F471306
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 636 | 366 | 570 | 305 |
Family's Representative Sequence
| Representative Sequence | 3300005288|Ga0065714_10074345|Ga0065714_100743453 |
| Length | 359 |
| Sequence | MPNCASSHKFFTENHVSSIPRANVGKGPLRPRHRNTIPRPDGPDFPELRTISFIFQPMPAPDLSSRQLRAFTALAEQRNFTRAAETCHLSQPAFSALIRTLEETLGARLFDRDTRSVQLTPEGRLFEPSARRLLDDMQGAIGDLADHTQRRKGRVSVAALPSLAAGWLPAILAEFMQAWPGITVELHDALSDACIAQLRSHQADFALAATGAGAAAASDLRGRKLCDDRFHLVCRKDHALATVPRLTAKQLAPWPFIQMARNSSVRQSLDVALHPLRLNAVFEVEHLATVMGLVEAGIGISVVPELTLFHFRRDTLVTRPLPLPGLTRTIYLVQRREGSLSVAAQTLHDLILARLGTLN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 3 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 4 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 5 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 6 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 7 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 8 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 9 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 10 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 11 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 12 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 13 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 14 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 15 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 16 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 17 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 18 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 19 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 20 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 21 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 22 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 23 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 24 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 25 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 26 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 27 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 28 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 29 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 30 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 31 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 32 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 33 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 34 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 35 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 36 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 37 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 38 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 39 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 40 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 41 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 42 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 43 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 44 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 45 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 46 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 47 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 48 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 49 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 50 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 51 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 52 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 53 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 54 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 55 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 56 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 57 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 58 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 59 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 60 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 61 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 62 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 63 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 64 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 65 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 66 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 67 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 68 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 69 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 70 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 71 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 72 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 73 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 74 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 75 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 76 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 77 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 78 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 79 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 80 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 81 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 82 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 83 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 84 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 85 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 86 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 87 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 88 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 89 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 90 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 91 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 92 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 93 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 94 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 95 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 96 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 97 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 98 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 99 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 100 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 101 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 102 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 103 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 111 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 112 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 113 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 115 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 116 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 117 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 118 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 119 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 120 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 121 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 122 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 123 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 124 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 125 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 126 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 131 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 137 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 157 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 158 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 161 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 197 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 200 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 201 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 202 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 203 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 204 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 205 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 206 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 207 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 208 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 209 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 210 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 212 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 213 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 214 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 215 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 216 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 217 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 218 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 219 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 220 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 221 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 222 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 223 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 224 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 225 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 226 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 227 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 228 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 229 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 230 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 231 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 232 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 233 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 234 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 235 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 236 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 237 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 238 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 239 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 240 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 241 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 242 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 243 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 244 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 245 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 246 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 247 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 248 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 249 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 250 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 251 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 252 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 253 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 254 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 255 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 256 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 313 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 314 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 315 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 316 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 317 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 318 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 319 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 320 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 321 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 322 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 330 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 333 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 334 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 335 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 336 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 337 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 338 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 339 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 341 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 342 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 343 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 344 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 345 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 346 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 347 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 348 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 349 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 351 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 352 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 354 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 355 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 356 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 357 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 358 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 359 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 360 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 361 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 362 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 363 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 364 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 365 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 366 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.52 |
