_10053864 298
388 3300025294 Ga0209025_1011879 Ga0209025_10118796 298
389 3300025295 Ga0209564_1000200 Ga0209564_100020093 298
390 3300025295 Ga0209564_1000318 Ga0209564_100031839 298
391 3300025295 Ga0209564_1000489 Ga0209564_10004895 298
392 3300025295 Ga0209564_1000582 Ga0209564_100058221 298
393 3300025295 Ga0209564_1002074 Ga0209564_10020747 298
394 3300025297 Ga0209758_1000025 Ga0209758_1000025433 298
395 3300025297 Ga0209758_1012494 Ga0209758_10124942 298
396 3300025298 Ga0209050_1000002 Ga0209050_10000021348 298
397 3300025298 Ga0209050_1000565 Ga0209050_100056526 298
398 3300025299 Ga0209256_1000067 Ga0209256_1000067106 298
399 3300025299 Ga0209256_1000198 Ga0209256_1000198115 298
400 3300025299 Ga0209256_1000335 Ga0209256_100033566 298
401 3300025299 Ga0209256_1000362 Ga0209256_100036229 298
402 3300025302 Ga0207426_1000001 Ga0207426_1000001145 298
403 3300025302 Ga0207426_1000178 Ga0207426_100017821 298
404 3300025302 Ga0207426_1000264 Ga0207426_100026418 298
405 3300025303 Ga0209051_1000002 Ga0209051_10000021118 298
406 3300025303 Ga0209051_1000096 Ga0209051_100009667 298
407 3300025303 Ga0209051_1000278 Ga0209051_100027828 298
408 3300025303 Ga0209051_1010611 Ga0209051_10106114 298
409 3300025303 Ga0209051_1022601 Ga0209051_10226012 298
410 3300025304 Ga0209257_1000002 Ga0209257_10000021259 298
411 3300025304 Ga0209257_1000072 Ga0209257_1000072258 298
412 3300025304 Ga0209257_1011137 Ga0209257_10111372 298
413 3300025914 Ga0207671_10159153 Ga0207671_101591532 298
414 3300025923 Ga0207681_10110578 Ga0207681_101105782 298
415 3300025940 Ga0207691_10304944 Ga0207691_103049442 298
416 3300025949 Ga0207667_10527763 Ga0207667_105277631 298
417 3300026118 Ga0207675_100214544 Ga0207675_1002145442 298
418 3300028379 Ga0268266_10167691 Ga0268266_101676912 298
419 3300042006 Ga0439432_036936 Ga0439432_036936_81_995 298
420 3300042007 Ga0439449_0001161 Ga0439449_0001161_1992_2906 298
421 3300046453 Ga0495627_009896 Ga0495627_009896_1878_2795 298
422 3300046460 Ga0495638_0038579 Ga0495638_0038579_1865_2881 298
423 3300046513 Ga0495616_0004666 Ga0495616_0004666_7476_8492 298
424 3300046515 Ga0495620_0070522 Ga0495620_0070522_45_965 298
425 3300046518 Ga0495631_0000021 Ga0495631_0000021_31139_32155 298
426 3300046530 Ga0495654_0021664 Ga0495654_0021664_1669_2685 298
427 3300046615 Ga0495656_0000141 Ga0495656_0000141_9166_10080 298
428 3300046660 Ga0495625_0043430 Ga0495625_0043430_2168_3184 298
429 3300046683 Ga0495658_0002746 Ga0495658_0002746_3764_4780 298
430 3300047321 Ga0495676_0010916 Ga0495676_0010916_5089_6105 298
431 3300047673 Ga0495593_0002373 Ga0495593_0002373_4606_5622 298
432 3300048089 Ga0495614_0004046 Ga0495614_0004046_5563_6579 298
433 3300048904 Ga0496101_0005734 Ga0496101_0005734_3939_4856 298
434 3300048907 Ga0496104_0271876 Ga0496104_0271876_334_1257 298
435 3300048920 Ga0496117_0007805 Ga0496117_0007805_6453_7493 298
436 3300048921 Ga0496118_0002845 Ga0496118_0002845_15875_16792 298
437 3300048924 Ga0496121_0234345 Ga0496121_0234345_10_1026 298
438 3300048925 Ga0496122_0000238 Ga0496122_0000238_904_1818 298
439 3300048925 Ga0496122_0041484 Ga0496122_0041484_97_1113 298
440 3300048925 Ga0496122_0059464 Ga0496122_0059464_37_954 298
441 3300048926 Ga0496123_0000262 Ga0496123_0000262_14818_15732 298
442 3300048926 Ga0496123_0023727 Ga0496123_0023727_91_1008 298
443 3300048927 Ga0496124_0141563 Ga0496124_0141563_263_1180 298
444 3300048928 Ga0496125_0012129 Ga0496125_0012129_4754_5671 298
445 3300050496 nmdc:mga07m45_41256_c1 nmdc:mga07m45_41256_c1_868_1782 298
446 3300053093 Ga0500651_0000360 Ga0500651_0000360_13665_14681 298
447 3300053094 Ga0500566_0003903 Ga0500566_0003903_5822_6838 298
448 3300053110 Ga0500571_000052 Ga0500571_000052_11236_12252 298