| Metatranscriptomes | 1.1 |
| Isolates | 10.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 40.09 |
| Nodule | 2.2 |
| Rhizoplane | 1.26 |
| Rhizosphere | 43.87 |
| Stem | 0 |
| Stem Tuber | 0.16 |
| Unclassified | 12.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000174 | 3300001915 | Bacteria | 18584 |
| 2 | JGI24740J21852_10000852 | 3300001979 | Bacteria | 13458 |
| 3 | JGI24740J21852_10001192 | 3300001979 | Bacteria | 11728 |
| 4 | JGI24740J21852_10004237 | 3300001979 | Bacteria | 6182 |
| 5 | JGI24740J21852_10043788 | 3300001979 | Bacteria | 1332 |
| 6 | JGI25155J39150_1000357 | 3300002704 | Bacteria | 14284 |
| 7 | JGI25156J39149_1000398 | 3300002705 | Bacteria | 27303 |
| 8 | JGI25162J39368_1000026 | 3300002737 | Bacteria | 227710 |
| 9 | JGI25162J39368_1000027 | 3300002737 | Bacteria | 223163 |
| 10 | JGI25154J39366_1000241 | 3300002738 | Bacteria | 35875 |
| 11 | JGI25154J39366_1000349 | 3300002738 | Bacteria | 26415 |
| 12 | JGI25154J39366_1000405 | 3300002738 | Bacteria | 23503 |
| 13 | JGI25154J39366_1001245 | 3300002738 | Bacteria | 9581 |
| 14 | JGI25158J39367_1001439 | 3300002739 | Bacteria | 4171 |
| 15 | JGI25157J39369_1000105 | 3300002741 | Bacteria | 71453 |
| 16 | JGI25152J39213_1014378 | 3300002773 | Bacteria | 1608 |
| 17 | JGI25150J39212_1000679 | 3300002774 | Bacteria | 12436 |
| 18 | JGI25150J39212_1003302 | 3300002774 | Bacteria | 3798 |
| 19 | JGI25159J45721_1005058 | 3300002987 | Bacteria | 4203 |
| 20 | JGI25159J45721_1006953 | 3300002987 | Bacteria | 3307 |
| 21 | JGI25159J45721_1017845 | 3300002987 | Bacteria | 1451 |
| 22 | JGI25151J46595_10000045 | 3300003187 | Bacteria | 169207 |
| 23 | JGI25151J46595_10000285 | 3300003187 | Bacteria | 57259 |
| 24 | JGI25151J46595_10000412 | 3300003187 | Bacteria | 43739 |
| 25 | JGI25151J46595_10001901 | 3300003187 | Bacteria | 13275 |
| 26 | JGI25165J46597_1000031 | 3300003214 | Bacteria | 296858 |
| 27 | JGI25153J46596_10010430 | 3300003215 | Bacteria | 4203 |
| 28 | JGI25153J46596_10021547 | 3300003215 | Bacteria | 2399 |
| 29 | rootL2_10070966 | 3300003322 | Bacteria | 8408 |
| 30 | rootL2_10112703 | 3300003322 | Bacteria | 3205 |
| 31 | JGI25160J50197_1007660 | 3300003354 | Bacteria | 4203 |
| 32 | JGI25160J50197_1009350 | 3300003354 | Bacteria | 3645 |
| 33 | JGI25160J50197_1014814 | 3300003354 | Bacteria | 2588 |
| 34 | Ga0006562J51391_1047816 | 3300003578 | Bacteria | 2920 |
| 35 | Ga0006562J51391_1047817 | 3300003578 | Bacteria | 1970 |
| 36 | Ga0006562J51391_1126290 | 3300003578 | Bacteria | 1520 |
| 37 | Ga0006562J51391_1126291 | 3300003578 | Bacteria | 1370 |
| 38 | Ga0006562J51391_1128109 | 3300003578 | Bacteria | 1520 |
| 39 | Ga0006562J51391_1128110 | 3300003578 | Bacteria | 1736 |
| 40 | Ga0055538_1000018 | 3300003751 | Bacteria | 296858 |
| 41 | Ga0055538_1003595 | 3300003751 | Bacteria | 1933 |
| 42 | Ga0055539_1000023 | 3300003752 | Bacteria | 296858 |
| 43 | Ga0055539_1000053 | 3300003752 | Bacteria | 165149 |
| 44 | Ga0055533_1000031 | 3300003756 | Bacteria | 296858 |
| 45 | Ga0055533_1002112 | 3300003756 | Bacteria | 4773 |
| 46 | Ga0055532_1000033 | 3300003758 | Bacteria | 214652 |
| 47 | Ga0055532_1000051 | 3300003758 | Bacteria | 165365 |
| 48 | Ga0055525_1000039 | 3300003759 | Bacteria | 296858 |
| 49 | Ga0055525_1000440 | 3300003759 | Bacteria | 24091 |
| 50 | Ga0055525_1000621 | 3300003759 | Bacteria | 14565 |
| 51 | Ga0055535_1000024 | 3300003761 | Bacteria | 214652 |
| 52 | Ga0055535_1000274 | 3300003761 | Bacteria | 54132 |
| 53 | Ga0055542_1000027 | 3300003762 | Bacteria | 254819 |
| 54 | Ga0055529_1000044 | 3300003763 | Bacteria | 214652 |
| 55 | Ga0055526_1002868 | 3300003771 | Bacteria | 11363 |
| 56 | Ga0055526_1007438 | 3300003771 | Bacteria | 5688 |
| 57 | Ga0055526_1009818 | 3300003771 | Bacteria | 4546 |
| 58 | Ga0055526_1010720 | 3300003771 | Bacteria | 4228 |
| 59 | Ga0055526_1010795 | 3300003771 | Bacteria | 4203 |
| 60 | Ga0055537_1000006 | 3300003773 | Bacteria | 147020 |
| 61 | Ga0055537_1000162 | 3300003773 | Bacteria | 50062 |
| 62 | Ga0055537_1000445 | 3300003773 | Bacteria | 26375 |
| 63 | Ga0055537_1002317 | 3300003773 | Bacteria | 6501 |
| 64 | Ga0055537_1003980 | 3300003773 | Bacteria | 4363 |
| 65 | Ga0055537_1004001 | 3300003773 | Bacteria | 4339 |
| 66 | Ga0055537_1004177 | 3300003773 | Bacteria | 4203 |
| 67 | Ga0055524_1000032 | 3300003775 | Bacteria | 182182 |
| 68 | Ga0055524_1000690 | 3300003775 | Bacteria | 23658 |
| 69 | Ga0055524_1008604 | 3300003775 | Bacteria | 4228 |
| 70 | Ga0055524_1008676 | 3300003775 | Bacteria | 4203 |
| 71 | Ga0055524_1038591 | 3300003775 | Bacteria | 1246 |
| 72 | Ga0055536_1000163 | 3300003781 | Bacteria | 56770 |
| 73 | Ga0055536_1003187 | 3300003781 | Bacteria | 8888 |
| 74 | Ga0055536_1016958 | 3300003781 | Bacteria | 2408 |
| 75 | Ga0055534_1000128 | 3300003784 | Bacteria | 56698 |
| 76 | Ga0055534_1001699 | 3300003784 | Bacteria | 8395 |
| 77 | Ga0055534_1003814 | 3300003784 | Bacteria | 4615 |
| 78 | Ga0055534_1004269 | 3300003784 | Bacteria | 4203 |
| 79 | Ga0055534_1005845 | 3300003784 | Bacteria | 3213 |
| 80 | Ga0055528_1000504 | 3300003790 | Bacteria | 30737 |
| 81 | Ga0055528_1006119 | 3300003790 | Bacteria | 5497 |
| 82 | Ga0055528_1009033 | 3300003790 | Bacteria | 4203 |
| 83 | Ga0055528_1012244 | 3300003790 | Bacteria | 3345 |
| 84 | Ga0055530_10000328 | 3300003791 | Bacteria | 42975 |
| 85 | Ga0055530_10000866 | 3300003791 | Bacteria | 24928 |
| 86 | Ga0055530_10003406 | 3300003791 | Bacteria | 9074 |
| 87 | Ga0055530_10014544 | 3300003791 | Bacteria | 2615 |
| 88 | Ga0055540_1000046 | 3300003792 | Bacteria | 148762 |
| 89 | Ga0055540_1000813 | 3300003792 | Bacteria | 21129 |
| 90 | Ga0055540_1004807 | 3300003792 | Bacteria | 5937 |
| 91 | Ga0055540_1007252 | 3300003792 | Bacteria | 4229 |
| 92 | Ga0055531_10000428 | 3300003794 | Bacteria | 39914 |
| 93 | Ga0055531_10002570 | 3300003794 | Bacteria | 12051 |
| 94 | Ga0055531_10011137 | 3300003794 | Bacteria | 4378 |
| 95 | Ga0055531_10014498 | 3300003794 | Bacteria | 3543 |
| 96 | Ga0055531_10034955 | 3300003794 | Bacteria | 1584 |
| 97 | Ga0055541_1000016 | 3300003841 | Bacteria | 296861 |
| 98 | Ga0055541_1000303 | 3300003841 | Bacteria | 16411 |
| 99 | Ga0055543_1003838 | 3300004625 | Bacteria | 4266 |
| 100 | Ga0055543_1003866 | 3300004625 | Bacteria | 4241 |
| 101 | Ga0065165_1007662 | 3300005262 | Bacteria | 5243 |
| 102 | Ga0065165_1009778 | 3300005262 | Bacteria | 4241 |
| 103 | Ga0065714_10074345 | 3300005288 | Bacteria | 3032 |
| 104 | Ga0070658_10134468 | 3300005327 | Bacteria | 2062 |
| 105 | Ga0070660_100007159 | 3300005339 | Bacteria | 7757 |
| 106 | Ga0070661_100000021 | 3300005344 | Bacteria | 128510 |
| 107 | Ga0070669_100087562 | 3300005353 | Bacteria | 2329 |
| 108 | Ga0070673_100445481 | 3300005364 | Unclassified | 1164 |
| 109 | Ga0070659_100000839 | 3300005366 | Bacteria | 22393 |
| 110 | Ga0070663_100000004 | 3300005455 | Bacteria | 254839 |
| 111 | Ga0070679_100094032 | 3300005530 | Bacteria | 2985 |
| 112 | Ga0068853_100005678 | 3300005539 | Bacteria | 9811 |
| 113 | Ga0068853_100341405 | 3300005539 | Bacteria | 1392 |
| 114 | Ga0068855_100120233 | 3300005563 | Bacteria | 3006 |
| 115 | Ga0068855_100504858 | 3300005563 | Bacteria | 1314 |
| 116 | Ga0068855_100510097 | 3300005563 | Bacteria | 1306 |
| 117 | Ga0070664_100000007 | 3300005564 | Bacteria | 176744 |
| 118 | Ga0068857_100016420 | 3300005577 | Bacteria | 6487 |
| 119 | Ga0068854_100000045 | 3300005578 | Bacteria | 91844 |
| 120 | Ga0068856_100000004 | 3300005614 | Bacteria | 233761 |
| 121 | Ga0068856_100236266 | 3300005614 | Bacteria | 1843 |
| 122 | Ga0075365_10001542 | 3300006038 | Bacteria | 10541 |
| 123 | Ga0075363_100004545 | 3300006048 | Bacteria | 6083 |
| 124 | Ga0075364_10003241 | 3300006051 | Bacteria | 9217 |
| 125 | Ga0075364_10029645 | 3300006051 | Bacteria | 3510 |
| 126 | Ga0075364_10082317 | 3300006051 | Bacteria | 2130 |
| 127 | Ga0075432_10002170 | 3300006058 | Bacteria | 6527 |
| 128 | Ga0075432_10017820 | 3300006058 | Bacteria | 2422 |
| 129 | Ga0075362_10002812 | 3300006177 | Bacteria | 5938 |
| 130 | Ga0075362_10095521 | 3300006177 | Bacteria | 1384 |
| 131 | Ga0075366_10002392 | 3300006195 | Bacteria | 9626 |
| 132 | Ga0075366_10016252 | 3300006195 | Bacteria | 4275 |
| 133 | Ga0075366_10069943 | 3300006195 | Bacteria | 2090 |
| 134 | Ga0075370_10000759 | 3300006353 | Bacteria | 12912 |
| 135 | Ga0075370_10047873 | 3300006353 | Bacteria | 2421 |
| 136 | Ga0079104_1007154 | 3300006946 | Bacteria | 4091 |
| 137 | Ga0079104_1016174 | 3300006946 | Bacteria | 2189 |
| 138 | Ga0079104_1020222 | 3300006946 | Bacteria | 1840 |
| 139 | Ga0099826_10000065 | 3300006948 | Bacteria | 60649 |
| 140 | Ga0099826_10000122 | 3300006948 | Bacteria | 35250 |
| 141 | Ga0105251_10078738 | 3300009011 | Bacteria | 1526 |
| 142 | Ga0105240_10014225 | 3300009093 | Bacteria | 10869 |
| 143 | Ga0105240_10113980 | 3300009093 | Bacteria | 3266 |
| 144 | Ga0105240_10264636 | 3300009093 | Bacteria | 1982 |
| 145 | Ga0105240_10281036 | 3300009093 | Bacteria | 1912 |
| 146 | Ga0105243_10017120 | 3300009148 | Bacteria | 5482 |
| 147 | Ga0105239_10402938 | 3300010375 | Bacteria | 1548 |
| 148 | Ga0157347_1000228 | 3300012502 | Bacteria | 3257 |
| 149 | Ga0157373_10003146 | 3300013100 | Bacteria | 12471 |
| 150 | Ga0157373_10037094 | 3300013100 | Bacteria | 3496 |
| 151 | Ga0157371_10000001 | 3300013102 | Bacteria | 1162285 |
| 152 | Ga0157371_10000028 | 3300013102 | Bacteria | 254964 |
| 153 | Ga0157370_10000002 | 3300013104 | Bacteria | 431400 |
| 154 | Ga0157370_10001308 | 3300013104 | Bacteria | 31056 |
| 155 | Ga0157370_10224212 | 3300013104 | Bacteria | 1740 |
| 156 | Ga0157369_10002517 | 3300013105 | Bacteria | 21909 |
| 157 | Ga0157369_10007328 | 3300013105 | Bacteria | 12697 |
| 158 | Ga0157372_10000619 | 3300013307 | Bacteria | 38787 |
| 159 | Ga0182008_10001266 | 3300014497 | Bacteria | 17367 |
| 160 | Ga0182008_10026396 | 3300014497 | Bacteria | 2946 |
| 161 | Ga0182008_10113687 | 3300014497 | Bacteria | 1342 |
| 162 | Ga0182006_1008186 | 3300015261 | Bacteria | 4742 |
| 163 | Ga0182007_10004904 | 3300015262 | Bacteria | 5974 |
| 164 | Ga0182005_1000252 | 3300015265 | Bacteria | 34129 |
| 165 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 166 | Ga0163161_10000079 | 3300017792 | Bacteria | 97522 |
| 167 | Ga0163161_10001508 | 3300017792 | Bacteria | 17221 |
| 168 | Ga0163161_10020413 | 3300017792 | Bacteria | 4649 |
| 169 | Ga0163161_10087750 | 3300017792 | Bacteria | 2298 |
| 170 | Ga0163161_10176756 | 3300017792 | Bacteria | 1635 |
| 171 | Ga0206351_10260248 | 3300020077 | Bacteria | 2756 |
| 172 | Ga0209435_100028 | 3300025206 | Bacteria | 182520 |
| 173 | Ga0209435_100037 | 3300025206 | Bacteria | 124928 |
| 174 | Ga0209760_101921 | 3300025207 | Bacteria | 2043 |
| 175 | Ga0209436_102723 | 3300025208 | Bacteria | 5092 |
| 176 | Ga0209784_100024 | 3300025224 | Bacteria | 394613 |
| 177 | Ga0209784_100027 | 3300025224 | Bacteria | 363933 |
| 178 | Ga0209784_100525 | 3300025224 | Bacteria | 14438 |
| 179 | Ga0209784_101405 | 3300025224 | Bacteria | 3266 |
| 180 | Ga0209566_100018 | 3300025225 | Bacteria | 448638 |
| 181 | Ga0209566_100027 | 3300025225 | Bacteria | 363933 |
| 182 | Ga0209566_100129 | 3300025225 | Bacteria | 92878 |
| 183 | Ga0209674_100044 | 3300025226 | Bacteria | 363933 |
| 184 | Ga0209674_100225 | 3300025226 | Bacteria | 51780 |
| 185 | Ga0209674_100305 | 3300025226 | Bacteria | 33309 |
| 186 | Ga0209674_100775 | 3300025226 | Bacteria | 10818 |
| 187 | Ga0209672_100068 | 3300025228 | Bacteria | 175572 |
| 188 | Ga0209672_104679 | 3300025228 | Bacteria | 2493 |
| 189 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 190 | Ga0209147_100008 | 3300025229 | Bacteria | 777096 |
| 191 | Ga0209147_100940 | 3300025229 | Bacteria | 12877 |
| 192 | Ga0209563_100039 | 3300025230 | Bacteria | 409717 |
| 193 | Ga0209563_100048 | 3300025230 | Bacteria | 363933 |
| 194 | Ga0209563_102266 | 3300025230 | Bacteria | 4444 |
| 195 | Ga0207427_100616 | 3300025231 | Bacteria | 17528 |
| 196 | Ga0209437_100053 | 3300025233 | Bacteria | 375580 |
| 197 | Ga0209437_100055 | 3300025233 | Bacteria | 363933 |
| 198 | Ga0209258_100013 | 3300025242 | Bacteria | 777096 |
| 199 | Ga0209258_100048 | 3300025242 | Bacteria | 365881 |
| 200 | Ga0209258_100398 | 3300025242 | Bacteria | 54737 |
| 201 | Ga0207425_1000107 | 3300025245 | Bacteria | 77829 |
| 202 | Ga0209646_1000021 | 3300025246 | Bacteria | 461083 |
| 203 | Ga0209646_1000063 | 3300025246 | Bacteria | 248065 |
| 204 | Ga0209646_1000095 | 3300025246 | Bacteria | 182520 |
| 205 | Ga0209026_1000110 | 3300025250 | Bacteria | 141989 |
| 206 | Ga0209026_1007165 | 3300025250 | Bacteria | 2572 |
| 207 | Ga0209677_100024 | 3300025253 | Bacteria | 406035 |
| 208 | Ga0209677_100028 | 3300025253 | Bacteria | 363933 |
| 209 | Ga0209148_1000019 | 3300025254 | Bacteria | 748518 |
| 210 | Ga0209148_1000040 | 3300025254 | Bacteria | 473531 |
| 211 | Ga0209148_1004104 | 3300025254 | Bacteria | 3683 |
| 212 | Ga0209759_1000080 | 3300025256 | Bacteria | 171186 |
| 213 | Ga0209759_1000115 | 3300025256 | Bacteria | 141877 |
| 214 | Ga0209759_1000155 | 3300025256 | Bacteria | 118819 |
| 215 | Ga0209759_1001910 | 3300025256 | Bacteria | 10220 |
| 216 | Ga0209759_1007204 | 3300025256 | Bacteria | 3615 |
| 217 | Ga0209129_1000007 | 3300025258 | Bacteria | 771325 |
| 218 | Ga0209129_1001384 | 3300025258 | Bacteria | 13561 |
| 219 | Ga0209129_1007676 | 3300025258 | Bacteria | 3148 |
| 220 | Ga0209233_1000070 | 3300025261 | Bacteria | 363933 |
| 221 | Ga0209565_1000016 | 3300025263 | Bacteria | 477707 |
| 222 | Ga0209565_1000178 | 3300025263 | Bacteria | 80603 |
| 223 | Ga0209565_1000196 | 3300025263 | Bacteria | 72238 |
| 224 | Ga0209565_1000229 | 3300025263 | Bacteria | 61660 |
| 225 | Ga0209565_1000336 | 3300025263 | Bacteria | 41751 |
| 226 | Ga0209565_1001871 | 3300025263 | Bacteria | 8381 |
| 227 | Ga0209565_1014648 | 3300025263 | Bacteria | 1793 |
| 228 | Ga0209565_1021622 | 3300025263 | Bacteria | 1342 |
| 229 | Ga0209455_1000042 | 3300025272 | Bacteria | 419638 |
| 230 | Ga0209455_1007520 | 3300025272 | Bacteria | 3066 |
| 231 | Ga0209673_1000073 | 3300025273 | Bacteria | 233645 |
| 232 | Ga0209673_1000463 | 3300025273 | Bacteria | 68460 |
| 233 | Ga0209673_1000764 | 3300025273 | Bacteria | 43642 |
| 234 | Ga0209673_1000884 | 3300025273 | Bacteria | 38736 |
| 235 | Ga0209673_1009344 | 3300025273 | Bacteria | 4260 |
| 236 | Ga0209673_1041756 | 3300025273 | Bacteria | 1298 |
| 237 | Ga0209130_1000210 | 3300025284 | Bacteria | 77155 |
| 238 | Ga0209130_1000263 | 3300025284 | Bacteria | 65894 |
| 239 | Ga0209130_1000580 | 3300025284 | Bacteria | 35617 |
| 240 | Ga0209130_1001148 | 3300025284 | Bacteria | 19288 |
| 241 | Ga0209675_1000080 | 3300025291 | Bacteria | 154613 |
| 242 | Ga0209675_1000092 | 3300025291 | Bacteria | 144839 |
| 243 | Ga0209675_1000186 | 3300025291 | Bacteria | 68471 |
| 244 | Ga0209675_1000361 | 3300025291 | Bacteria | 38739 |
| 245 | Ga0209675_1001704 | 3300025291 | Bacteria | 12152 |
| 246 | Ga0209675_1002302 | 3300025291 | Bacteria | 9905 |
| 247 | Ga0209675_1003136 | 3300025291 | Bacteria | 8046 |
| 248 | Ga0209675_1017016 | 3300025291 | Bacteria | 2093 |
| 249 | Ga0209676_1000004 | 3300025292 | Bacteria | 1138360 |
| 250 | Ga0209676_1000165 | 3300025292 | Bacteria | 156709 |
| 251 | Ga0209676_1000172 | 3300025292 | Bacteria | 153664 |
| 252 | Ga0209676_1000480 | 3300025292 | Bacteria | 65842 |
| 253 | Ga0209676_1008977 | 3300025292 | Bacteria | 4381 |
| 254 | Ga0209676_1011313 | 3300025292 | Bacteria | 3612 |
| 255 | Ga0209025_1000039 | 3300025294 | Bacteria | 377396 |
| 256 | Ga0209025_1000114 | 3300025294 | Bacteria | 218921 |
| 257 | Ga0209025_1000125 | 3300025294 | Bacteria | 201444 |
| 258 | Ga0209025_1000222 | 3300025294 | Bacteria | 135688 |
| 259 | Ga0209025_1000230 | 3300025294 | Bacteria | 131131 |
| 260 | Ga0209025_1000278 | 3300025294 | Bacteria | 117718 |
| 261 | Ga0209025_1000628 | 3300025294 | Bacteria | 62542 |
| 262 | Ga0209025_1005386 | 3300025294 | Bacteria | 10474 |
| 263 | Ga0209025_1011879 | 3300025294 | Bacteria | 5669 |
| 264 | Ga0209564_1000165 | 3300025295 | Bacteria | 160244 |
| 265 | Ga0209564_1000200 | 3300025295 | Bacteria | 137503 |
| 266 | Ga0209564_1000318 | 3300025295 | Bacteria | 93851 |
| 267 | Ga0209564_1000489 | 3300025295 | Bacteria | 65860 |
| 268 | Ga0209564_1000582 | 3300025295 | Bacteria | 57908 |
| 269 | Ga0209564_1002074 | 3300025295 | Bacteria | 17227 |
| 270 | Ga0209564_1012912 | 3300025295 | Bacteria | 3597 |
| 271 | Ga0209758_1000025 | 3300025297 | Bacteria | 586687 |
| 272 | Ga0209758_1002670 | 3300025297 | Bacteria | 17613 |
| 273 | Ga0209758_1012494 | 3300025297 | Bacteria | 4747 |
| 274 | Ga0209758_1042251 | 3300025297 | Bacteria | 1693 |
| 275 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 276 | Ga0209050_1000084 | 3300025298 | Bacteria | 263245 |
| 277 | Ga0209050_1000565 | 3300025298 | Bacteria | 60237 |
| 278 | Ga0209256_1000067 | 3300025299 | Bacteria | 246812 |
| 279 | Ga0209256_1000110 | 3300025299 | Bacteria | 182312 |
| 280 | Ga0209256_1000198 | 3300025299 | Bacteria | 113429 |
| 281 | Ga0209256_1000335 | 3300025299 | Bacteria | 78765 |
| 282 | Ga0209256_1000362 | 3300025299 | Bacteria | 73517 |
| 283 | Ga0209256_1032242 | 3300025299 | Bacteria | 1423 |
| 284 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 285 | Ga0207426_1000178 | 3300025302 | Bacteria | 159291 |
| 286 | Ga0207426_1000264 | 3300025302 | Bacteria | 110747 |
| 287 | Ga0207426_1000436 | 3300025302 | Bacteria | 67619 |
| 288 | Ga0207426_1002104 | 3300025302 | Bacteria | 13705 |
| 289 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 290 | Ga0209051_1000058 | 3300025303 | Bacteria | 263137 |
| 291 | Ga0209051_1000096 | 3300025303 | Bacteria | 167399 |
| 292 | Ga0209051_1000278 | 3300025303 | Bacteria | 83769 |
| 293 | Ga0209051_1000673 | 3300025303 | Bacteria | 38238 |
| 294 | Ga0209051_1001488 | 3300025303 | Bacteria | 19623 |
| 295 | Ga0209051_1010611 | 3300025303 | Bacteria | 4626 |
| 296 | Ga0209051_1015557 | 3300025303 | Bacteria | 3492 |
| 297 | Ga0209051_1022601 | 3300025303 | Bacteria | 2643 |
| 298 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 299 | Ga0209257_1000022 | 3300025304 | Bacteria | 765258 |
| 300 | Ga0209257_1000072 | 3300025304 | Bacteria | 332791 |
| 301 | Ga0209257_1000092 | 3300025304 | Bacteria | 263137 |
| 302 | Ga0209257_1011137 | 3300025304 | Bacteria | 4387 |
| 303 | Ga0207713_1056345 | 3300025735 | Bacteria | 1528 |
| 304 | Ga0207705_10124608 | 3300025909 | Bacteria | 1914 |
| 305 | Ga0207695_10001071 | 3300025913 | Bacteria | 47830 |
| 306 | Ga0207695_10015134 | 3300025913 | Bacteria | 9100 |
| 307 | Ga0207695_10181958 | 3300025913 | Bacteria | 2023 |
| 308 | Ga0207671_10159153 | 3300025914 | Bacteria | 1748 |
| 309 | Ga0207657_10051639 | 3300025919 | Bacteria | 3573 |
| 310 | Ga0207649_10000030 | 3300025920 | Bacteria | 154458 |
| 311 | Ga0207652_10105578 | 3300025921 | Bacteria | 2492 |
| 312 | Ga0207681_10110578 | 3300025923 | Bacteria | 1998 |
| 313 | Ga0207690_10001459 | 3300025932 | Bacteria | 14792 |
| 314 | Ga0207709_10004910 | 3300025935 | Bacteria | 7655 |
| 315 | Ga0207691_10304944 | 3300025940 | Bacteria | 1367 |
| 316 | Ga0207679_10000004 | 3300025945 | Bacteria | 589021 |
| 317 | Ga0207667_10166753 | 3300025949 | Bacteria | 2264 |
| 318 | Ga0207667_10527763 | 3300025949 | Bacteria | 1195 |
| 319 | Ga0207640_10000155 | 3300025981 | Bacteria | 49469 |
| 320 | Ga0207639_10180756 | 3300026041 | Bacteria | 1794 |
| 321 | Ga0207678_10000005 | 3300026067 | Bacteria | 193984 |
| 322 | Ga0207702_10000342 | 3300026078 | Bacteria | 53546 |
| 323 | Ga0207702_10573670 | 3300026078 | Bacteria | 1105 |
| 324 | Ga0207675_100214544 | 3300026118 | Unclassified | 1852 |
| 325 | Ga0207698_10154674 | 3300026142 | Bacteria | 1996 |
| 326 | Ga0209282_1000057 | 3300027666 | Bacteria | 99758 |
| 327 | Ga0209282_1005596 | 3300027666 | Bacteria | 7730 |
| 328 | Ga0207428_10087053 | 3300027907 | Bacteria | 2431 |
| 329 | Ga0268266_10167691 | 3300028379 | Bacteria | 1991 |
| 330 | Ga0316176_1085576 | 3300030732 | Bacteria | 6139 |
| 331 | Ga0314311_1207443 | 3300030733 | Bacteria | 5190 |
| 332 | Ga0316179_1087651 | 3300030734 | Bacteria | 4112 |
| 333 | Ga0316178_1008722 | 3300030735 | Bacteria | 6969 |
| 334 | Ga0316180_1108197 | 3300030736 | Bacteria | 3425 |
| 335 | Ga0316183_1023144 | 3300030742 | Bacteria | 13762 |
| 336 | Ga0316181_1207329 | 3300030744 | Bacteria | 3325 |
| 337 | Ga0316182_1238298 | 3300030745 | Bacteria | 2783 |
| 338 | Ga0265327_10003596 | 3300031251 | Bacteria | 14624 |
| 339 | Ga0307513_10000066 | 3300031456 | Bacteria | 141617 |
| 340 | Ga0307408_100011351 | 3300031548 | Bacteria | 5885 |
| 341 | Ga0307408_100019360 | 3300031548 | Bacteria | 4582 |
| 342 | Ga0307408_100319387 | 3300031548 | Bacteria | 1307 |
| 343 | Ga0307405_10039858 | 3300031731 | Bacteria | 2842 |
| 344 | Ga0307405_10053765 | 3300031731 | Bacteria | 2510 |
| 345 | Ga0307410_10294198 | 3300031852 | Bacteria | 1279 |
| 346 | Ga0307406_10000129 | 3300031901 | Bacteria | 44483 |
| 347 | Ga0307406_10007196 | 3300031901 | Bacteria | 6164 |
| 348 | Ga0307406_10146839 | 3300031901 | Bacteria | 1677 |
| 349 | Ga0307407_10270863 | 3300031903 | Bacteria | 1172 |
| 350 | Ga0307412_10009245 | 3300031911 | Bacteria | 5649 |
| 351 | Ga0307412_10030907 | 3300031911 | Bacteria | 3377 |
| 352 | Ga0307412_10044875 | 3300031911 | Bacteria | 2886 |
| 353 | Ga0307412_10082604 | 3300031911 | Bacteria | 2225 |
| 354 | Ga0307412_10271310 | 3300031911 | Bacteria | 1327 |
| 355 | Ga0307412_10359337 | 3300031911 | Bacteria | 1172 |
| 356 | Ga0307414_10022669 | 3300032004 | Bacteria | 3966 |
| 357 | Ga0307414_10036835 | 3300032004 | Bacteria | 3270 |
| 358 | Ga0307411_10011599 | 3300032005 | Bacteria | 4767 |
| 359 | Ga0307411_10157031 | 3300032005 | Bacteria | 1698 |
| 360 | Ga0307411_10198056 | 3300032005 | Bacteria | 1540 |
| 361 | Ga0307411_10198191 | 3300032005 | Bacteria | 1539 |
| 362 | Ga0395900_0089947 | 3300037418 | Bacteria | 3155 |
| 363 | Ga0395905_0001326 | 3300037471 | Bacteria | 30204 |
| 364 | Ga0395905_0213441 | 3300037471 | Bacteria | 1808 |