449 3300053118 Ga0500594_0008611 Ga0500594_0008611_585_1601 298
450 3300053118 Ga0500594_0014392 Ga0500594_0014392_203_1117 298
451 3300053120 Ga0500597_016713 Ga0500597_016713_925_1941 298
452 3300053122 Ga0500608_002675 Ga0500608_002675_4403_5320 298
453 3300053128 Ga0500626_004619 Ga0500626_004619_560_1576 298
454 3300053133 Ga0500655_008403 Ga0500655_008403_236_1252 298
455 3300053134 Ga0500658_0000052 Ga0500658_0000052_47194_48210 298
456 3300053134 Ga0500658_0000503 Ga0500658_0000503_8743_9759 298
457 3300053138 Ga0500564_019948 Ga0500564_019948_454_1470 298
458 3300053139 Ga0500568_0001382 Ga0500568_0001382_3416_4432 298
459 3300053140 Ga0500573_0047021 Ga0500573_0047021_352_1266 298
460 3300053141 Ga0500574_000444 Ga0500574_000444_3790_4806 298
461 3300053153 Ga0500616_0013412 Ga0500616_0013412_385_1302 298
462 3300053161 Ga0500634_0019577 Ga0500634_0019577_956_1972 298
463 3300053177 Ga0500636_0052460 Ga0500636_0052460_1113_2129 298
464 iso_pu_bacteria 2513020051 2513231952 298
465 iso_pu_bacteria 2599185214 2599624898 298
466 iso_pu_bacteria 2599185226 2599672910 298
467 iso_pu_bacteria 2599185227 2599682640 298
468 iso_pu_bacteria 2599185229 2599694519 298
469 iso_pu_bacteria 2643221658 2644329210 298
470 iso_pu_bacteria 2643221672 2644401692 298
471 iso_pu_bacteria 2738541277 2738717363 298
472 iso_pu_bacteria 2738541307 2738878956 298
473 iso_pu_bacteria 2738543013 2739250101 298
474 iso_pu_bacteria 2738543019 2739278049 298
475 iso_pu_bacteria 2818991446 2819596827 298
476 iso_pu_bacteria 2831265667 2831265949 298
477 iso_pu_bacteria 2838054893 2838060858 298
478 iso_pu_bacteria 2885198086 2885203596 298
479 iso_pu_bacteria 2885211737 2885217054 298
480 iso_pu_bacteria 2899924645 2899930387 298
481 iso_pu_bacteria 2928037797 2928039500 298
482 iso_pu_bacteria 2928044640 2928044895 298
483 iso_pu_bacteria 2928051484 2928052696 298
484 iso_pu_bacteria 2928064002 2928064643 298
485 iso_pu_bacteria 2928070936 2928074940 298
486 iso_pu_bacteria 2928084124 2928089077 298
487 3300001915 JGI24741J21665_1000174 JGI24741J21665_10001747 299
488 3300001979 JGI24740J21852_10000852 JGI24740J21852_1000085210 299
489 3300001979 JGI24740J21852_10004237 JGI24740J21852_100042376 299
490 3300002737 JGI25162J39368_1000026 JGI25162J39368_100002666 299
491 3300002737 JGI25162J39368_1000027 JGI25162J39368_1000027106 299
492 3300003214 JGI25165J46597_1000031 JGI25165J46597_1000031180 299
493 3300003578 Ga0006562J51391_1126290 Ga0006562J51391_11262901 299
494 3300003578 Ga0006562J51391_1126291 Ga0006562J51391_11262912 299
495 3300003751 Ga0055538_1000018 Ga0055538_1000018180 299
496 3300003751 Ga0055538_1003595 Ga0055538_10035952 299
497 3300003752 Ga0055539_1000023 Ga0055539_1000023180 299
498 3300003752 Ga0055539_1000053 Ga0055539_1000053109 299
499 3300003756 Ga0055533_1000031 Ga0055533_1000031114 299
500 3300003758 Ga0055532_1000033 Ga0055532_1000033150 299
501 3300003759 Ga0055525_1000039 Ga0055525_1000039180 299
502 3300003759 Ga0055525_1000440 Ga0055525_100044014 299
503 3300003759 Ga0055525_1000621 Ga0055525_100062111 299
504 3300003761 Ga0055535_1000024 Ga0055535_1000024150 299
505 3300003763 Ga0055529_1000044 Ga0055529_1000044150 299
506 3300003841 Ga0055541_1000016 Ga0055541_1000016180 299
507 3300005327 Ga0070658_10134468 Ga0070658_101344682 299
508 3300005339 Ga0070660_100007159 Ga0070660_1000071594 299
509 3300005344 Ga0070661_100000021 Ga0070661_10000002135 299
510 3300005366 Ga0070659_100000839 Ga0070659_10000083910 299
511 3300005455 Ga0070663_100000004 Ga0070663_10000000444 299
512 3300005530 Ga0070679_100094032 Ga0070679_1000940322 299
513 3300005563 Ga0068855_100120233 Ga0068855_1001202332 299
514 3300005564 Ga0070664_100000007 Ga0070664_10000000744 299
515 3300005577 Ga0068857_100016420 Ga0068857_1000164205 299
516 3300005578 Ga0068854_100000045 Ga0068854_1000000457 299
517 3300005614 Ga0068856_100000004 Ga0068856_10000000429 299
518 3300005614 Ga0068856_100236266 Ga0068856_1002362662 299
519 3300009093 Ga0105240_10014225 Ga0105240_100142255 299
520 3300013100 Ga0157373_10037094 Ga0157373_100370944 299
521 3300013102 Ga0157371_10000001 Ga0157371_10000001433 299
522 3300013102 Ga0157371_10000028 Ga0157371_10000028183 299
523 3300013104 Ga0157370_10000002 Ga0157370_1000000240 299
524 3300013105 Ga0157369_10002517 Ga0157369_1000251718 299
525 3300013307 Ga0157372_10000619 Ga0157372_1000061925 299
526 3300014497 Ga0182008_10026396 Ga0182008_100263963 299
527 3300015261 Ga0182006_1008186 Ga0182006_10081865 299
528 3300015262 Ga0182007_10004904 Ga0182007_100049044 299
529 3300015265 Ga0182005_1000252 Ga0182005_100025235 299
530 3300017792 Ga0163161_10176756 Ga0163161_101767562 299
531 3300020077 Ga0206351_10260248 Ga0206351_102602482 299
532 3300025207 Ga0209760_101921 Ga0209760_1019212 299
533 3300025224 Ga0209784_100024 Ga0209784_10002435 299
534 3300025224 Ga0209784_100027 Ga0209784_100027180 299
535 3300025224 Ga0209784_101405 Ga0209784_1014052 299
536 3300025225 Ga0209566_100018 Ga0209566_10001835 299
537 3300025225 Ga0209566_100027 Ga0209566_100027180 299
538 3300025226 Ga0209674_100044 Ga0209674_100044180 299
539 3300025226 Ga0209674_100225 Ga0209674_1002259 299
540 3300025226 Ga0209674_100775 Ga0209674_1007759 299
541 3300025228 Ga0209672_100068 Ga0209672_10006883 299
542 3300025229 Ga0209147_100008 Ga0209147_100008336 299
543 3300025230 Ga0209563_100039 Ga0209563_100039328 299
544 3300025230 Ga0209563_100048 Ga0209563_100048180 299
545 3300025231 Ga0207427_100616 Ga0207427_10061610 299
546 3300025233 Ga0209437_100055 Ga0209437_100055180 299
547 3300025242 Ga0209258_100013 Ga0209258_100013336 299
548 3300025253 Ga0209677_100024 Ga0209677_100024326 299
549 3300025253 Ga0209677_100028 Ga0209677_100028180 299
550 3300025254 Ga0209148_1004104 Ga0209148_10041043 299
551 3300025256 Ga0209759_1001910 Ga0209759_10019107 299
552 3300025261 Ga0209233_1000070 Ga0209233_1000070180 299
553 3300025272 Ga0209455_1000042 Ga0209455_1000042336 299
554 3300025294 Ga0209025_1000125 Ga0209025_100012568 299
555 3300025303 Ga0209051_1015557 Ga0209051_10155574 299
556 3300025909 Ga0207705_10124608 Ga0207705_101246082 299
557 3300025913 Ga0207695_10001071 Ga0207695_1000107128 299
558 3300025913 Ga0207695_10181958 Ga0207695_101819582 299
559 3300025919 Ga0207657_10051639 Ga0207657_100516394 299
560 3300025920 Ga0207649_10000030 Ga0207649_10000030155 299
561 3300025921 Ga0207652_10105578 Ga0207652_101055782 299
562 3300025932 Ga0207690_10001459 Ga0207690_1000145912 299
563 3300025945 Ga0207679_10000004 Ga0207679_10000004228 299
564 3300025949 Ga0207667_10166753 Ga0207667_101667532 299
565 3300025981 Ga0207640_10000155 Ga0207640_100001555 299
566 3300026067 Ga0207678_10000005 Ga0207678_1000000544 299
567 3300026078 Ga0207702_10000342 Ga0207702_1000034221 299
568 3300026078 Ga0207702_10573670 Ga0207702_105736702 299
569 3300026142 Ga0207698_10154674 Ga0207698_101546742 299
570 3300031251 Ga0265327_10003596 Ga0265327_100035962 299
571 3300037418 Ga0395900_0089947 Ga0395900_0089947_465_1364 299
572 3300037471 Ga0395905_0001326 Ga0395905_0001326_2028_2951 299
573 3300037471 Ga0395905_0213441 Ga0395905_0213441_423_1322 299
574 3300044650 Ga0466986_0022780 Ga0466986_0022780_1806_2705 299
575 3300044658 Ga0466972_0005748 Ga0466972_0005748_4207_5106 299
576 3300044672 Ga0466982_0004071 Ga0466982_0004071_4313_5212 299
577 3300044683 Ga0466965_0007706 Ga0466965_0007706_4010_4909 299
578 3300044684 Ga0466966_0117721 Ga0466966_0117721_247_1146 299
579 3300044693 Ga0466961_0000194 Ga0466961_0000194_32338_33237 299