| 365 | Ga0395901_0438761 | 3300038443 | Bacteria | 1337 |
| 366 | Ga0439436_0006267 | 3300041404 | Bacteria | 3652 |
| 367 | Ga0439436_0015800 | 3300041404 | Bacteria | 2268 |
| 368 | Ga0439438_040191 | 3300041405 | Bacteria | 1216 |
| 369 | Ga0439447_012885 | 3300041407 | Bacteria | 2389 |
| 370 | Ga0439466_0001839 | 3300041411 | Bacteria | 8332 |
| 371 | Ga0439466_0003263 | 3300041411 | Bacteria | 6316 |
| 372 | Ga0439466_0022118 | 3300041411 | Bacteria | 2247 |
| 373 | Ga0439465_0002729 | 3300041413 | Bacteria | 5771 |
| 374 | Ga0439465_0008377 | 3300041413 | Bacteria | 3264 |
| 375 | Ga0451853_2505844 | 3300041512 | Bacteria | 1623 |
| 376 | Ga0439431_0000602 | 3300041997 | Bacteria | 7602 |
| 377 | Ga0439431_0002506 | 3300041997 | Bacteria | 4062 |
| 378 | Ga0439431_0021968 | 3300041997 | Bacteria | 1535 |
| 379 | Ga0439442_000356 | 3300042002 | Bacteria | 10906 |
| 380 | Ga0439442_007780 | 3300042002 | Bacteria | 2162 |
| 381 | Ga0439432_002354 | 3300042006 | Bacteria | 7133 |
| 382 | Ga0439432_036936 | 3300042006 | Bacteria | 1561 |
| 383 | Ga0439449_0001161 | 3300042007 | Bacteria | 10323 |
| 384 | Ga0439449_0040381 | 3300042007 | Bacteria | 1734 |
| 385 | Ga0439452_001694 | 3300042010 | Bacteria | 8661 |
| 386 | Ga0439452_015968 | 3300042010 | Bacteria | 2048 |
| 387 | Ga0439462_0005665 | 3300042015 | Bacteria | 3083 |
| 388 | Ga0439462_0008376 | 3300042015 | Bacteria | 2605 |
| 389 | Ga0450911_004615 | 3300042115 | Bacteria | 2237 |
| 390 | Ga0450911_009592 | 3300042115 | Bacteria | 1354 |
| 391 | Ga0450921_000059 | 3300042123 | Bacteria | 3054 |
| 392 | Ga0450922_003756 | 3300042124 | Bacteria | 1397 |
| 393 | Ga0450923_000356 | 3300042125 | Bacteria | 4755 |
| 394 | Ga0450898_006207 | 3300042134 | Bacteria | 1828 |
| 395 | Ga0450906_000114 | 3300042145 | Bacteria | 14010 |
| 396 | Ga0450910_001770 | 3300042147 | Bacteria | 2777 |
| 397 | Ga0439446_0001003 | 3300042156 | Bacteria | 6164 |
| 398 | Ga0439446_0003242 | 3300042156 | Bacteria | 4014 |
| 399 | Ga0450908_000411 | 3300042184 | Bacteria | 8254 |
| 400 | Ga0450909_003251 | 3300042185 | Bacteria | 2313 |
| 401 | Ga0439434_0002977 | 3300042435 | Bacteria | 4954 |
| 402 | Ga0439434_0006263 | 3300042435 | Bacteria | 3472 |
| 403 | Ga0450918_001238 | 3300042531 | Bacteria | 5188 |
| 404 | Ga0466986_0022780 | 3300044650 | Bacteria | 4163 |
| 405 | Ga0466972_0005748 | 3300044658 | Bacteria | 6210 |
| 406 | Ga0466982_0004071 | 3300044672 | Bacteria | 6527 |
| 407 | Ga0466965_0007706 | 3300044683 | Bacteria | 4954 |
| 408 | Ga0466966_0117721 | 3300044684 | Bacteria | 1634 |
| 409 | Ga0466961_0000194 | 3300044693 | Bacteria | 40839 |
| 410 | Ga0466971_0012336 | 3300044719 | Bacteria | 3744 |
| 411 | Ga0466970_0002743 | 3300044765 | Bacteria | 8504 |
| 412 | Ga0466970_0106289 | 3300044765 | Bacteria | 1531 |
| 413 | Ga0466957_0018736 | 3300044842 | Bacteria | 4066 |
| 414 | Ga0466957_0176994 | 3300044842 | Bacteria | 1392 |
| 415 | Ga0466960_0028531 | 3300044901 | Bacteria | 2554 |
| 416 | Ga0466959_0000928 | 3300045049 | Bacteria | 17381 |
| 417 | Ga0466967_0026078 | 3300045976 | Bacteria | 4834 |
| 418 | Ga0495627_002599 | 3300046453 | Bacteria | 8520 |
| 419 | Ga0495627_009896 | 3300046453 | Bacteria | 3491 |
| 420 | Ga0495592_0025069 | 3300046454 | Bacteria | 4529 |
| 421 | Ga0495638_0025738 | 3300046460 | Bacteria | 3820 |
| 422 | Ga0495638_0038579 | 3300046460 | Bacteria | 3034 |
| 423 | Ga0495653_0013213 | 3300046463 | Bacteria | 6730 |
| 424 | Ga0495650_0000015 | 3300046471 | Bacteria | 557595 |
| 425 | Ga0495605_0000624 | 3300046474 | Bacteria | 27289 |
| 426 | Ga0495596_0000038 | 3300046500 | Bacteria | 95273 |
| 427 | Ga0495607_0000048 | 3300046501 | Bacteria | 121640 |
| 428 | Ga0495607_0001888 | 3300046501 | Bacteria | 17773 |
| 429 | Ga0495607_0015724 | 3300046501 | Bacteria | 4897 |
| 430 | Ga0495583_0002011 | 3300046506 | Bacteria | 18547 |
| 431 | Ga0495606_0000208 | 3300046507 | Bacteria | 103578 |
| 432 | Ga0495606_0002379 | 3300046507 | Bacteria | 22053 |
| 433 | Ga0495608_0015415 | 3300046511 | Bacteria | 5300 |
| 434 | Ga0495610_0000141 | 3300046512 | Bacteria | 79877 |
| 435 | Ga0495610_0051727 | 3300046512 | Bacteria | 1997 |
| 436 | Ga0495616_0001178 | 3300046513 | Bacteria | 18447 |
| 437 | Ga0495616_0001459 | 3300046513 | Bacteria | 16445 |
| 438 | Ga0495616_0004666 | 3300046513 | Bacteria | 8595 |
| 439 | Ga0495618_0045013 | 3300046514 | Bacteria | 2783 |
| 440 | Ga0495620_0013152 | 3300046515 | Bacteria | 4247 |
| 441 | Ga0495620_0070522 | 3300046515 | Bacteria | 1431 |
| 442 | Ga0495628_0000827 | 3300046516 | Bacteria | 28693 |
| 443 | Ga0495631_0000021 | 3300046518 | Bacteria | 92765 |
| 444 | Ga0495632_0001125 | 3300046519 | Bacteria | 22872 |
| 445 | Ga0495637_0002203 | 3300046520 | Bacteria | 10890 |
| 446 | Ga0495637_0021191 | 3300046520 | Bacteria | 2982 |
| 447 | Ga0495643_0000328 | 3300046522 | Bacteria | 65181 |
| 448 | Ga0495644_0062315 | 3300046523 | Bacteria | 1401 |
| 449 | Ga0495642_0050011 | 3300046528 | Bacteria | 1717 |
| 450 | Ga0495642_0065219 | 3300046528 | Bacteria | 1516 |
| 451 | Ga0495652_0034890 | 3300046529 | Bacteria | 4381 |
| 452 | Ga0495652_0119845 | 3300046529 | Bacteria | 2100 |
| 453 | Ga0495654_0021664 | 3300046530 | Bacteria | 3342 |
| 454 | Ga0495609_0001032 | 3300046538 | Bacteria | 19570 |
| 455 | Ga0495621_0036435 | 3300046539 | Bacteria | 1707 |
| 456 | Ga0495597_0016789 | 3300046542 | Bacteria | 3454 |
| 457 | Ga0495597_0048561 | 3300046542 | Bacteria | 1877 |
| 458 | Ga0495645_0054893 | 3300046543 | Bacteria | 2893 |
| 459 | Ga0495622_0066605 | 3300046557 | Bacteria | 1665 |
| 460 | Ga0495633_0015227 | 3300046558 | Bacteria | 3995 |
| 461 | Ga0495656_0000141 | 3300046615 | Bacteria | 26743 |
| 462 | Ga0495668_0015172 | 3300046616 | Bacteria | 4504 |
| 463 | Ga0495625_0000437 | 3300046660 | Bacteria | 62719 |
| 464 | Ga0495625_0043430 | 3300046660 | Bacteria | 3259 |
| 465 | Ga0495635_0117097 | 3300046663 | Bacteria | 1818 |
| 466 | Ga0495661_0002776 | 3300046665 | Bacteria | 13270 |
| 467 | Ga0495661_0010954 | 3300046665 | Bacteria | 6163 |
| 468 | Ga0495661_0017305 | 3300046665 | Bacteria | 4762 |
| 469 | Ga0495661_0205662 | 3300046665 | Bacteria | 1028 |
| 470 | Ga0495588_0077793 | 3300046674 | Bacteria | 1730 |
| 471 | Ga0495599_0007322 | 3300046678 | Bacteria | 6689 |
| 472 | Ga0495646_0001482 | 3300046680 | Bacteria | 13955 |
| 473 | Ga0495646_0003380 | 3300046680 | Bacteria | 9918 |
| 474 | Ga0495658_0002746 | 3300046683 | Bacteria | 8849 |
| 475 | Ga0495624_0014709 | 3300046690 | Bacteria | 5299 |
| 476 | Ga0495670_0010557 | 3300046691 | Bacteria | 4540 |
| 477 | Ga0495670_0156453 | 3300046691 | Bacteria | 1196 |
| 478 | Ga0495671_0000462 | 3300046692 | Bacteria | 31814 |
| 479 | Ga0495671_0016868 | 3300046692 | Bacteria | 3893 |
| 480 | Ga0495649_0025594 | 3300046694 | Bacteria | 3287 |
| 481 | Ga0495600_0018956 | 3300046809 | Bacteria | 4391 |
| 482 | Ga0495660_0088014 | 3300046810 | Bacteria | 1619 |
| 483 | Ga0495660_0140419 | 3300046810 | Bacteria | 1203 |
| 484 | Ga0495604_0012483 | 3300047317 | Bacteria | 6756 |
| 485 | Ga0495604_0037846 | 3300047317 | Bacteria | 3797 |
| 486 | Ga0495636_0004786 | 3300047318 | Bacteria | 5305 |
| 487 | Ga0495672_0027483 | 3300047320 | Bacteria | 3615 |
| 488 | Ga0495672_0108818 | 3300047320 | Bacteria | 1490 |
| 489 | Ga0495676_0010916 | 3300047321 | Bacteria | 8211 |
| 490 | Ga0495687_014410 | 3300047443 | Bacteria | 4073 |
| 491 | Ga0495687_043789 | 3300047443 | Bacteria | 1948 |
| 492 | Ga0495673_0000113 | 3300047469 | Bacteria | 163495 |
| 493 | Ga0495593_0002373 | 3300047673 | Bacteria | 11312 |
| 494 | Ga0495602_0046578 | 3300048088 | Bacteria | 3915 |
| 495 | Ga0495614_0004046 | 3300048089 | Bacteria | 6589 |
| 496 | Ga0495626_0001224 | 3300048091 | Bacteria | 21136 |
| 497 | Ga0496101_0005734 | 3300048904 | Bacteria | 7933 |
| 498 | Ga0496103_0016925 | 3300048906 | Bacteria | 4355 |
| 499 | Ga0496104_0271876 | 3300048907 | Bacteria | 1607 |
| 500 | Ga0496111_0091360 | 3300048914 | Bacteria | 2231 |
| 501 | Ga0496117_0007805 | 3300048920 | Bacteria | 10311 |
| 502 | Ga0496118_0002845 | 3300048921 | Bacteria | 22594 |
| 503 | Ga0496121_0004379 | 3300048924 | Bacteria | 19076 |
| 504 | Ga0496121_0030981 | 3300048924 | Bacteria | 4899 |
| 505 | Ga0496121_0053672 | 3300048924 | Bacteria | 3375 |
| 506 | Ga0496121_0234345 | 3300048924 | Bacteria | 1283 |
| 507 | Ga0496122_0000238 | 3300048925 | Bacteria | 123588 |
| 508 | Ga0496122_0000676 | 3300048925 | Bacteria | 68538 |
| 509 | Ga0496122_0041484 | 3300048925 | Bacteria | 3638 |
| 510 | Ga0496122_0059464 | 3300048925 | Bacteria | 2821 |
| 511 | Ga0496123_0000262 | 3300048926 | Bacteria | 106366 |
| 512 | Ga0496123_0008328 | 3300048926 | Bacteria | 9544 |
| 513 | Ga0496123_0023727 | 3300048926 | Bacteria | 4687 |
| 514 | Ga0496124_0141563 | 3300048927 | Bacteria | 1897 |
| 515 | Ga0496125_0007020 | 3300048928 | Bacteria | 12051 |
| 516 | Ga0496125_0012129 | 3300048928 | Bacteria | 8573 |
| 517 | Ga0496125_0109544 | 3300048928 | Bacteria | 2005 |
| 518 | Ga0495682_0017433 | 3300049460 | Bacteria | 2710 |
| 519 | Ga0501033_0223522 | 3300049570 | Bacteria | 1339 |
| 520 | Ga0501034_0000022 | 3300049571 | Bacteria | 264441 |
| 521 | Ga0501036_0520420 | 3300049572 | Bacteria | 989 |
| 522 | Ga0501038_0320827 | 3300049574 | Bacteria | 1212 |
| 523 | Ga0501039_0135826 | 3300049575 | Bacteria | 1931 |
| 524 | Ga0501047_0009582 | 3300049581 | Bacteria | 9154 |
| 525 | Ga0501262_000044 | 3300049759 | Bacteria | 16463 |
| 526 | Ga0501035_0023999 | 3300049822 | Bacteria | 5596 |
| 527 | Ga0501044_0013376 | 3300049823 | Bacteria | 8874 |
| 528 | Ga0501044_0027489 | 3300049823 | Bacteria | 6011 |
| 529 | nmdc:mga03683_1355_c1 | 3300050489 | Bacteria | 7262 |
| 530 | nmdc:mga03n38_17203_c1 | 3300050490 | Bacteria | 2827 |
| 531 | nmdc:mga03n38_5412_c1 | 3300050490 | Bacteria | 4346 |
| 532 | nmdc:mga00v17_131904_c1 | 3300050491 | Bacteria | 1597 |
| 533 | nmdc:mga0yw44_473_c1 | 3300050492 | Bacteria | 14285 |
| 534 | nmdc:mga0k408_250629_c1 | 3300050493 | Unclassified | 1057 |
| 535 | nmdc:mga0k408_2986_c1 | 3300050493 | Bacteria | 8966 |
| 536 | nmdc:mga0k408_54798_c1 | 3300050493 | Bacteria | 2311 |
| 537 | nmdc:mga0k408_79253_c1 | 3300050493 | Bacteria | 1922 |
| 538 | nmdc:mga07m45_41256_c1 | 3300050496 | Bacteria | 2584 |
| 539 | Ga0500610_0000115 | 3300053079 | Bacteria | 24228 |
| 540 | Ga0500610_0000411 | 3300053079 | Bacteria | 13125 |
| 541 | Ga0500644_0073158 | 3300053088 | Bacteria | 1240 |
| 542 | Ga0500651_0000360 | 3300053093 | Bacteria | 25226 |
| 543 | Ga0500566_0003903 | 3300053094 | Bacteria | 8896 |
| 544 | Ga0500571_000052 | 3300053110 | Bacteria | 35666 |
| 545 | Ga0500593_000089 | 3300053117 | Bacteria | 33327 |
| 546 | Ga0500594_0008611 | 3300053118 | Bacteria | 2329 |
| 547 | Ga0500594_0014392 | 3300053118 | Bacteria | 1894 |
| 548 | Ga0500595_020459 | 3300053119 | Bacteria | 2381 |
| 549 | Ga0500597_016713 | 3300053120 | Bacteria | 2806 |
| 550 | Ga0500607_000146 | 3300053121 | Bacteria | 59939 |
| 551 | Ga0500608_002675 | 3300053122 | Bacteria | 6534 |
| 552 | Ga0500618_001381 | 3300053125 | Bacteria | 10986 |
| 553 | Ga0500618_019575 | 3300053125 | Bacteria | 1664 |
| 554 | Ga0500626_004619 | 3300053128 | Bacteria | 5261 |
| 555 | Ga0500655_008403 | 3300053133 | Bacteria | 1858 |
| 556 | Ga0500658_0000052 | 3300053134 | Bacteria | 61874 |
| 557 | Ga0500658_0000503 | 3300053134 | Bacteria | 16677 |
| 558 | Ga0500559_0148289 | 3300053136 | Bacteria | 1100 |
| 559 | Ga0500564_019948 | 3300053138 | Bacteria | 3067 |
| 560 | Ga0500568_0001382 | 3300053139 | Bacteria | 15727 |
| 561 | Ga0500573_0047021 | 3300053140 | Bacteria | 2486 |
| 562 | Ga0500574_000444 | 3300053141 | Bacteria | 5239 |
| 563 | Ga0500574_010160 | 3300053141 | Bacteria | 2076 |
| 564 | Ga0500586_000131 | 3300053145 | Bacteria | 13729 |
| 565 | Ga0500616_0013412 | 3300053153 | Bacteria | 4759 |
| 566 | Ga0500619_022509 | 3300053154 | Bacteria | 1830 |
| 567 | Ga0500627_0002112 | 3300053158 | Bacteria | 5765 |
| 568 | Ga0500634_0019577 | 3300053161 | Bacteria | 3648 |
| 569 | Ga0500636_0052460 | 3300053177 | Bacteria | 2395 |
| 570 | Ga0466962_0009891 | 3300061719 | Bacteria | 4574 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050493 | nmdc:mga0k408_250629_c1 | nmdc:mga0k408_250629_c1_23_796 | 249 |
| 2 | 3300044901 | Ga0466960_0028531 | Ga0466960_0028531_786_1706 | 254 |
| 3 | 3300003354 | JGI25160J50197_1009350 | JGI25160J50197_10093502 | 261 |
| 4 | 3300025284 | Ga0209130_1000263 | Ga0209130_10002639 | 261 |
| 5 | 3300025302 | Ga0207426_1000436 | Ga0207426_100043642 | 261 |
| 6 | 3300041997 | Ga0439431_0021968 | Ga0439431_0021968_588_1502 | 261 |
| 7 | 3300038443 | Ga0395901_0438761 | Ga0395901_0438761_513_1325 | 263 |
| 8 | 3300046539 | Ga0495621_0036435 | Ga0495621_0036435_837_1688 | 271 |
| 9 | 3300046663 | Ga0495635_0117097 | Ga0495635_0117097_959_1792 | 271 |
| 10 | 3300003187 | JGI25151J46595_10000285 | JGI25151J46595_1000028512 | 274 |
| 11 | 3300025294 | Ga0209025_1000114 | Ga0209025_1000114207 | 274 |
| 12 | 3300025297 | Ga0209758_1002670 | Ga0209758_100267019 | 274 |
| 13 | 3300006195 | Ga0075366_10069943 | Ga0075366_100699433 | 281 |
| 14 | 3300049460 | Ga0495682_0017433 | Ga0495682_0017433_1774_2694 | 292 |
| 15 | iso_pu_bacteria | 2854601825 | 2854603607 | 292 |
| 16 | iso_pu_bacteria | 2855730933 | 2855735384 | 292 |
| 17 | iso_pu_bacteria | 2855767633 | 2855771167 | 292 |
| 18 | iso_pu_bacteria | 2881412998 | 2881416961 | 292 |
| 19 | 3300003187 | JGI25151J46595_10000045 | JGI25151J46595_1000004530 | 293 |
| 20 | 3300025294 | Ga0209025_1000039 | Ga0209025_1000039195 | 293 |
| 21 | 3300031911 | Ga0307412_10082604 | Ga0307412_100826042 | 293 |
| 22 | 3300046501 | Ga0495607_0001888 | Ga0495607_0001888_753_1688 | 293 |
| 23 | 3300006058 | Ga0075432_10017820 | Ga0075432_100178201 | 294 |
| 24 | 3300006948 | Ga0099826_10000065 | Ga0099826_1000006522 | 294 |
| 25 | 3300009011 | Ga0105251_10078738 | Ga0105251_100787381 | 294 |
| 26 | 3300025735 | Ga0207713_1056345 | Ga0207713_10563451 | 294 |
| 27 | 3300027666 | Ga0209282_1000057 | Ga0209282_100005763 | 294 |
| 28 | 3300031456 | Ga0307513_10000066 | Ga0307513_10000066119 | 294 |
| 29 | 3300041512 | Ga0451853_2505844 | Ga0451853_2505844_541_1434 | 294 |
| 30 | 3300042010 | Ga0439452_015968 | Ga0439452_015968_938_1828 | 294 |
| 31 | 3300044765 | Ga0466970_0106289 | Ga0466970_0106289_278_1201 | 294 |
| 32 | 3300046474 | Ga0495605_0000624 | Ga0495605_0000624_25049_25939 | 294 |
| 33 | 3300046500 | Ga0495596_0000038 | Ga0495596_0000038_75303_76193 | 294 |
| 34 | 3300046501 | Ga0495607_0015724 | Ga0495607_0015724_2459_3349 | 294 |
| 35 | 3300046507 | Ga0495606_0000208 | Ga0495606_0000208_81432_82334 | 294 |
| 36 | 3300046512 | Ga0495610_0000141 | Ga0495610_0000141_65088_65978 | 294 |
| 37 | 3300046513 | Ga0495616_0001178 | Ga0495616_0001178_12325_13215 | 294 |
| 38 | 3300046538 | Ga0495609_0001032 | Ga0495609_0001032_18635_19525 | 294 |
| 39 | 3300046542 | Ga0495597_0048561 | Ga0495597_0048561_135_1025 | 294 |
| 40 | 3300046665 | Ga0495661_0002776 | Ga0495661_0002776_2478_3368 | 294 |
| 41 | 3300046692 | Ga0495671_0000462 | Ga0495671_0000462_14202_15092 | 294 |
| 42 | 3300046694 | Ga0495649_0025594 | Ga0495649_0025594_2350_3240 | 294 |
| 43 | 3300046810 | Ga0495660_0140419 | Ga0495660_0140419_46_936 | 294 |
| 44 | 3300047320 | Ga0495672_0027483 | Ga0495672_0027483_261_1151 | 294 |
| 45 | 3300048924 | Ga0496121_0004379 | Ga0496121_0004379_7658_8548 | 294 |
| 46 | 3300048924 | Ga0496121_0030981 | Ga0496121_0030981_2410_3327 | 294 |
| 47 | 3300048925 | Ga0496122_0000676 | Ga0496122_0000676_2443_3333 | 294 |
| 48 | 3300048926 | Ga0496123_0008328 | Ga0496123_0008328_1823_2713 | 294 |
| 49 | 3300048928 | Ga0496125_0109544 | Ga0496125_0109544_179_1069 | 294 |
| 50 | 3300049570 | Ga0501033_0223522 | Ga0501033_0223522_98_1045 | 294 |
| 51 | 3300049572 | Ga0501036_0520420 | Ga0501036_0520420_18_965 | 294 |
| 52 | 3300049574 | Ga0501038_0320827 | Ga0501038_0320827_242_1189 | 294 |
| 53 | 3300049575 | Ga0501039_0135826 | Ga0501039_0135826_375_1322 | 294 |
| 54 | 3300049581 | Ga0501047_0009582 | Ga0501047_0009582_7649_8596 | 294 |
| 55 | 3300049822 | Ga0501035_0023999 | Ga0501035_0023999_419_1366 | 294 |
| 56 | 3300049823 | Ga0501044_0013376 | Ga0501044_0013376_7755_8702 | 294 |
| 57 | iso_pu_bacteria | 2834641062 | 2834643728 | 294 |
| 58 | iso_pu_bacteria | 8003400568 | 8003405110 | 294 |
| 59 | 3300042115 | Ga0450911_009592 | Ga0450911_009592_379_1278 | 295 |
| 60 | iso_pu_bacteria | 2511231003 | 2511248642 | 295 |
| 61 | iso_pu_bacteria | 2511231026 | 2511386981 | 295 |
| 62 | iso_pu_bacteria | 2513237150 | 2513957138 | 295 |
| 63 | iso_pu_bacteria | 2513237165 | 2514043300 | 295 |
| 64 | iso_pu_bacteria | 2596583598 | 2597028175 | 295 |
| 65 | iso_pu_bacteria | 2599185178 | 2599444906 | 295 |
| 66 | iso_pu_bacteria | 2643221603 | 2644031592 | 295 |
| 67 | iso_pu_bacteria | 2643221628 | 2644161173 | 295 |
| 68 | iso_pu_bacteria | 2808606386 | 2808984599 | 295 |
| 69 | iso_pu_bacteria | 2808606415 | 2809130856 | 295 |
| 70 | iso_pu_bacteria | 2808606419 | 2809150809 | 295 |
| 71 | iso_pu_bacteria | 2818991445 | 2819593093 | 295 |
| 72 | iso_pu_bacteria | 2842677519 | 2842681411 | 295 |
| 73 | iso_pu_bacteria | 2852618963 | 2852622328 | 295 |
| 74 | iso_pu_bacteria | 2857576091 | 2857579825 | 295 |
| 75 | iso_pu_bacteria | 2885266251 | 2885269775 | 295 |
| 76 | iso_pu_bacteria | 2900577576 | 2900581491 | 295 |
| 77 | iso_pu_bacteria | 2904439833 | 2904441049 | 295 |
| 78 | iso_pu_bacteria | 2904449895 | 2904454202 | 295 |
| 79 | iso_pu_bacteria | 2904456579 | 2904461941 | 295 |
| 80 | iso_pu_bacteria | 2919462493 | 2919465204 | 295 |
| 81 | iso_pu_bacteria | 2928058823 | 2928060048 | 295 |
| 82 | iso_pu_bacteria | 2929520902 | 2929521937 | 295 |
| 83 | iso_pu_bacteria | 2945945610 | 2945949992 | 295 |
| 84 | iso_pu_bacteria | 644736347 | 644750121 | 295 |
| 85 | 3300003578 | Ga0006562J51391_1128109 | Ga0006562J51391_11281091 | 296 |
| 86 | 3300003578 | Ga0006562J51391_1128110 | Ga0006562J51391_11281103 | 296 |
| 87 | 3300003773 | Ga0055537_1000162 | Ga0055537_100016220 | 296 |
| 88 | 3300003784 | Ga0055534_1000128 | Ga0055534_100012826 | 296 |
| 89 | 3300003790 | Ga0055528_1006119 | Ga0055528_10061193 | 296 |
| 90 | 3300005288 | Ga0065714_10074345 | Ga0065714_100743453 | 296 |
| 91 | 3300006038 | Ga0075365_10001542 | Ga0075365_100015425 | 296 |
| 92 | 3300006048 | Ga0075363_100004545 | Ga0075363_1000045454 | 296 |
| 93 | 3300006051 | Ga0075364_10003241 | Ga0075364_100032415 | 296 |
| 94 | 3300006051 | Ga0075364_10082317 | Ga0075364_100823172 | 296 |
| 95 | 3300006058 | Ga0075432_10002170 | Ga0075432_100021704 | 296 |
| 96 | 3300006177 | Ga0075362_10002812 | Ga0075362_100028122 | 296 |
| 97 | 3300006195 | Ga0075366_10002392 | Ga0075366_100023922 | 296 |
| 98 | 3300006353 | Ga0075370_10000759 | Ga0075370_100007599 | 296 |
| 99 | 3300006946 | Ga0079104_1007154 | Ga0079104_10071541 | 296 |
| 100 | 3300006946 | Ga0079104_1016174 | Ga0079104_10161741 | 296 |
| 101 | 3300006946 | Ga0079104_1020222 | Ga0079104_10202222 | 296 |
| 102 | 3300006948 | Ga0099826_10000122 | Ga0099826_100001223 | 296 |
| 103 | 3300009148 | Ga0105243_10017120 | Ga0105243_100171204 | 296 |
| 104 | 3300012502 | Ga0157347_1000228 | Ga0157347_10002282 | 296 |
| 105 | 3300013100 | Ga0157373_10003146 | Ga0157373_100031463 | 296 |
| 106 | 3300013104 | Ga0157370_10001308 | Ga0157370_1000130836 | 296 |
| 107 | 3300017792 | Ga0163161_10000079 | Ga0163161_1000007947 | 296 |
| 108 | 3300017792 | Ga0163161_10001508 | Ga0163161_100015089 | 296 |
| 109 | 3300025258 | Ga0209129_1001384 | Ga0209129_10013848 | 296 |
| 110 | 3300025263 | Ga0209565_1000229 | Ga0209565_100022927 | 296 |
| 111 | 3300025263 | Ga0209565_1021622 | Ga0209565_10216221 | 296 |
| 112 | 3300025273 | Ga0209673_1000463 | Ga0209673_100046335 | 296 |
| 113 | 3300025273 | Ga0209673_1009344 | Ga0209673_10093445 | 296 |
| 114 | 3300025273 | Ga0209673_1041756 | Ga0209673_10417561 | 296 |
| 115 | 3300025291 | Ga0209675_1000186 | Ga0209675_100018635 | 296 |
| 116 | 3300025292 | Ga0209676_1011313 | Ga0209676_10113133 | 296 |
| 117 | 3300025294 | Ga0209025_1000230 | Ga0209025_100023056 | 296 |
| 118 | 3300025295 | Ga0209564_1012912 | Ga0209564_10129122 | 296 |
| 119 | 3300025303 | Ga0209051_1000673 | Ga0209051_100067325 | 296 |
| 120 | 3300025935 | Ga0207709_10004910 | Ga0207709_100049103 | 296 |
| 121 | 3300027666 | Ga0209282_1005596 | Ga0209282_10055964 | 296 |
| 122 | 3300027907 | Ga0207428_10087053 | Ga0207428_100870532 | 296 |
| 123 | 3300030732 | Ga0316176_1085576 | Ga0316176_10855764 | 296 |
| 124 | 3300030733 | Ga0314311_1207443 | Ga0314311_12074431 | 296 |
| 125 | 3300030734 | Ga0316179_1087651 | Ga0316179_10876513 | 296 |
| 126 | 3300030735 | Ga0316178_1008722 | Ga0316178_10087223 | 296 |
| 127 | 3300030736 | Ga0316180_1108197 | Ga0316180_11081972 | 296 |
| 128 | 3300030742 | Ga0316183_1023144 | Ga0316183_10231444 | 296 |
| 129 | 3300030744 | Ga0316181_1207329 | Ga0316181_12073292 | 296 |
| 130 | 3300030745 | Ga0316182_1238298 | Ga0316182_12382982 | 296 |
| 131 | 3300031548 | Ga0307408_100011351 | Ga0307408_1000113513 | 296 |
| 132 | 3300031548 | Ga0307408_100319387 | Ga0307408_1003193872 | 296 |
| 133 | 3300031731 | Ga0307405_10039858 | Ga0307405_100398583 | 296 |
| 134 | 3300031852 | Ga0307410_10294198 | Ga0307410_102941981 | 296 |
| 135 | 3300031901 | Ga0307406_10000129 | Ga0307406_100001292 | 296 |
| 136 | 3300031901 | Ga0307406_10146839 | Ga0307406_101468392 | 296 |
| 137 | 3300031903 | Ga0307407_10270863 | Ga0307407_102708631 | 296 |
| 138 | 3300031911 | Ga0307412_10009245 | Ga0307412_100092452 | 296 |
| 139 | 3300031911 | Ga0307412_10030907 | Ga0307412_100309073 | 296 |
| 140 | 3300031911 | Ga0307412_10044875 | Ga0307412_100448753 | 296 |
| 141 | 3300031911 | Ga0307412_10271310 | Ga0307412_102713101 | 296 |
| 142 | 3300031911 | Ga0307412_10359337 | Ga0307412_103593371 | 296 |
| 143 | 3300032004 | Ga0307414_10022669 | Ga0307414_100226695 | 296 |
| 144 | 3300032004 | Ga0307414_10036835 | Ga0307414_100368351 | 296 |
| 145 | 3300032005 | Ga0307411_10011599 | Ga0307411_100115993 | 296 |
| 146 | 3300032005 | Ga0307411_10198056 | Ga0307411_101980562 | 296 |
| 147 | 3300032005 | Ga0307411_10198191 | Ga0307411_101981912 | 296 |
| 148 | 3300041404 | Ga0439436_0006267 | Ga0439436_0006267_1543_2451 | 296 |
| 149 | 3300041411 | Ga0439466_0001839 | Ga0439466_0001839_6539_7447 | 296 |
| 150 | 3300041413 | Ga0439465_0008377 | Ga0439465_0008377_2260_3168 | 296 |
| 151 | 3300041997 | Ga0439431_0002506 | Ga0439431_0002506_2447_3355 | 296 |
| 152 | 3300042002 | Ga0439442_000356 | Ga0439442_000356_3344_4252 | 296 |
| 153 | 3300042115 | Ga0450911_004615 | Ga0450911_004615_755_1663 | 296 |
| 154 | 3300042123 | Ga0450921_000059 | Ga0450921_000059_394_1302 | 296 |
| 155 | 3300042124 | Ga0450922_003756 | Ga0450922_003756_41_949 | 296 |
| 156 | 3300042125 | Ga0450923_000356 | Ga0450923_000356_3833_4741 | 296 |
| 157 | 3300042145 | Ga0450906_000114 | Ga0450906_000114_6467_7375 | 296 |
| 158 | 3300042147 | Ga0450910_001770 | Ga0450910_001770_1707_2615 | 296 |
| 159 | 3300042184 | Ga0450908_000411 | Ga0450908_000411_5093_6001 | 296 |
| 160 | 3300042185 | Ga0450909_003251 | Ga0450909_003251_67_975 | 296 |
| 161 | 3300042435 | Ga0439434_0002977 | Ga0439434_0002977_3198_4106 | 296 |
| 162 | 3300042531 | Ga0450918_001238 | Ga0450918_001238_178_1086 | 296 |
| 163 | 3300046453 | Ga0495627_002599 | Ga0495627_002599_3928_4872 | 296 |
| 164 | 3300046515 | Ga0495620_0013152 | Ga0495620_0013152_886_1830 | 296 |
| 165 | 3300046520 | Ga0495637_0002203 | Ga0495637_0002203_8711_9622 | 296 |