580 3300044719 Ga0466971_0012336 Ga0466971_0012336_1614_2513 299
581 3300044765 Ga0466970_0002743 Ga0466970_0002743_5829_6728 299
582 3300044842 Ga0466957_0018736 Ga0466957_0018736_2186_3085 299
583 3300044842 Ga0466957_0176994 Ga0466957_0176994_14_934 299
584 3300045049 Ga0466959_0000928 Ga0466959_0000928_15170_16069 299
585 3300045976 Ga0466967_0026078 Ga0466967_0026078_2406_3305 299
586 3300046454 Ga0495592_0025069 Ga0495592_0025069_1014_1937 299
587 3300046460 Ga0495638_0025738 Ga0495638_0025738_752_1720 299
588 3300046463 Ga0495653_0013213 Ga0495653_0013213_2477_3400 299
589 3300046471 Ga0495650_0000015 Ga0495650_0000015_526244_527284 299
590 3300046501 Ga0495607_0000048 Ga0495607_0000048_106935_107843 299
591 3300046506 Ga0495583_0002011 Ga0495583_0002011_11876_12865 299
592 3300046507 Ga0495606_0002379 Ga0495606_0002379_9054_9965 299
593 3300046511 Ga0495608_0015415 Ga0495608_0015415_633_1556 299
594 3300046512 Ga0495610_0051727 Ga0495610_0051727_187_1098 299
595 3300046513 Ga0495616_0001459 Ga0495616_0001459_13470_14411 299
596 3300046514 Ga0495618_0045013 Ga0495618_0045013_633_1556 299
597 3300046516 Ga0495628_0000827 Ga0495628_0000827_5694_6617 299
598 3300046519 Ga0495632_0001125 Ga0495632_0001125_16072_17007 299
599 3300046520 Ga0495637_0021191 Ga0495637_0021191_806_1738 299
600 3300046522 Ga0495643_0000328 Ga0495643_0000328_27159_28100 299
601 3300046528 Ga0495642_0050011 Ga0495642_0050011_214_1161 299
602 3300046528 Ga0495642_0065219 Ga0495642_0065219_21_962 299
603 3300046529 Ga0495652_0034890 Ga0495652_0034890_240_1163 299
604 3300046529 Ga0495652_0119845 Ga0495652_0119845_342_1265 299
605 3300046542 Ga0495597_0016789 Ga0495597_0016789_1229_2176 299
606 3300046543 Ga0495645_0054893 Ga0495645_0054893_1369_2292 299
607 3300046557 Ga0495622_0066605 Ga0495622_0066605_405_1328 299
608 3300046558 Ga0495633_0015227 Ga0495633_0015227_1235_2146 299
609 3300046616 Ga0495668_0015172 Ga0495668_0015172_3081_4028 299
610 3300046665 Ga0495661_0017305 Ga0495661_0017305_852_1799 299
611 3300046678 Ga0495599_0007322 Ga0495599_0007322_2402_3325 299
612 3300046680 Ga0495646_0001482 Ga0495646_0001482_8181_9104 299
613 3300046680 Ga0495646_0003380 Ga0495646_0003380_817_1740 299
614 3300046690 Ga0495624_0014709 Ga0495624_0014709_3837_4760 299
615 3300046809 Ga0495600_0018956 Ga0495600_0018956_1263_2186 299
616 3300047317 Ga0495604_0037846 Ga0495604_0037846_899_1822 299
617 3300047318 Ga0495636_0004786 Ga0495636_0004786_1318_2223 299
618 3300047443 Ga0495687_014410 Ga0495687_014410_1590_2555 299
619 3300047443 Ga0495687_043789 Ga0495687_043789_836_1783 299
620 3300047469 Ga0495673_0000113 Ga0495673_0000113_32293_33204 299
621 3300048088 Ga0495602_0046578 Ga0495602_0046578_618_1541 299
622 3300048091 Ga0495626_0001224 Ga0495626_0001224_17943_18866 299
623 3300048906 Ga0496103_0016925 Ga0496103_0016925_2511_3452 299
624 3300048914 Ga0496111_0091360 Ga0496111_0091360_1042_1983 299
625 3300048928 Ga0496125_0007020 Ga0496125_0007020_1574_2473 299
626 3300049571 Ga0501034_0000022 Ga0501034_0000022_103531_104436 299
627 3300049823 Ga0501044_0027489 Ga0501044_0027489_2910_3854 299
628 3300053088 Ga0500644_0073158 Ga0500644_0073158_52_1029 299
629 3300053119 Ga0500595_020459 Ga0500595_020459_543_1466 299
630 3300053125 Ga0500618_001381 Ga0500618_001381_9632_10549 299
631 3300053136 Ga0500559_0148289 Ga0500559_0148289_149_1060 299
632 3300053141 Ga0500574_010160 Ga0500574_010160_270_1193 299
633 3300053145 Ga0500586_000131 Ga0500586_000131_7748_8659 299
634 3300053154 Ga0500619_022509 Ga0500619_022509_412_1335 299
635 3300061719 Ga0466962_0009891 Ga0466962_0009891_678_1577 299
636 iso_pu_bacteria 2808606418 2809143063 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