| 166 | 3300046523 | Ga0495644_0062315 | Ga0495644_0062315_429_1328 | 296 |
| 167 | 3300046660 | Ga0495625_0000437 | Ga0495625_0000437_19556_20464 | 296 |
| 168 | 3300046665 | Ga0495661_0010954 | Ga0495661_0010954_680_1615 | 296 |
| 169 | 3300046665 | Ga0495661_0205662 | Ga0495661_0205662_17_961 | 296 |
| 170 | 3300046674 | Ga0495588_0077793 | Ga0495588_0077793_744_1688 | 296 |
| 171 | 3300046691 | Ga0495670_0010557 | Ga0495670_0010557_1567_2466 | 296 |
| 172 | 3300046691 | Ga0495670_0156453 | Ga0495670_0156453_17_928 | 296 |
| 173 | 3300046692 | Ga0495671_0016868 | Ga0495671_0016868_1456_2400 | 296 |
| 174 | 3300046810 | Ga0495660_0088014 | Ga0495660_0088014_128_1039 | 296 |
| 175 | 3300047317 | Ga0495604_0012483 | Ga0495604_0012483_4971_5867 | 296 |
| 176 | 3300047320 | Ga0495672_0108818 | Ga0495672_0108818_533_1432 | 296 |
| 177 | 3300049759 | Ga0501262_000044 | Ga0501262_000044_1443_2351 | 296 |
| 178 | 3300050490 | nmdc:mga03n38_17203_c1 | nmdc:mga03n38_17203_c1_1347_2255 | 296 |
| 179 | 3300050490 | nmdc:mga03n38_5412_c1 | nmdc:mga03n38_5412_c1_1133_2041 | 296 |
| 180 | 3300050492 | nmdc:mga0yw44_473_c1 | nmdc:mga0yw44_473_c1_12488_13396 | 296 |
| 181 | 3300050493 | nmdc:mga0k408_2986_c1 | nmdc:mga0k408_2986_c1_7169_8077 | 296 |
| 182 | 3300050493 | nmdc:mga0k408_54798_c1 | nmdc:mga0k408_54798_c1_929_1930 | 296 |
| 183 | 3300053079 | Ga0500610_0000115 | Ga0500610_0000115_14042_14986 | 296 |
| 184 | 3300053079 | Ga0500610_0000411 | Ga0500610_0000411_9284_10195 | 296 |
| 185 | 3300053117 | Ga0500593_000089 | Ga0500593_000089_26929_27873 | 296 |
| 186 | 3300053121 | Ga0500607_000146 | Ga0500607_000146_11371_12366 | 296 |
| 187 | 3300053158 | Ga0500627_0002112 | Ga0500627_0002112_3635_4630 | 296 |
| 188 | iso_pu_bacteria | 2511231002 | 2511242475 | 296 |
| 189 | iso_pu_bacteria | 2643221683 | 2644465181 | 296 |
| 190 | iso_pu_bacteria | 2885192300 | 2885197401 | 296 |
| 191 | iso_pu_bacteria | 2945909444 | 2945911182 | 296 |
| 192 | iso_pu_bacteria | 2945972063 | 2945973999 | 296 |
| 193 | iso_pu_bacteria | 2945984333 | 2945986524 | 296 |
| 194 | iso_pu_bacteria | 2954767861 | 2954770419 | 296 |
| 195 | 3300001979 | JGI24740J21852_10001192 | JGI24740J21852_100011928 | 297 |
| 196 | 3300002704 | JGI25155J39150_1000357 | JGI25155J39150_10003578 | 297 |
| 197 | 3300002705 | JGI25156J39149_1000398 | JGI25156J39149_100039822 | 297 |
| 198 | 3300002738 | JGI25154J39366_1000241 | JGI25154J39366_10002417 | 297 |
| 199 | 3300002738 | JGI25154J39366_1000349 | JGI25154J39366_100034922 | 297 |
| 200 | 3300002738 | JGI25154J39366_1000405 | JGI25154J39366_10004055 | 297 |
| 201 | 3300002738 | JGI25154J39366_1001245 | JGI25154J39366_10012457 | 297 |
| 202 | 3300002741 | JGI25157J39369_1000105 | JGI25157J39369_100010538 | 297 |
| 203 | 3300002987 | JGI25159J45721_1017845 | JGI25159J45721_10178452 | 297 |
| 204 | 3300003756 | Ga0055533_1002112 | Ga0055533_10021125 | 297 |
| 205 | 3300003758 | Ga0055532_1000051 | Ga0055532_100005145 | 297 |
| 206 | 3300003771 | Ga0055526_1002868 | Ga0055526_10028686 | 297 |
| 207 | 3300003773 | Ga0055537_1000006 | Ga0055537_10000064 | 297 |
| 208 | 3300003773 | Ga0055537_1000445 | Ga0055537_100044518 | 297 |
| 209 | 3300003773 | Ga0055537_1004001 | Ga0055537_10040014 | 297 |
| 210 | 3300003775 | Ga0055524_1000032 | Ga0055524_1000032140 | 297 |
| 211 | 3300003784 | Ga0055534_1003814 | Ga0055534_10038144 | 297 |
| 212 | 3300003790 | Ga0055528_1000504 | Ga0055528_100050431 | 297 |
| 213 | 3300003791 | Ga0055530_10003406 | Ga0055530_100034063 | 297 |
| 214 | 3300003792 | Ga0055540_1000046 | Ga0055540_1000046105 | 297 |
| 215 | 3300003792 | Ga0055540_1004807 | Ga0055540_10048074 | 297 |
| 216 | 3300003794 | Ga0055531_10002570 | Ga0055531_100025704 | 297 |
| 217 | 3300003794 | Ga0055531_10014498 | Ga0055531_100144982 | 297 |
| 218 | 3300003841 | Ga0055541_1000303 | Ga0055541_10003036 | 297 |
| 219 | 3300005262 | Ga0065165_1007662 | Ga0065165_10076624 | 297 |
| 220 | 3300005539 | Ga0068853_100341405 | Ga0068853_1003414052 | 297 |
| 221 | 3300005563 | Ga0068855_100504858 | Ga0068855_1005048581 | 297 |
| 222 | 3300006051 | Ga0075364_10029645 | Ga0075364_100296453 | 297 |
| 223 | 3300009093 | Ga0105240_10113980 | Ga0105240_101139803 | 297 |
| 224 | 3300014497 | Ga0182008_10113687 | Ga0182008_101136871 | 297 |
| 225 | 3300025206 | Ga0209435_100028 | Ga0209435_10002893 | 297 |
| 226 | 3300025206 | Ga0209435_100037 | Ga0209435_10003774 | 297 |
| 227 | 3300025224 | Ga0209784_100525 | Ga0209784_10052510 | 297 |
| 228 | 3300025225 | Ga0209566_100129 | Ga0209566_10012928 | 297 |
| 229 | 3300025226 | Ga0209674_100305 | Ga0209674_10030510 | 297 |
| 230 | 3300025229 | Ga0209147_100004 | Ga0209147_100004300 | 297 |
| 231 | 3300025230 | Ga0209563_102266 | Ga0209563_1022663 | 297 |
| 232 | 3300025233 | Ga0209437_100053 | Ga0209437_100053353 | 297 |
| 233 | 3300025242 | Ga0209258_100398 | Ga0209258_10039819 | 297 |
| 234 | 3300025246 | Ga0209646_1000021 | Ga0209646_1000021227 | 297 |
| 235 | 3300025246 | Ga0209646_1000063 | Ga0209646_100006356 | 297 |
| 236 | 3300025246 | Ga0209646_1000095 | Ga0209646_100009593 | 297 |
| 237 | 3300025250 | Ga0209026_1000110 | Ga0209026_100011093 | 297 |
| 238 | 3300025250 | Ga0209026_1007165 | Ga0209026_10071653 | 297 |
| 239 | 3300025254 | Ga0209148_1000019 | Ga0209148_1000019596 | 297 |
| 240 | 3300025256 | Ga0209759_1000080 | Ga0209759_100008039 | 297 |
| 241 | 3300025256 | Ga0209759_1000115 | Ga0209759_100011593 | 297 |
| 242 | 3300025256 | Ga0209759_1000155 | Ga0209759_100015510 | 297 |
| 243 | 3300025256 | Ga0209759_1007204 | Ga0209759_10072042 | 297 |
| 244 | 3300025263 | Ga0209565_1000016 | Ga0209565_1000016140 | 297 |
| 245 | 3300025263 | Ga0209565_1000336 | Ga0209565_100033643 | 297 |
| 246 | 3300025263 | Ga0209565_1014648 | Ga0209565_10146482 | 297 |
| 247 | 3300025272 | Ga0209455_1007520 | Ga0209455_10075202 | 297 |
| 248 | 3300025273 | Ga0209673_1000073 | Ga0209673_1000073138 | 297 |
| 249 | 3300025284 | Ga0209130_1000210 | Ga0209130_100021063 | 297 |
| 250 | 3300025291 | Ga0209675_1000080 | Ga0209675_100008051 | 297 |
| 251 | 3300025291 | Ga0209675_1002302 | Ga0209675_10023027 | 297 |
| 252 | 3300025292 | Ga0209676_1000165 | Ga0209676_100016564 | 297 |
| 253 | 3300025295 | Ga0209564_1000165 | Ga0209564_100016529 | 297 |
| 254 | 3300025297 | Ga0209758_1042251 | Ga0209758_10422512 | 297 |
| 255 | 3300025298 | Ga0209050_1000084 | Ga0209050_1000084190 | 297 |
| 256 | 3300025299 | Ga0209256_1000110 | Ga0209256_1000110138 | 297 |
| 257 | 3300025299 | Ga0209256_1032242 | Ga0209256_10322421 | 297 |
| 258 | 3300025302 | Ga0207426_1002104 | Ga0207426_10021048 | 297 |
| 259 | 3300025303 | Ga0209051_1000058 | Ga0209051_1000058190 | 297 |
| 260 | 3300025303 | Ga0209051_1001488 | Ga0209051_10014882 | 297 |
| 261 | 3300025304 | Ga0209257_1000022 | Ga0209257_100002281 | 297 |
| 262 | 3300025304 | Ga0209257_1000092 | Ga0209257_1000092190 | 297 |
| 263 | 3300025913 | Ga0207695_10015134 | Ga0207695_100151347 | 297 |
| 264 | 3300026041 | Ga0207639_10180756 | Ga0207639_101807562 | 297 |
| 265 | 3300031548 | Ga0307408_100019360 | Ga0307408_1000193605 | 297 |
| 266 | 3300031731 | Ga0307405_10053765 | Ga0307405_100537652 | 297 |
| 267 | 3300031901 | Ga0307406_10007196 | Ga0307406_100071967 | 297 |
| 268 | 3300032005 | Ga0307411_10157031 | Ga0307411_101570312 | 297 |
| 269 | 3300041404 | Ga0439436_0015800 | Ga0439436_0015800_79_990 | 297 |
| 270 | 3300041405 | Ga0439438_040191 | Ga0439438_040191_39_950 | 297 |
| 271 | 3300041407 | Ga0439447_012885 | Ga0439447_012885_1004_1915 | 297 |
| 272 | 3300041411 | Ga0439466_0003263 | Ga0439466_0003263_2223_3134 | 297 |
| 273 | 3300041411 | Ga0439466_0022118 | Ga0439466_0022118_308_1219 | 297 |
| 274 | 3300041413 | Ga0439465_0002729 | Ga0439465_0002729_3884_4795 | 297 |
| 275 | 3300041997 | Ga0439431_0000602 | Ga0439431_0000602_2053_2964 | 297 |
| 276 | 3300042002 | Ga0439442_007780 | Ga0439442_007780_919_1830 | 297 |
| 277 | 3300042006 | Ga0439432_002354 | Ga0439432_002354_4151_5062 | 297 |
| 278 | 3300042007 | Ga0439449_0040381 | Ga0439449_0040381_200_1111 | 297 |
| 279 | 3300042010 | Ga0439452_001694 | Ga0439452_001694_4368_5279 | 297 |
| 280 | 3300042015 | Ga0439462_0005665 | Ga0439462_0005665_2081_2992 | 297 |
| 281 | 3300042015 | Ga0439462_0008376 | Ga0439462_0008376_423_1334 | 297 |
| 282 | 3300042134 | Ga0450898_006207 | Ga0450898_006207_427_1338 | 297 |
| 283 | 3300042156 | Ga0439446_0001003 | Ga0439446_0001003_4276_5187 | 297 |
| 284 | 3300042156 | Ga0439446_0003242 | Ga0439446_0003242_941_1852 | 297 |
| 285 | 3300042435 | Ga0439434_0006263 | Ga0439434_0006263_1853_2764 | 297 |
| 286 | 3300048924 | Ga0496121_0053672 | Ga0496121_0053672_1012_1917 | 297 |
| 287 | 3300050489 | nmdc:mga03683_1355_c1 | nmdc:mga03683_1355_c1_2806_3717 | 297 |
| 288 | 3300050491 | nmdc:mga00v17_131904_c1 | nmdc:mga00v17_131904_c1_546_1448 | 297 |
| 289 | 3300050493 | nmdc:mga0k408_79253_c1 | nmdc:mga0k408_79253_c1_815_1726 | 297 |
| 290 | 3300053125 | Ga0500618_019575 | Ga0500618_019575_603_1538 | 297 |
| 291 | iso_pu_bacteria | 2818991436 | 2819543300 | 297 |
| 292 | iso_pu_bacteria | 2842733646 | 2842734948 | 297 |
| 293 | iso_pu_bacteria | 2842747753 | 2842748027 | 297 |
| 294 | iso_pu_bacteria | 2844533157 | 2844538386 | 297 |
| 295 | 3300001979 | JGI24740J21852_10043788 | JGI24740J21852_100437882 | 298 |
| 296 | 3300002739 | JGI25158J39367_1001439 | JGI25158J39367_10014392 | 298 |
| 297 | 3300002773 | JGI25152J39213_1014378 | JGI25152J39213_10143782 | 298 |
| 298 | 3300002774 | JGI25150J39212_1000679 | JGI25150J39212_100067915 | 298 |
| 299 | 3300002774 | JGI25150J39212_1003302 | JGI25150J39212_10033021 | 298 |
| 300 | 3300002987 | JGI25159J45721_1005058 | JGI25159J45721_10050582 | 298 |
| 301 | 3300002987 | JGI25159J45721_1006953 | JGI25159J45721_10069532 | 298 |
| 302 | 3300003187 | JGI25151J46595_10000412 | JGI25151J46595_1000041230 | 298 |
| 303 | 3300003187 | JGI25151J46595_10001901 | JGI25151J46595_100019019 | 298 |
| 304 | 3300003215 | JGI25153J46596_10010430 | JGI25153J46596_100104302 | 298 |
| 305 | 3300003215 | JGI25153J46596_10021547 | JGI25153J46596_100215472 | 298 |
| 306 | 3300003322 | rootL2_10070966 | rootL2_100709662 | 298 |
| 307 | 3300003322 | rootL2_10112703 | rootL2_101127032 | 298 |
| 308 | 3300003354 | JGI25160J50197_1007660 | JGI25160J50197_10076602 | 298 |
| 309 | 3300003354 | JGI25160J50197_1014814 | JGI25160J50197_10148142 | 298 |
| 310 | 3300003578 | Ga0006562J51391_1047816 | Ga0006562J51391_10478162 | 298 |
| 311 | 3300003578 | Ga0006562J51391_1047817 | Ga0006562J51391_10478172 | 298 |
| 312 | 3300003761 | Ga0055535_1000274 | Ga0055535_100027414 | 298 |
| 313 | 3300003762 | Ga0055542_1000027 | Ga0055542_1000027226 | 298 |
| 314 | 3300003771 | Ga0055526_1007438 | Ga0055526_10074385 | 298 |
| 315 | 3300003771 | Ga0055526_1009818 | Ga0055526_10098183 | 298 |
| 316 | 3300003771 | Ga0055526_1010720 | Ga0055526_10107202 | 298 |
| 317 | 3300003771 | Ga0055526_1010795 | Ga0055526_10107952 | 298 |
| 318 | 3300003773 | Ga0055537_1002317 | Ga0055537_10023177 | 298 |
| 319 | 3300003773 | Ga0055537_1003980 | Ga0055537_10039803 | 298 |
| 320 | 3300003773 | Ga0055537_1004177 | Ga0055537_10041772 | 298 |
| 321 | 3300003775 | Ga0055524_1000690 | Ga0055524_100069012 | 298 |
| 322 | 3300003775 | Ga0055524_1008604 | Ga0055524_10086042 | 298 |
| 323 | 3300003775 | Ga0055524_1008676 | Ga0055524_10086762 | 298 |
| 324 | 3300003775 | Ga0055524_1038591 | Ga0055524_10385911 | 298 |
| 325 | 3300003781 | Ga0055536_1000163 | Ga0055536_10001635 | 298 |
| 326 | 3300003781 | Ga0055536_1003187 | Ga0055536_10031874 | 298 |
| 327 | 3300003781 | Ga0055536_1016958 | Ga0055536_10169582 | 298 |
| 328 | 3300003784 | Ga0055534_1001699 | Ga0055534_10016999 | 298 |
| 329 | 3300003784 | Ga0055534_1004269 | Ga0055534_10042692 | 298 |
| 330 | 3300003784 | Ga0055534_1005845 | Ga0055534_10058452 | 298 |
| 331 | 3300003790 | Ga0055528_1009033 | Ga0055528_10090332 | 298 |
| 332 | 3300003790 | Ga0055528_1012244 | Ga0055528_10122443 | 298 |
| 333 | 3300003791 | Ga0055530_10000328 | Ga0055530_1000032811 | 298 |
| 334 | 3300003791 | Ga0055530_10000866 | Ga0055530_1000086619 | 298 |
| 335 | 3300003791 | Ga0055530_10014544 | Ga0055530_100145442 | 298 |
| 336 | 3300003792 | Ga0055540_1000813 | Ga0055540_100081310 | 298 |
| 337 | 3300003792 | Ga0055540_1007252 | Ga0055540_10072522 | 298 |
| 338 | 3300003794 | Ga0055531_10000428 | Ga0055531_1000042827 | 298 |
| 339 | 3300003794 | Ga0055531_10011137 | Ga0055531_100111372 | 298 |
| 340 | 3300003794 | Ga0055531_10034955 | Ga0055531_100349551 | 298 |
| 341 | 3300004625 | Ga0055543_1003838 | Ga0055543_10038384 | 298 |
| 342 | 3300004625 | Ga0055543_1003866 | Ga0055543_10038664 | 298 |
| 343 | 3300005262 | Ga0065165_1009778 | Ga0065165_10097784 | 298 |
| 344 | 3300005353 | Ga0070669_100087562 | Ga0070669_1000875622 | 298 |
| 345 | 3300005364 | Ga0070673_100445481 | Ga0070673_1004454811 | 298 |
| 346 | 3300005539 | Ga0068853_100005678 | Ga0068853_1000056785 | 298 |
| 347 | 3300005563 | Ga0068855_100510097 | Ga0068855_1005100971 | 298 |
| 348 | 3300006177 | Ga0075362_10095521 | Ga0075362_100955212 | 298 |
| 349 | 3300006195 | Ga0075366_10016252 | Ga0075366_100162522 | 298 |
| 350 | 3300006353 | Ga0075370_10047873 | Ga0075370_100478732 | 298 |
| 351 | 3300009093 | Ga0105240_10264636 | Ga0105240_102646362 | 298 |
| 352 | 3300009093 | Ga0105240_10281036 | Ga0105240_102810362 | 298 |
| 353 | 3300010375 | Ga0105239_10402938 | Ga0105239_104029382 | 298 |
| 354 | 3300013104 | Ga0157370_10224212 | Ga0157370_102242122 | 298 |
| 355 | 3300013105 | Ga0157369_10007328 | Ga0157369_100073285 | 298 |
| 356 | 3300014497 | Ga0182008_10001266 | Ga0182008_100012667 | 298 |
| 357 | 3300015683 | Ga0183362_10001 | Ga0183362_10001755 | 298 |
| 358 | 3300017792 | Ga0163161_10020413 | Ga0163161_100204134 | 298 |
| 359 | 3300017792 | Ga0163161_10087750 | Ga0163161_100877502 | 298 |
| 360 | 3300025208 | Ga0209436_102723 | Ga0209436_1027235 | 298 |
| 361 | 3300025228 | Ga0209672_104679 | Ga0209672_1046792 | 298 |
| 362 | 3300025229 | Ga0209147_100940 | Ga0209147_10094015 | 298 |
| 363 | 3300025242 | Ga0209258_100048 | Ga0209258_100048149 | 298 |
| 364 | 3300025245 | Ga0207425_1000107 | Ga0207425_100010726 | 298 |
| 365 | 3300025254 | Ga0209148_1000040 | Ga0209148_1000040149 | 298 |
| 366 | 3300025258 | Ga0209129_1000007 | Ga0209129_100000793 | 298 |
| 367 | 3300025258 | Ga0209129_1007676 | Ga0209129_10076762 | 298 |
| 368 | 3300025263 | Ga0209565_1000178 | Ga0209565_100017839 | 298 |
| 369 | 3300025263 | Ga0209565_1000196 | Ga0209565_100019618 | 298 |
| 370 | 3300025263 | Ga0209565_1001871 | Ga0209565_10018713 | 298 |
| 371 | 3300025273 | Ga0209673_1000764 | Ga0209673_100076422 | 298 |
| 372 | 3300025273 | Ga0209673_1000884 | Ga0209673_10008844 | 298 |
| 373 | 3300025284 | Ga0209130_1000580 | Ga0209130_100058016 | 298 |
| 374 | 3300025284 | Ga0209130_1001148 | Ga0209130_100114819 | 298 |
| 375 | 3300025291 | Ga0209675_1000092 | Ga0209675_100009279 | 298 |
| 376 | 3300025291 | Ga0209675_1000361 | Ga0209675_10003614 | 298 |
| 377 | 3300025291 | Ga0209675_1001704 | Ga0209675_10017045 | 298 |
| 378 | 3300025291 | Ga0209675_1003136 | Ga0209675_10031364 | 298 |
| 379 | 3300025291 | Ga0209675_1017016 | Ga0209675_10170162 | 298 |
| 380 | 3300025292 | Ga0209676_1000004 | Ga0209676_1000004838 | 298 |
| 381 | 3300025292 | Ga0209676_1000172 | Ga0209676_100017294 | 298 |
| 382 | 3300025292 | Ga0209676_1000480 | Ga0209676_100048054 | 298 |
| 383 | 3300025292 | Ga0209676_1008977 | Ga0209676_10089772 | 298 |
| 384 | 3300025294 | Ga0209025_1000222 | Ga0209025_100022252 | 298 |
| 385 | 3300025294 | Ga0209025_1000278 | Ga0209025_100027872 | 298 |
| 386 | 3300025294 | Ga0209025_1000628 | Ga0209025_10006285 | 298 |
| 387 | 3300025294 | Ga0209025_1005386 | Ga0209025_10053864 | 298 |
| 388 | 3300025294 | Ga0209025_1011879 | Ga0209025_10118796 | 298 |
| 389 | 3300025295 | Ga0209564_1000200 | Ga0209564_100020093 | 298 |
| 390 | 3300025295 | Ga0209564_1000318 | Ga0209564_100031839 | 298 |
| 391 | 3300025295 | Ga0209564_1000489 | Ga0209564_10004895 | 298 |
| 392 | 3300025295 | Ga0209564_1000582 | Ga0209564_100058221 | 298 |
| 393 | 3300025295 | Ga0209564_1002074 | Ga0209564_10020747 | 298 |
| 394 | 3300025297 | Ga0209758_1000025 | Ga0209758_1000025433 | 298 |
| 395 | 3300025297 | Ga0209758_1012494 | Ga0209758_10124942 | 298 |
| 396 | 3300025298 | Ga0209050_1000002 | Ga0209050_10000021348 | 298 |
| 397 | 3300025298 | Ga0209050_1000565 | Ga0209050_100056526 | 298 |
| 398 | 3300025299 | Ga0209256_1000067 | Ga0209256_1000067106 | 298 |
| 399 | 3300025299 | Ga0209256_1000198 | Ga0209256_1000198115 | 298 |
| 400 | 3300025299 | Ga0209256_1000335 | Ga0209256_100033566 | 298 |
| 401 | 3300025299 | Ga0209256_1000362 | Ga0209256_100036229 | 298 |
| 402 | 3300025302 | Ga0207426_1000001 | Ga0207426_1000001145 | 298 |
| 403 | 3300025302 | Ga0207426_1000178 | Ga0207426_100017821 | 298 |
| 404 | 3300025302 | Ga0207426_1000264 | Ga0207426_100026418 | 298 |
| 405 | 3300025303 | Ga0209051_1000002 | Ga0209051_10000021118 | 298 |
| 406 | 3300025303 | Ga0209051_1000096 | Ga0209051_100009667 | 298 |
| 407 | 3300025303 | Ga0209051_1000278 | Ga0209051_100027828 | 298 |
| 408 | 3300025303 | Ga0209051_1010611 | Ga0209051_10106114 | 298 |
| 409 | 3300025303 | Ga0209051_1022601 | Ga0209051_10226012 | 298 |
| 410 | 3300025304 | Ga0209257_1000002 | Ga0209257_10000021259 | 298 |
| 411 | 3300025304 | Ga0209257_1000072 | Ga0209257_1000072258 | 298 |
| 412 | 3300025304 | Ga0209257_1011137 | Ga0209257_10111372 | 298 |
| 413 | 3300025914 | Ga0207671_10159153 | Ga0207671_101591532 | 298 |
| 414 | 3300025923 | Ga0207681_10110578 | Ga0207681_101105782 | 298 |
| 415 | 3300025940 | Ga0207691_10304944 | Ga0207691_103049442 | 298 |
| 416 | 3300025949 | Ga0207667_10527763 | Ga0207667_105277631 | 298 |
| 417 | 3300026118 | Ga0207675_100214544 | Ga0207675_1002145442 | 298 |
| 418 | 3300028379 | Ga0268266_10167691 | Ga0268266_101676912 | 298 |
| 419 | 3300042006 | Ga0439432_036936 | Ga0439432_036936_81_995 | 298 |
| 420 | 3300042007 | Ga0439449_0001161 | Ga0439449_0001161_1992_2906 | 298 |
| 421 | 3300046453 | Ga0495627_009896 | Ga0495627_009896_1878_2795 | 298 |
| 422 | 3300046460 | Ga0495638_0038579 | Ga0495638_0038579_1865_2881 | 298 |
| 423 | 3300046513 | Ga0495616_0004666 | Ga0495616_0004666_7476_8492 | 298 |
| 424 | 3300046515 | Ga0495620_0070522 | Ga0495620_0070522_45_965 | 298 |
| 425 | 3300046518 | Ga0495631_0000021 | Ga0495631_0000021_31139_32155 | 298 |
| 426 | 3300046530 | Ga0495654_0021664 | Ga0495654_0021664_1669_2685 | 298 |
| 427 | 3300046615 | Ga0495656_0000141 | Ga0495656_0000141_9166_10080 | 298 |
| 428 | 3300046660 | Ga0495625_0043430 | Ga0495625_0043430_2168_3184 | 298 |
| 429 | 3300046683 | Ga0495658_0002746 | Ga0495658_0002746_3764_4780 | 298 |
| 430 | 3300047321 | Ga0495676_0010916 | Ga0495676_0010916_5089_6105 | 298 |
| 431 | 3300047673 | Ga0495593_0002373 | Ga0495593_0002373_4606_5622 | 298 |
| 432 | 3300048089 | Ga0495614_0004046 | Ga0495614_0004046_5563_6579 | 298 |
| 433 | 3300048904 | Ga0496101_0005734 | Ga0496101_0005734_3939_4856 | 298 |
| 434 | 3300048907 | Ga0496104_0271876 | Ga0496104_0271876_334_1257 | 298 |
| 435 | 3300048920 | Ga0496117_0007805 | Ga0496117_0007805_6453_7493 | 298 |
| 436 | 3300048921 | Ga0496118_0002845 | Ga0496118_0002845_15875_16792 | 298 |
| 437 | 3300048924 | Ga0496121_0234345 | Ga0496121_0234345_10_1026 | 298 |
| 438 | 3300048925 | Ga0496122_0000238 | Ga0496122_0000238_904_1818 | 298 |
| 439 | 3300048925 | Ga0496122_0041484 | Ga0496122_0041484_97_1113 | 298 |
| 440 | 3300048925 | Ga0496122_0059464 | Ga0496122_0059464_37_954 | 298 |
| 441 | 3300048926 | Ga0496123_0000262 | Ga0496123_0000262_14818_15732 | 298 |
| 442 | 3300048926 | Ga0496123_0023727 | Ga0496123_0023727_91_1008 | 298 |
| 443 | 3300048927 | Ga0496124_0141563 | Ga0496124_0141563_263_1180 | 298 |
| 444 | 3300048928 | Ga0496125_0012129 | Ga0496125_0012129_4754_5671 | 298 |
| 445 | 3300050496 | nmdc:mga07m45_41256_c1 | nmdc:mga07m45_41256_c1_868_1782 | 298 |
| 446 | 3300053093 | Ga0500651_0000360 | Ga0500651_0000360_13665_14681 | 298 |
| 447 | 3300053094 | Ga0500566_0003903 | Ga0500566_0003903_5822_6838 | 298 |
| 448 | 3300053110 | Ga0500571_000052 | Ga0500571_000052_11236_12252 | 298 |
| 449 | 3300053118 | Ga0500594_0008611 | Ga0500594_0008611_585_1601 | 298 |
| 450 | 3300053118 | Ga0500594_0014392 | Ga0500594_0014392_203_1117 | 298 |
| 451 | 3300053120 | Ga0500597_016713 | Ga0500597_016713_925_1941 | 298 |
| 452 | 3300053122 | Ga0500608_002675 | Ga0500608_002675_4403_5320 | 298 |
| 453 | 3300053128 | Ga0500626_004619 | Ga0500626_004619_560_1576 | 298 |
| 454 | 3300053133 | Ga0500655_008403 | Ga0500655_008403_236_1252 | 298 |
| 455 | 3300053134 | Ga0500658_0000052 | Ga0500658_0000052_47194_48210 | 298 |
| 456 | 3300053134 | Ga0500658_0000503 | Ga0500658_0000503_8743_9759 | 298 |
| 457 | 3300053138 | Ga0500564_019948 | Ga0500564_019948_454_1470 | 298 |
| 458 | 3300053139 | Ga0500568_0001382 | Ga0500568_0001382_3416_4432 | 298 |
| 459 | 3300053140 | Ga0500573_0047021 | Ga0500573_0047021_352_1266 | 298 |
| 460 | 3300053141 | Ga0500574_000444 | Ga0500574_000444_3790_4806 | 298 |
| 461 | 3300053153 | Ga0500616_0013412 | Ga0500616_0013412_385_1302 | 298 |
| 462 | 3300053161 | Ga0500634_0019577 | Ga0500634_0019577_956_1972 | 298 |
| 463 | 3300053177 | Ga0500636_0052460 | Ga0500636_0052460_1113_2129 | 298 |
| 464 | iso_pu_bacteria | 2513020051 | 2513231952 | 298 |
| 465 | iso_pu_bacteria | 2599185214 | 2599624898 | 298 |
| 466 | iso_pu_bacteria | 2599185226 | 2599672910 | 298 |
| 467 | iso_pu_bacteria | 2599185227 | 2599682640 | 298 |
| 468 | iso_pu_bacteria | 2599185229 | 2599694519 | 298 |
| 469 | iso_pu_bacteria | 2643221658 | 2644329210 | 298 |
| 470 | iso_pu_bacteria | 2643221672 | 2644401692 | 298 |
| 471 | iso_pu_bacteria | 2738541277 | 2738717363 | 298 |
| 472 | iso_pu_bacteria | 2738541307 | 2738878956 | 298 |
| 473 | iso_pu_bacteria | 2738543013 | 2739250101 | 298 |
| 474 | iso_pu_bacteria | 2738543019 | 2739278049 | 298 |
| 475 | iso_pu_bacteria | 2818991446 | 2819596827 | 298 |
| 476 | iso_pu_bacteria | 2831265667 | 2831265949 | 298 |
| 477 | iso_pu_bacteria | 2838054893 | 2838060858 | 298 |
| 478 | iso_pu_bacteria | 2885198086 | 2885203596 | 298 |
| 479 | iso_pu_bacteria | 2885211737 | 2885217054 | 298 |
| 480 | iso_pu_bacteria | 2899924645 | 2899930387 | 298 |
| 481 | iso_pu_bacteria | 2928037797 | 2928039500 | 298 |
| 482 | iso_pu_bacteria | 2928044640 | 2928044895 | 298 |
| 483 | iso_pu_bacteria | 2928051484 | 2928052696 | 298 |
| 484 | iso_pu_bacteria | 2928064002 | 2928064643 | 298 |
| 485 | iso_pu_bacteria | 2928070936 | 2928074940 | 298 |
| 486 | iso_pu_bacteria | 2928084124 | 2928089077 | 298 |
| 487 | 3300001915 | JGI24741J21665_1000174 | JGI24741J21665_10001747 | 299 |
| 488 | 3300001979 | JGI24740J21852_10000852 | JGI24740J21852_1000085210 | 299 |
| 489 | 3300001979 | JGI24740J21852_10004237 | JGI24740J21852_100042376 | 299 |
| 490 | 3300002737 | JGI25162J39368_1000026 | JGI25162J39368_100002666 | 299 |
| 491 | 3300002737 | JGI25162J39368_1000027 | JGI25162J39368_1000027106 | 299 |
| 492 | 3300003214 | JGI25165J46597_1000031 | JGI25165J46597_1000031180 | 299 |
| 493 | 3300003578 | Ga0006562J51391_1126290 | Ga0006562J51391_11262901 | 299 |
| 494 | 3300003578 | Ga0006562J51391_1126291 | Ga0006562J51391_11262912 | 299 |
| 495 | 3300003751 | Ga0055538_1000018 | Ga0055538_1000018180 | 299 |
| 496 | 3300003751 | Ga0055538_1003595 | Ga0055538_10035952 | 299 |
| 497 | 3300003752 | Ga0055539_1000023 | Ga0055539_1000023180 | 299 |
| 498 | 3300003752 | Ga0055539_1000053 | Ga0055539_1000053109 | 299 |