65

124

0.98

PF03466

LysR_substrate

LysR substrate binding domain

148

356

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3clo-assembly1.cif.gz_B crystal structure of putative transcriptional regulator containing a luxr dna binding domain (np_811094.1) from bacteroides thetaiotaomicron vpi-5482 at 2.04 a resolution 0.9163 3 47
7x1k-assembly1.cif.gz_B crystal structure of the flagellar expression regulator degu from listeria monocytogenes 0.9156 2 47
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.9148 3 88
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9143 3 88
1fse-assembly2.cif.gz_C crystal structure of the bacillus subtilis regulatory protein gere 0.9119 3 47
ID Description Score Start End Superfamily
af_P52696_4_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9843 4 87 1.10.10.10
af_P77171_5_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9672 2 82 1.10.10.10
af_P37641_3_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9626 4 80 1.10.10.10
af_P37682_6_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9623 3 87 1.10.10.10
af_Q2FVT4_1_85_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.957 3 86 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A658JMP9-F1-model_v4 deleted 0.9495 3 80
AF-A0A1Q5IPR2-F1-model_v4 Transcriptional regulator 0.9469 3 88 GO:0000976
GO:0003700
AF-A0A3C1Y027-F1-model_v4 LysR family transcriptional regulator 0.9464 3 87 GO:0003700
GO:0005829
AF-E8UYI9-F1-model_v4 Regulatory protein LysR 0.9457 1 73 GO:0003700
AF-A0A7X6IIS4-F1-model_v4 deleted 0.9448 3 80

Feature Viewer

pLDDT pTM Quality
91.41 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map