| 499 | 3300003756 | Ga0055533_1000031 | Ga0055533_1000031114 | 299 |
| 500 | 3300003758 | Ga0055532_1000033 | Ga0055532_1000033150 | 299 |
| 501 | 3300003759 | Ga0055525_1000039 | Ga0055525_1000039180 | 299 |
| 502 | 3300003759 | Ga0055525_1000440 | Ga0055525_100044014 | 299 |
| 503 | 3300003759 | Ga0055525_1000621 | Ga0055525_100062111 | 299 |
| 504 | 3300003761 | Ga0055535_1000024 | Ga0055535_1000024150 | 299 |
| 505 | 3300003763 | Ga0055529_1000044 | Ga0055529_1000044150 | 299 |
| 506 | 3300003841 | Ga0055541_1000016 | Ga0055541_1000016180 | 299 |
| 507 | 3300005327 | Ga0070658_10134468 | Ga0070658_101344682 | 299 |
| 508 | 3300005339 | Ga0070660_100007159 | Ga0070660_1000071594 | 299 |
| 509 | 3300005344 | Ga0070661_100000021 | Ga0070661_10000002135 | 299 |
| 510 | 3300005366 | Ga0070659_100000839 | Ga0070659_10000083910 | 299 |
| 511 | 3300005455 | Ga0070663_100000004 | Ga0070663_10000000444 | 299 |
| 512 | 3300005530 | Ga0070679_100094032 | Ga0070679_1000940322 | 299 |
| 513 | 3300005563 | Ga0068855_100120233 | Ga0068855_1001202332 | 299 |
| 514 | 3300005564 | Ga0070664_100000007 | Ga0070664_10000000744 | 299 |
| 515 | 3300005577 | Ga0068857_100016420 | Ga0068857_1000164205 | 299 |
| 516 | 3300005578 | Ga0068854_100000045 | Ga0068854_1000000457 | 299 |
| 517 | 3300005614 | Ga0068856_100000004 | Ga0068856_10000000429 | 299 |
| 518 | 3300005614 | Ga0068856_100236266 | Ga0068856_1002362662 | 299 |
| 519 | 3300009093 | Ga0105240_10014225 | Ga0105240_100142255 | 299 |
| 520 | 3300013100 | Ga0157373_10037094 | Ga0157373_100370944 | 299 |
| 521 | 3300013102 | Ga0157371_10000001 | Ga0157371_10000001433 | 299 |
| 522 | 3300013102 | Ga0157371_10000028 | Ga0157371_10000028183 | 299 |
| 523 | 3300013104 | Ga0157370_10000002 | Ga0157370_1000000240 | 299 |
| 524 | 3300013105 | Ga0157369_10002517 | Ga0157369_1000251718 | 299 |
| 525 | 3300013307 | Ga0157372_10000619 | Ga0157372_1000061925 | 299 |
| 526 | 3300014497 | Ga0182008_10026396 | Ga0182008_100263963 | 299 |
| 527 | 3300015261 | Ga0182006_1008186 | Ga0182006_10081865 | 299 |
| 528 | 3300015262 | Ga0182007_10004904 | Ga0182007_100049044 | 299 |
| 529 | 3300015265 | Ga0182005_1000252 | Ga0182005_100025235 | 299 |
| 530 | 3300017792 | Ga0163161_10176756 | Ga0163161_101767562 | 299 |
| 531 | 3300020077 | Ga0206351_10260248 | Ga0206351_102602482 | 299 |
| 532 | 3300025207 | Ga0209760_101921 | Ga0209760_1019212 | 299 |
| 533 | 3300025224 | Ga0209784_100024 | Ga0209784_10002435 | 299 |
| 534 | 3300025224 | Ga0209784_100027 | Ga0209784_100027180 | 299 |
| 535 | 3300025224 | Ga0209784_101405 | Ga0209784_1014052 | 299 |
| 536 | 3300025225 | Ga0209566_100018 | Ga0209566_10001835 | 299 |
| 537 | 3300025225 | Ga0209566_100027 | Ga0209566_100027180 | 299 |
| 538 | 3300025226 | Ga0209674_100044 | Ga0209674_100044180 | 299 |
| 539 | 3300025226 | Ga0209674_100225 | Ga0209674_1002259 | 299 |
| 540 | 3300025226 | Ga0209674_100775 | Ga0209674_1007759 | 299 |
| 541 | 3300025228 | Ga0209672_100068 | Ga0209672_10006883 | 299 |
| 542 | 3300025229 | Ga0209147_100008 | Ga0209147_100008336 | 299 |
| 543 | 3300025230 | Ga0209563_100039 | Ga0209563_100039328 | 299 |
| 544 | 3300025230 | Ga0209563_100048 | Ga0209563_100048180 | 299 |
| 545 | 3300025231 | Ga0207427_100616 | Ga0207427_10061610 | 299 |
| 546 | 3300025233 | Ga0209437_100055 | Ga0209437_100055180 | 299 |
| 547 | 3300025242 | Ga0209258_100013 | Ga0209258_100013336 | 299 |
| 548 | 3300025253 | Ga0209677_100024 | Ga0209677_100024326 | 299 |
| 549 | 3300025253 | Ga0209677_100028 | Ga0209677_100028180 | 299 |
| 550 | 3300025254 | Ga0209148_1004104 | Ga0209148_10041043 | 299 |
| 551 | 3300025256 | Ga0209759_1001910 | Ga0209759_10019107 | 299 |
| 552 | 3300025261 | Ga0209233_1000070 | Ga0209233_1000070180 | 299 |
| 553 | 3300025272 | Ga0209455_1000042 | Ga0209455_1000042336 | 299 |
| 554 | 3300025294 | Ga0209025_1000125 | Ga0209025_100012568 | 299 |
| 555 | 3300025303 | Ga0209051_1015557 | Ga0209051_10155574 | 299 |
| 556 | 3300025909 | Ga0207705_10124608 | Ga0207705_101246082 | 299 |
| 557 | 3300025913 | Ga0207695_10001071 | Ga0207695_1000107128 | 299 |
| 558 | 3300025913 | Ga0207695_10181958 | Ga0207695_101819582 | 299 |
| 559 | 3300025919 | Ga0207657_10051639 | Ga0207657_100516394 | 299 |
| 560 | 3300025920 | Ga0207649_10000030 | Ga0207649_10000030155 | 299 |
| 561 | 3300025921 | Ga0207652_10105578 | Ga0207652_101055782 | 299 |
| 562 | 3300025932 | Ga0207690_10001459 | Ga0207690_1000145912 | 299 |
| 563 | 3300025945 | Ga0207679_10000004 | Ga0207679_10000004228 | 299 |
| 564 | 3300025949 | Ga0207667_10166753 | Ga0207667_101667532 | 299 |
| 565 | 3300025981 | Ga0207640_10000155 | Ga0207640_100001555 | 299 |
| 566 | 3300026067 | Ga0207678_10000005 | Ga0207678_1000000544 | 299 |
| 567 | 3300026078 | Ga0207702_10000342 | Ga0207702_1000034221 | 299 |
| 568 | 3300026078 | Ga0207702_10573670 | Ga0207702_105736702 | 299 |
| 569 | 3300026142 | Ga0207698_10154674 | Ga0207698_101546742 | 299 |
| 570 | 3300031251 | Ga0265327_10003596 | Ga0265327_100035962 | 299 |
| 571 | 3300037418 | Ga0395900_0089947 | Ga0395900_0089947_465_1364 | 299 |
| 572 | 3300037471 | Ga0395905_0001326 | Ga0395905_0001326_2028_2951 | 299 |
| 573 | 3300037471 | Ga0395905_0213441 | Ga0395905_0213441_423_1322 | 299 |
| 574 | 3300044650 | Ga0466986_0022780 | Ga0466986_0022780_1806_2705 | 299 |
| 575 | 3300044658 | Ga0466972_0005748 | Ga0466972_0005748_4207_5106 | 299 |
| 576 | 3300044672 | Ga0466982_0004071 | Ga0466982_0004071_4313_5212 | 299 |
| 577 | 3300044683 | Ga0466965_0007706 | Ga0466965_0007706_4010_4909 | 299 |
| 578 | 3300044684 | Ga0466966_0117721 | Ga0466966_0117721_247_1146 | 299 |
| 579 | 3300044693 | Ga0466961_0000194 | Ga0466961_0000194_32338_33237 | 299 |
| 580 | 3300044719 | Ga0466971_0012336 | Ga0466971_0012336_1614_2513 | 299 |
| 581 | 3300044765 | Ga0466970_0002743 | Ga0466970_0002743_5829_6728 | 299 |
| 582 | 3300044842 | Ga0466957_0018736 | Ga0466957_0018736_2186_3085 | 299 |
| 583 | 3300044842 | Ga0466957_0176994 | Ga0466957_0176994_14_934 | 299 |
| 584 | 3300045049 | Ga0466959_0000928 | Ga0466959_0000928_15170_16069 | 299 |
| 585 | 3300045976 | Ga0466967_0026078 | Ga0466967_0026078_2406_3305 | 299 |
| 586 | 3300046454 | Ga0495592_0025069 | Ga0495592_0025069_1014_1937 | 299 |
| 587 | 3300046460 | Ga0495638_0025738 | Ga0495638_0025738_752_1720 | 299 |
| 588 | 3300046463 | Ga0495653_0013213 | Ga0495653_0013213_2477_3400 | 299 |
| 589 | 3300046471 | Ga0495650_0000015 | Ga0495650_0000015_526244_527284 | 299 |
| 590 | 3300046501 | Ga0495607_0000048 | Ga0495607_0000048_106935_107843 | 299 |
| 591 | 3300046506 | Ga0495583_0002011 | Ga0495583_0002011_11876_12865 | 299 |
| 592 | 3300046507 | Ga0495606_0002379 | Ga0495606_0002379_9054_9965 | 299 |
| 593 | 3300046511 | Ga0495608_0015415 | Ga0495608_0015415_633_1556 | 299 |
| 594 | 3300046512 | Ga0495610_0051727 | Ga0495610_0051727_187_1098 | 299 |
| 595 | 3300046513 | Ga0495616_0001459 | Ga0495616_0001459_13470_14411 | 299 |
| 596 | 3300046514 | Ga0495618_0045013 | Ga0495618_0045013_633_1556 | 299 |
| 597 | 3300046516 | Ga0495628_0000827 | Ga0495628_0000827_5694_6617 | 299 |
| 598 | 3300046519 | Ga0495632_0001125 | Ga0495632_0001125_16072_17007 | 299 |
| 599 | 3300046520 | Ga0495637_0021191 | Ga0495637_0021191_806_1738 | 299 |
| 600 | 3300046522 | Ga0495643_0000328 | Ga0495643_0000328_27159_28100 | 299 |
| 601 | 3300046528 | Ga0495642_0050011 | Ga0495642_0050011_214_1161 | 299 |
| 602 | 3300046528 | Ga0495642_0065219 | Ga0495642_0065219_21_962 | 299 |
| 603 | 3300046529 | Ga0495652_0034890 | Ga0495652_0034890_240_1163 | 299 |
| 604 | 3300046529 | Ga0495652_0119845 | Ga0495652_0119845_342_1265 | 299 |
| 605 | 3300046542 | Ga0495597_0016789 | Ga0495597_0016789_1229_2176 | 299 |
| 606 | 3300046543 | Ga0495645_0054893 | Ga0495645_0054893_1369_2292 | 299 |
| 607 | 3300046557 | Ga0495622_0066605 | Ga0495622_0066605_405_1328 | 299 |
| 608 | 3300046558 | Ga0495633_0015227 | Ga0495633_0015227_1235_2146 | 299 |
| 609 | 3300046616 | Ga0495668_0015172 | Ga0495668_0015172_3081_4028 | 299 |
| 610 | 3300046665 | Ga0495661_0017305 | Ga0495661_0017305_852_1799 | 299 |
| 611 | 3300046678 | Ga0495599_0007322 | Ga0495599_0007322_2402_3325 | 299 |
| 612 | 3300046680 | Ga0495646_0001482 | Ga0495646_0001482_8181_9104 | 299 |
| 613 | 3300046680 | Ga0495646_0003380 | Ga0495646_0003380_817_1740 | 299 |
| 614 | 3300046690 | Ga0495624_0014709 | Ga0495624_0014709_3837_4760 | 299 |
| 615 | 3300046809 | Ga0495600_0018956 | Ga0495600_0018956_1263_2186 | 299 |
| 616 | 3300047317 | Ga0495604_0037846 | Ga0495604_0037846_899_1822 | 299 |
| 617 | 3300047318 | Ga0495636_0004786 | Ga0495636_0004786_1318_2223 | 299 |
| 618 | 3300047443 | Ga0495687_014410 | Ga0495687_014410_1590_2555 | 299 |
| 619 | 3300047443 | Ga0495687_043789 | Ga0495687_043789_836_1783 | 299 |
| 620 | 3300047469 | Ga0495673_0000113 | Ga0495673_0000113_32293_33204 | 299 |
| 621 | 3300048088 | Ga0495602_0046578 | Ga0495602_0046578_618_1541 | 299 |
| 622 | 3300048091 | Ga0495626_0001224 | Ga0495626_0001224_17943_18866 | 299 |
| 623 | 3300048906 | Ga0496103_0016925 | Ga0496103_0016925_2511_3452 | 299 |
| 624 | 3300048914 | Ga0496111_0091360 | Ga0496111_0091360_1042_1983 | 299 |
| 625 | 3300048928 | Ga0496125_0007020 | Ga0496125_0007020_1574_2473 | 299 |
| 626 | 3300049571 | Ga0501034_0000022 | Ga0501034_0000022_103531_104436 | 299 |
| 627 | 3300049823 | Ga0501044_0027489 | Ga0501044_0027489_2910_3854 | 299 |
| 628 | 3300053088 | Ga0500644_0073158 | Ga0500644_0073158_52_1029 | 299 |
| 629 | 3300053119 | Ga0500595_020459 | Ga0500595_020459_543_1466 | 299 |
| 630 | 3300053125 | Ga0500618_001381 | Ga0500618_001381_9632_10549 | 299 |
| 631 | 3300053136 | Ga0500559_0148289 | Ga0500559_0148289_149_1060 | 299 |
| 632 | 3300053141 | Ga0500574_010160 | Ga0500574_010160_270_1193 | 299 |
| 633 | 3300053145 | Ga0500586_000131 | Ga0500586_000131_7748_8659 | 299 |
| 634 | 3300053154 | Ga0500619_022509 | Ga0500619_022509_412_1335 | 299 |
| 635 | 3300061719 | Ga0466962_0009891 | Ga0466962_0009891_678_1577 | 299 |
| 636 | iso_pu_bacteria | 2808606418 | 2809143063 | 299 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3clo-assembly1.cif.gz_B | crystal structure of putative transcriptional regulator containing a luxr dna binding domain (np_811094.1) from bacteroides thetaiotaomicron vpi-5482 at 2.04 a resolution | 0.9163 | 3 | 47 |
| 7x1k-assembly1.cif.gz_B | crystal structure of the flagellar expression regulator degu from listeria monocytogenes | 0.9156 | 2 | 47 |
| 4ihs-assembly3.cif.gz_C | crystal structure of benm_dbd/catb site 1 dna complex | 0.9148 | 3 | 88 |
| 4ihs-assembly1.cif.gz_A | crystal structure of benm_dbd/catb site 1 dna complex | 0.9143 | 3 | 88 |
| 1fse-assembly2.cif.gz_C | crystal structure of the bacillus subtilis regulatory protein gere | 0.9119 | 3 | 47 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P52696_4_93_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9843 | 4 | 87 | 1.10.10.10 |
| af_P77171_5_91_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9672 | 2 | 82 | 1.10.10.10 |
| af_P37641_3_87_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9626 | 4 | 80 | 1.10.10.10 |
| af_P37682_6_92_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9623 | 3 | 87 | 1.10.10.10 |
| af_Q2FVT4_1_85_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.957 | 3 | 86 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A658JMP9-F1-model_v4 | deleted | 0.9495 | 3 | 80 |
|
| AF-A0A1Q5IPR2-F1-model_v4 | Transcriptional regulator | 0.9469 | 3 | 88 |
GO:0000976
GO:0003700 |
| AF-A0A3C1Y027-F1-model_v4 | LysR family transcriptional regulator | 0.9464 | 3 | 87 |
GO:0003700
GO:0005829 |
| AF-E8UYI9-F1-model_v4 | Regulatory protein LysR | 0.9457 | 1 | 73 |
GO:0003700
|
| AF-A0A7X6IIS4-F1-model_v4 | deleted | 0.9448 | 3 | 80 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar