F471213

General Info

Members Datasets Scaffolds Average Seq Length
634 510 325 327

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_94427_c1|nmdc:mga0yw44_94427_c1_468_1625
Length 385
Sequence MLFQKVKIPREFCFGPCQIAWSGRGSTLLADVECLPENRAGGRRVTEKNNRQGVDHMKRIVLGLLAATAMVLPAFAADVQPAILYDLGGKFDKSFNEAAYHGAEKFKTETGTAYVEFEVSNASQREQALRRFAEDGRNPIVMAGFAWEDALKVVAKEYPDLNFAIIDDAVDLPNVRSLVFKENEGSYLVGIMAAMASKTKKVSFIGGMDIPLIRKFECGYVGGAKSAGATDVIQNMTGDTPAAWNDPAKGGEIAKTQIDQGSDVVYAAAGGTGVGVLQAAADAGKLGIGVDSNQNGLQPGKVLTSMLKRVDVAVYTAFMDGKNGTFKGGLQNLGLKEGGVDYAMDDNNKALVTDEMKAAVEKAKADIIAGKIEVHDYTADNACPY

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
8 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
9 2512875024 Mesorhizobium loti R88b Isolate Nodule
10 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
11 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
12 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
13 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
14 2516143018 Ensifer sp. BR816 Isolate Nodule
15 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
16 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
17 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
18 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
19 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
20 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
21 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
22 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
23 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
24 2643221585 Pelomonas sp. Root662 Isolate Unclassified
25 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
26 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
27 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
28 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
29 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
30 2643221656 Pelomonas sp. Root405 Isolate Unclassified
31 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
32 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
33 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
34 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
35 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
36 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
37 2738541337 Pelomonas sp. BT06 Isolate Unclassified
38 2738543024 Aminobacter sp. AP02 Isolate Unclassified
39 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
40 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
41 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
42 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
43 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
44 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
45 2831864461 Roseateles noduli HZ7 Isolate Nodule
46 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
47 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
48 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
49 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
50 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
51 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
52 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
53 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
54 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
55 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
56 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
57 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
58 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
59 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
60 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
61 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
62 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
63 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
64 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
65 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
66 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
67 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
68 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
69 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
70 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
71 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
72 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
73 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
74 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
75 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
76 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
77 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
78 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
79 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
80 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
81 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
82 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
83 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
84 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
85 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
86 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
87 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
88 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
89 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
90 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
91 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
92 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
93 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
94 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
95 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
96 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
97 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
98 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
99 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
100 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
101 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
102 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
103 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
104 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
105 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
106 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
107 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
108 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
109 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
110 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
111 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
112 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
113 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
114 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
115 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
116 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
117 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
118 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
119 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
120 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
121 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
122 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
123 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
124 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
125 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
126 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
127 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
128 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
129 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
130 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
131 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
132 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
133 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
134 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
135 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
136 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
137 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
138 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
139 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
140 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
141 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
142 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
143 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
144 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
145 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
146 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
147 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
148 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
149 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
150 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
151 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
152 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
153 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
154 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
155 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
156 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
157 2909042592 Labrys sp. LIt4 Isolate Nodule
158 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
159 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
160 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
161 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
162 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
163 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
164 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
165 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
166 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
167 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
168 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
169 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
170 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
171 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
172 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
173 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
174 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
175 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
176 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
177 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
178 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
179 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
180 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
181 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
182 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
183 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
184 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
185 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
186 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
187 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
188 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
189 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
190 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
191 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
192 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
193 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
194 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
195 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
196 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
197 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
198 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
199 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
200 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
201 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
202 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
203 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
204 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
205 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
206 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
207 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
208 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
209 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
210 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
211 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
212 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
213 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
214 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
215 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
216 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
217 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
218 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
219 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
220 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
221 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
222 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
223 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
224 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
225 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
226 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
227 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
228 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
229 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
230 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
231 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
232 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
233 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
234 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
235 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
236 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
237 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
238 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
239 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
240 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
241 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
242 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
243 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
244 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
245 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
246 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
247 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
248 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
249 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
250 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
251 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
252 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
253 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
254 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
255 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
256 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
257 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
258 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
259 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
260 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
261 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
262 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
263 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
264 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
265 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
266 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
267 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
268 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
269 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
270 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
271 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
272 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
273 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
274 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
275 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
276 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
277 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
278 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
279 3004167301 Mesorhizobium loti 582 Isolate Unclassified
280 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
281 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
282 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
283 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
284 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
285 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
286 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
287 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
288 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
289 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
290 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
291 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
292 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
293 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
294 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
295 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
296 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
297 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
298 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
299 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
300 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
301 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
302 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
303 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
304 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
305 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
306 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
307 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
308 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
309 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
310 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
311 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
312 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
313 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
314 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
315 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
316 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
317 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
318 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
319 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
320 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
321 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
322 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
323 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
324 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
325 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
326 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
327 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
328 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
329 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
330 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
331 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
332 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
333 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
334 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
335 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
336 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
337 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
338 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
339 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
340 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
341 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
342 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
343 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
344 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
345 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
346 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
347 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
348 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
349 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
350 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
351 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
352 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
353 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
354 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
355 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
356 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
357 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
358 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
359 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
360 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
361 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
362 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
363 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
364 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
388 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
389 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
392 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
393 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
395 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
396 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
397 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
398 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
399 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
400 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
401 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
402 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
403 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
404 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
405 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
406 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
407 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
408 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
409 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
410 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
411 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
412 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
413 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
414 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
415 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
416 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
417 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
418 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
419 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
420 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
421 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
422 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
423 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
424 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
425 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
426 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
427 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
428 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
429 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
430 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
431 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
432 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
433 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
434 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
435 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
436 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
437 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
438 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
439 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
440 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
441 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
442 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
443 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
444 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
445 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
446 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
447 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
448 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
449 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
452 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
457 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
464 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
465 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
466 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
467 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
468 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
469 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
470 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
471 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
472 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
473 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
474 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
475 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
476 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
477 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
478 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
479 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
480 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
482 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
483 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
484 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
485 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
486 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
487 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
488 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
489 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
490 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
491 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
492 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
493 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
494 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
495 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
496 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
497 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
498 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
499 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
500 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
501 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
502 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
503 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
504 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
505 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
506 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
507 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
508 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
509 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
510 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 50.63
Metatranscriptomes 0.63
Isolates 48.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.68
Nodule 37.54
Rhizoplane 1.74
Rhizosphere 39.43
Stem 0
Stem Tuber 0
Unclassified 12.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10018804 3300001989 Bacteria 2479
2 JGI25157J39369_1004295 3300002741 Bacteria 2633
3 JGI25165J46597_1000042 3300003214 Bacteria 271606
4 rootH1_10070327 3300003316 Bacteria 2854
5 rootL2_10003345 3300003322 Bacteria 38796
6 rootL2_10007895 3300003322 Bacteria 11929
7 rootH1_10024633 3300003323 Bacteria 2839
8 Ga0006562J51391_1027443 3300003578 Bacteria 2660
9 Ga0055525_1000038 3300003759 Bacteria 297540
10 Ga0055542_1000592 3300003762 Bacteria 31197
11 Ga0055526_1006996 3300003771 Bacteria 5983
12 Ga0055540_1020501 3300003792 Bacteria 1746
13 Ga0055531_10000172 3300003794 Bacteria 72762
14 Ga0065165_1000214 3300005262 Bacteria 100283
15 Ga0065165_1001296 3300005262 Bacteria 28110
16 Ga0070658_10242221 3300005327 Bacteria 1529
17 Ga0070676_10192992 3300005328 Bacteria 1331
18 Ga0070682_100023714 3300005337 Bacteria 3645
19 Ga0068868_100047264 3300005338 Bacteria 3372
20 Ga0070671_100072256 3300005355 Bacteria 2881
21 Ga0070674_100089375 3300005356 Bacteria 2219
22 Ga0070674_100231800 3300005356 Bacteria 1441
23 Ga0068853_100006660 3300005539 Bacteria 9199
24 Ga0070665_100095193 3300005548 Bacteria 2982
25 Ga0070665_100110857 3300005548 Bacteria 2746
26 Ga0070665_100385303 3300005548 Bacteria 1409
27 Ga0068856_100303104 3300005614 Bacteria 1615
28 Ga0068856_100377939 3300005614 Bacteria 1436
29 Ga0068864_100020063 3300005618 Bacteria 5590
30 Ga0068861_100229987 3300005719 Bacteria 1572
31 Ga0068863_100084423 3300005841 Bacteria 3009
32 Ga0068860_100295273 3300005843 Bacteria 1586
33 Ga0068862_100029053 3300005844 Bacteria 4657
34 Ga0081455_10201456 3300005937 Bacteria 1490
35 Ga0081540_1057259 3300005983 Bacteria 1886
36 Ga0081539_10001093 3300005985 Bacteria 49316
37 Ga0075365_10024035 3300006038 Bacteria 3839
38 Ga0075365_10102201 3300006038 Bacteria 1964
39 Ga0075365_10140300 3300006038 Bacteria 1677
40 Ga0075364_10170647 3300006051 Bacteria 1470
41 Ga0075362_10048001 3300006177 Bacteria 1903
42 Ga0075362_10130466 3300006177 Bacteria 1195
43 Ga0075367_10034371 3300006178 Bacteria 2928
44 Ga0075369_10038435 3300006186 Bacteria 2041
45 Ga0075366_10003192 3300006195 Bacteria 8596
46 Ga0075366_10012497 3300006195 Bacteria 4815
47 Ga0075366_10016259 3300006195 Bacteria 4275
48 Ga0075366_10032564 3300006195 Bacteria 3068
49 Ga0075366_10032880 3300006195 Bacteria 3054
50 Ga0075366_10090980 3300006195 Bacteria 1828
51 Ga0097621_100301299 3300006237 Bacteria 1416
52 Ga0075370_10014969 3300006353 Bacteria 4145
53 Ga0075370_10015478 3300006353 Bacteria 4085
54 Ga0075370_10104906 3300006353 Bacteria 1638
55 Ga0075428_100128675 3300006844 Bacteria 2755
56 Ga0075433_10161073 3300006852 Bacteria 1997
57 Ga0099823_1002035 3300006944 Bacteria 17811
58 Ga0105240_10033560 3300009093 Bacteria 6627
59 Ga0105240_10119373 3300009093 Bacteria 3176
60 Ga0105240_10162477 3300009093 Bacteria 2651
61 Ga0111539_10004410 3300009094 Bacteria 18395
62 Ga0111539_10142462 3300009094 Bacteria 2806
63 Ga0111539_10382921 3300009094 Bacteria 1638
64 Ga0105245_10161527 3300009098 Bacteria 2126
65 Ga0105245_10656039 3300009098 Bacteria 1080
66 Ga0105243_10074398 3300009148 Bacteria 2755
67 Ga0105242_10137952 3300009176 Bacteria 2113
68 Ga0105248_10202094 3300009177 Bacteria 2239
69 Ga0105237_10007146 3300009545 Bacteria 12269
70 Ga0105237_10084410 3300009545 Bacteria 3166
71 Ga0105238_10121640 3300009551 Bacteria 2590
72 Ga0105249_10225001 3300009553 Bacteria 1848
73 Ga0105239_10026367 3300010375 Bacteria 6396
74 Ga0105239_10171559 3300010375 Bacteria 2426
75 Ga0105239_10394739 3300010375 Bacteria 1565
76 Ga0105246_10236749 3300011119 Bacteria 1441
77 Ga0157319_1000035 3300012497 Bacteria 40594
78 Ga0157370_10082493 3300013104 Bacteria 3024
79 Ga0157374_10197456 3300013296 Bacteria 1969
80 Ga0163162_10415229 3300013306 Bacteria 1478
81 Ga0157380_10084109 3300014326 Bacteria 2608
82 Ga0213872_10000039 3300021361 Bacteria 123507
83 Ga0213872_10000147 3300021361 Bacteria 64440
84 Ga0213872_10000251 3300021361 Bacteria 46656
85 Ga0213876_10026104 3300021384 Bacteria 3081
86 Ga0209563_100005 3300025230 Bacteria 1774893
87 Ga0209563_102197 3300025230 Bacteria 4537
88 Ga0209026_1000029 3300025250 Bacteria 337109
89 Ga0209148_1000069 3300025254 Bacteria 334444
90 Ga0209759_1000637 3300025256 Bacteria 32759
91 Ga0209233_1000028 3300025261 Bacteria 642062
92 Ga0209455_1000219 3300025272 Bacteria 79850
93 Ga0209673_1015054 3300025273 Bacteria 2958
94 Ga0209025_1050940 3300025294 Bacteria 1650
95 Ga0209564_1000003 3300025295 Bacteria 1585848
96 Ga0209758_1026940 3300025297 Bacteria 2472
97 Ga0209050_1001494 3300025298 Bacteria 24797
98 Ga0209050_1005118 3300025298 Bacteria 8426
99 Ga0209256_1000398 3300025299 Bacteria 68796
100 Ga0209256_1002098 3300025299 Bacteria 17414
101 Ga0209051_1024372 3300025303 Bacteria 2490
102 Ga0209257_1000017 3300025304 Bacteria 866287
103 Ga0209257_1008066 3300025304 Bacteria 6130
104 Ga0207697_10080239 3300025315 Bacteria 1374
105 Ga0207647_10006782 3300025904 Bacteria 8310
106 Ga0207645_10124923 3300025907 Bacteria 1672
107 Ga0207695_10158786 3300025913 Bacteria 2194
108 Ga0207671_10009754 3300025914 Bacteria 7992
109 Ga0207671_10218204 3300025914 Bacteria 1494
110 Ga0207663_10169980 3300025916 Bacteria 1547
111 Ga0207657_10085243 3300025919 Bacteria 2646
112 Ga0207694_10038481 3300025924 Bacteria 3677
113 Ga0207700_10352000 3300025928 Bacteria 1283
114 Ga0207709_10099662 3300025935 Bacteria 1918
115 Ga0207669_10060585 3300025937 Bacteria 2321
116 Ga0207711_10313812 3300025941 Bacteria 1448
117 Ga0207667_10073739 3300025949 Bacteria 3546
118 Ga0207712_10208347 3300025961 Bacteria 1555
119 Ga0207677_10144708 3300026023 Bacteria 1825
120 Ga0207639_10071953 3300026041 Bacteria 2706
121 Ga0207678_10036931 3300026067 Bacteria 4253
122 Ga0207678_10056395 3300026067 Bacteria 3381
123 Ga0207702_10260776 3300026078 Bacteria 1632
124 Ga0207702_10374725 3300026078 Bacteria 1367
125 Ga0207641_10024286 3300026088 Bacteria 4996
126 Ga0207648_10219433 3300026089 Bacteria 1690
127 Ga0207676_10062960 3300026095 Bacteria 2944
128 Ga0207674_10123111 3300026116 Bacteria 2559
129 Ga0207675_100326192 3300026118 Bacteria 1500
130 Ga0209389_1016780 3300027296 Bacteria 6626
131 Ga0207428_10004016 3300027907 Bacteria 14120
132 Ga0268266_10031733 3300028379 Bacteria 4488
133 Ga0268266_10042043 3300028379 Bacteria 3902
134 Ga0268266_10353183 3300028379 Bacteria 1382
135 Ga0268265_10022117 3300028380 Bacteria 4463
136 Ga0307515_10000058 3300028794 Bacteria 259680
137 Ga0307515_10000448 3300028794 Bacteria 98768
138 Ga0307515_10004747 3300028794 Bacteria 27845
139 Ga0307515_10055328 3300028794 Bacteria 5801
140 Ga0307515_10148502 3300028794 Bacteria 2466
141 Ga0265338_10001058 3300028800 Bacteria 45770
142 Ga0265760_10042875 3300031090 Bacteria 1352
143 Ga0265332_10000128 3300031238 Bacteria 63543
144 Ga0265339_10014502 3300031249 Bacteria 4748
145 Ga0265331_10010806 3300031250 Bacteria 5024
146 Ga0265327_10000144 3300031251 Bacteria 156779
147 Ga0265316_10049280 3300031344 Bacteria 3319
148 Ga0307513_10229873 3300031456 Bacteria 1668
149 Ga0307408_100000086 3300031548 Bacteria 101944
150 Ga0307408_100015303 3300031548 Bacteria 5108
151 Ga0265313_10041988 3300031595 Bacteria 2249
152 Ga0316576_10213940 3300031727 Bacteria 1450
153 Ga0307516_10006620 3300031730 Bacteria 13542
154 Ga0307412_10196230 3300031911 Bacteria 1530
155 Ga0307412_10215067 3300031911 Bacteria 1470
156 Ga0307414_10348555 3300032004 Bacteria 1270
157 Ga0307411_10004426 3300032005 Bacteria 6726
158 Ga0373950_0007296 3300034818 Bacteria 1712
159 Ga0373959_0016865 3300034820 Bacteria 1358
160 Ga0373940_0009575 3300035088 Bacteria 2255
161 Ga0373939_0000017 3300035114 Bacteria 61924
162 Ga0373931_0000641 3300035691 Bacteria 14534
163 Ga0373931_0100090 3300035691 Bacteria 1629
164 Ga0373927_0000541 3300035695 Bacteria 28706
165 Ga0373925_0000276 3300037068 Bacteria 53582
166 Ga0395900_0202913 3300037418 Bacteria 2005
167 Ga0395900_0582108 3300037418 Bacteria 1061
168 Ga0395898_0087263 3300037466 Bacteria 3006
169 Ga0395898_0089836 3300037466 Bacteria 2956
170 Ga0395905_0000374 3300037471 Bacteria 63889
171 Ga0395905_0000733 3300037471 Bacteria 43190
172 Ga0395905_0003446 3300037471 Bacteria 16922
173 Ga0395905_0052404 3300037471 Bacteria 3819
174 Ga0395901_0119188 3300038443 Bacteria 2773
175 Ga0395901_0140072 3300038443 Bacteria 2542
176 Ga0400483_027468 3300039062 Bacteria 2637
177 Ga0400483_202022 3300039062 Bacteria 2211
178 Ga0400483_233109 3300039062 Bacteria 4363
179 Ga0400483_259287 3300039062 Bacteria 2724
180 Ga0436365_0205756 3300039437 Bacteria 2780
181 Ga0436365_1049200 3300039437 Bacteria 1948
182 Ga0436365_1263409 3300039437 Bacteria 5315
183 Ga0436360_0515915 3300039438 Bacteria 1328
184 Ga0436360_0547977 3300039438 Bacteria 2642
185 Ga0436360_0675949 3300039438 Bacteria 1801
186 Ga0436360_0860095 3300039438 Bacteria 5393
187 Ga0436361_0397141 3300039447 Bacteria 7048
188 Ga0436361_0490539 3300039447 Bacteria 60948
189 Ga0436361_0744848 3300039447 Bacteria 1352
190 Ga0436361_0802941 3300039447 Bacteria 44636
191 Ga0436361_0848343 3300039447 Bacteria 176869
192 Ga0436361_1200524 3300039447 Bacteria 6090
193 Ga0436363_0929338 3300039450 Bacteria 3642
194 Ga0436362_0275278 3300039453 Bacteria 1433
195 Ga0451807_0112059 3300041486 Bacteria 3286
196 Ga0439437_005862 3300042000 Bacteria 1356
197 Ga0450888_000847 3300042126 Bacteria 2913
198 Ga0439459_0000883 3300042438 Bacteria 4197
199 Ga0451577_0015308 3300042876 Bacteria 7136
200 Ga0466972_0027586 3300044658 Bacteria 2808
201 Ga0453683_0105478 3300044673 Unclassified 1770
202 Ga0466963_0103442 3300044694 Bacteria 1951
203 Ga0453684_0006348 3300044712 Bacteria 22539
204 Ga0453684_0029746 3300044712 Bacteria 7742
205 Ga0453684_0058606 3300044712 Bacteria 4973
206 Ga0466960_0026492 3300044901 Bacteria 2634
207 Ga0466960_0099047 3300044901 Bacteria 1498
208 Ga0451576_0000728 3300045051 Bacteria 66112
209 Ga0451576_0000781 3300045051 Bacteria 62611
210 Ga0495638_0019832 3300046460 Bacteria 4446
211 Ga0495638_0036259 3300046460 Bacteria 3142
212 Ga0495638_0106210 3300046460 Bacteria 1673
213 Ga0495643_0099530 3300046522 Bacteria 1491
214 Ga0495648_0086812 3300046524 Bacteria 1764
215 Ga0495654_0000314 3300046530 Bacteria 42570
216 Ga0495683_0121072 3300047323 Bacteria 1241
217 Ga0495687_020920 3300047443 Bacteria 3179
218 Ga0495686_0090426 3300047472 Bacteria 1859
219 Ga0495686_0151800 3300047472 Bacteria 1359
220 Ga0496100_0018744 3300048903 Bacteria 4113
221 Ga0496111_0266062 3300048914 Bacteria 1272
222 Ga0496112_0159883 3300048915 Bacteria 2219
223 Ga0496112_0278259 3300048915 Bacteria 1621
224 Ga0496113_0267308 3300048916 Bacteria 1367
225 Ga0496115_0220672 3300048918 Bacteria 1564
226 Ga0496118_0129046 3300048921 Bacteria 1628
227 Ga0496118_0194452 3300048921 Bacteria 1209
228 Ga0496120_0022308 3300048923 Bacteria 3984
229 Ga0501308_002325 3300049128 Bacteria 1655
230 Ga0501310_003373 3300049130 Bacteria 1558
231 Ga0501300_004505 3300049523 Bacteria 2064
232 Ga0501031_0000024 3300049568 Bacteria 89705
233 Ga0501031_0083815 3300049568 Bacteria 2078
234 Ga0501032_0000007 3300049569 Bacteria 253881
235 Ga0501032_0016721 3300049569 Bacteria 5153
236 Ga0501032_0064754 3300049569 Bacteria 2446
237 Ga0501032_0111122 3300049569 Bacteria 1813
238 Ga0501033_0000051 3300049570 Bacteria 111291
239 Ga0501033_0000260 3300049570 Bacteria 50590
240 Ga0501033_0007216 3300049570 Bacteria 8670
241 Ga0501033_0029108 3300049570 Bacteria 4150
242 Ga0501034_0000029 3300049571 Bacteria 253881
243 Ga0501034_0000139 3300049571 Bacteria 135587
244 Ga0501034_0002910 3300049571 Bacteria 19875
245 Ga0501034_0006986 3300049571 Bacteria 12055
246 Ga0501034_0108345 3300049571 Bacteria 2769
247 Ga0501036_0000004 3300049572 Bacteria 253881
248 Ga0501036_0022455 3300049572 Bacteria 5308
249 Ga0501036_0030980 3300049572 Bacteria 4519
250 Ga0501036_0032163 3300049572 Bacteria 4432
251 Ga0501037_0000004 3300049573 Bacteria 253989
252 Ga0501037_0000870 3300049573 Bacteria 22576
253 Ga0501037_0011087 3300049573 Bacteria 6631
254 Ga0501038_0000005 3300049574 Bacteria 253881
255 Ga0501038_0001781 3300049574 Bacteria 20003
256 Ga0501038_0039109 3300049574 Bacteria 4150
257 Ga0501038_0112099 3300049574 Bacteria 2258
258 Ga0501038_0176200 3300049574 Bacteria 1728
259 Ga0501039_0000009 3300049575 Bacteria 253881
260 Ga0501039_0001074 3300049575 Bacteria 20003
261 Ga0501043_0000113 3300049579 Bacteria 76112
262 Ga0501043_0002269 3300049579 Bacteria 16355
263 Ga0501043_0047375 3300049579 Bacteria 3379
264 Ga0501043_0075926 3300049579 Bacteria 2640
265 Ga0501046_0022094 3300049580 Bacteria 5243
266 Ga0501046_0166090 3300049580 Bacteria 1658
267 Ga0501047_0000487 3300049581 Bacteria 43218
268 Ga0501047_0001923 3300049581 Bacteria 19963
269 Ga0501047_0042584 3300049581 Bacteria 4387
270 Ga0501047_0108570 3300049581 Bacteria 2657
271 Ga0501048_0105424 3300049582 Bacteria 1990
272 Ga0501068_0004616 3300049584 Bacteria 7494
273 Ga0501069_0014211 3300049585 Bacteria 4252
274 Ga0501070_0000822 3300049586 Bacteria 28172
275 Ga0501070_0021060 3300049586 Bacteria 5470
276 Ga0501070_0024199 3300049586 Bacteria 5092
277 Ga0501071_0030542 3300049587 Bacteria 3812
278 Ga0501071_0097852 3300049587 Bacteria 2161
279 Ga0501073_0006747 3300049589 Bacteria 8546
280 Ga0501074_0012168 3300049590 Bacteria 6255
281 Ga0501227_005998 3300049665 Bacteria 2607
282 Ga0501233_015665 3300049668 Bacteria 1564
283 Ga0501235_002002 3300049669 Bacteria 4368
284 Ga0501255_007753 3300049684 Bacteria 1146
285 Ga0501258_000656 3300049687 Bacteria 2468
286 Ga0501221_001003 3300049704 Bacteria 4643
287 Ga0501079_0187998 3300049741 Bacteria 1612
288 Ga0501080_0011970 3300049742 Bacteria 7947
289 Ga0501080_0042871 3300049742 Bacteria 4212
290 Ga0501080_0146800 3300049742 Bacteria 2180
291 Ga0501080_0302169 3300049742 Bacteria 1451
292 Ga0501080_0400393 3300049742 Bacteria 1235
293 Ga0501083_0004298 3300049744 Bacteria 10035
294 Ga0501269_002542 3300049766 Bacteria 2240
295 Ga0501035_0000014 3300049822 Bacteria 253874
296 Ga0501035_0000201 3300049822 Bacteria 72627
297 Ga0501035_0001226 3300049822 Bacteria 26728
298 Ga0501035_0001287 3300049822 Bacteria 25890
299 Ga0501035_0012165 3300049822 Bacteria 7958
300 Ga0501035_0020547 3300049822 Bacteria 6064
301 Ga0501035_0058517 3300049822 Bacteria 3433
302 Ga0501035_0061600 3300049822 Bacteria 3339
303 Ga0501044_0000012 3300049823 Bacteria 253881
304 Ga0501044_0019827 3300049823 Bacteria 7183
305 Ga0501044_0025056 3300049823 Bacteria 6326
306 Ga0501044_0029809 3300049823 Bacteria 5752
307 Ga0501044_0046007 3300049823 Bacteria 4519
308 Ga0501044_0055989 3300049823 Bacteria 4048
309 nmdc:mga00v17_294043_c1 3300050491 Bacteria 1055
310 nmdc:mga0yw44_5658_c1 3300050492 Bacteria 5946
311 nmdc:mga0yw44_94427_c1 3300050492 Bacteria 1896
312 nmdc:mga0k408_18695_c1 3300050493 Bacteria 3871
313 nmdc:mga0k408_7245_c1 3300050493 Bacteria 5928
314 nmdc:mga0k408_9845_c2 3300050493 Bacteria 3435
315 nmdc:mga07m45_13801_c1 3300050496 Bacteria 4292
316 nmdc:mga07m45_38255_c1 3300050496 Bacteria 2677
317 nmdc:mga0qj67_212008_c1 3300050509 Bacteria 1573
318 nmdc:mga08y16_110794_c1 3300050511 Bacteria 2858
319 nmdc:mga08y16_3005_c1 3300050511 Bacteria 17394
320 Ga0500610_0002706 3300053079 Bacteria 6609
321 Ga0500644_0028051 3300053088 Bacteria 1757
322 Ga0500568_0001046 3300053139 Bacteria 18905
323 Ga0500622_0000370 3300053156 Bacteria 43300
324 Ga0500622_0001549 3300053156 Bacteria 18205
325 Ga0500627_0115056 3300053158 Bacteria 1211

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050509 nmdc:mga0qj67_212008_c1 nmdc:mga0qj67_212008_c1_12_845 276
2 3300053156 Ga0500622_0001549 Ga0500622_0001549_11351_12355 288
3 3300049669 Ga0501235_002002 Ga0501235_002002_176_1114 291
4 3300006353 Ga0075370_10015478 Ga0075370_100154783 296
5 3300025299 Ga0209256_1000398 Ga0209256_100039815 296
6 3300042438 Ga0439459_0000883 Ga0439459_0000883_336_1379 296
7 3300050496 nmdc:mga07m45_38255_c1 nmdc:mga07m45_38255_c1_1363_2406 296
8 3300031238 Ga0265332_10000128 Ga0265332_1000012819 301
9 3300003322 rootL2_10003345 rootL2_1000334516 302
10 3300042876 Ga0451577_0015308 Ga0451577_0015308_986_1966 302
11 3300044673 Ga0453683_0105478 Ga0453683_0105478_146_1126 302
12 3300044712 Ga0453684_0029746 Ga0453684_0029746_4402_5382 302
13 3300045051 Ga0451576_0000781 Ga0451576_0000781_32606_33586 302
14 3300039447 Ga0436361_0744848 Ga0436361_0744848_52_1029 303
15 3300003771 Ga0055526_1006996 Ga0055526_10069963 304
16 3300005262 Ga0065165_1001296 Ga0065165_10012966 304
17 3300006195 Ga0075366_10016259 Ga0075366_100162593 304
18 3300009093 Ga0105240_10162477 Ga0105240_101624773 304
19 3300012497 Ga0157319_1000035 Ga0157319_100003519 304
20 3300025295 Ga0209564_1000003 Ga0209564_1000003931 304
21 3300025299 Ga0209256_1002098 Ga0209256_10020987 304
22 3300031548 Ga0307408_100015303 Ga0307408_1000153034 304
23 3300021361 Ga0213872_10000039 Ga0213872_1000003925 305
24 3300039447 Ga0436361_0802941 Ga0436361_0802941_20786_21766 305
25 3300005262 Ga0065165_1000214 Ga0065165_100021435 306
26 3300006195 Ga0075366_10032880 Ga0075366_100328803 308
27 3300050493 nmdc:mga0k408_9845_c2 nmdc:mga0k408_9845_c2_939_1907 308
28 3300028800 Ga0265338_10001058 Ga0265338_100010586 309
29 3300003759 Ga0055525_1000038 Ga0055525_1000038204 311
30 3300025230 Ga0209563_100005 Ga0209563_1000051067 311
31 3300034818 Ga0373950_0007296 Ga0373950_0007296_12_950 311
32 3300035088 Ga0373940_0009575 Ga0373940_0009575_1289_2227 311
33 3300005328 Ga0070676_10192992 Ga0070676_101929921 313
34 3300005985 Ga0081539_10001093 Ga0081539_100010937 313
35 3300006177 Ga0075362_10130466 Ga0075362_101304661 313
36 3300006195 Ga0075366_10090980 Ga0075366_100909803 313
37 3300009098 Ga0105245_10656039 Ga0105245_106560391 313
38 3300009176 Ga0105242_10137952 Ga0105242_101379521 313
39 3300014326 Ga0157380_10084109 Ga0157380_100841092 313
40 3300006844 Ga0075428_100128675 Ga0075428_1001286752 314
41 3300006852 Ga0075433_10161073 Ga0075433_101610732 314
42 3300009094 Ga0111539_10004410 Ga0111539_1000441013 314
43 3300027907 Ga0207428_10004016 Ga0207428_1000401611 314
44 3300028794 Ga0307515_10000058 Ga0307515_10000058114 314
45 3300050511 nmdc:mga08y16_3005_c1 nmdc:mga08y16_3005_c1_13705_14676 314
46 iso_pu_bacteria 2643221544 2643745769 314
47 iso_pu_bacteria 2643221585 2643936841 314
48 iso_pu_bacteria 2643221656 2644318742 314
49 iso_pu_bacteria 2886848708 2886853234 314
50 3300005338 Ga0068868_100047264 Ga0068868_1000472643 315
51 3300005355 Ga0070671_100072256 Ga0070671_1000722561 315
52 3300005548 Ga0070665_100095193 Ga0070665_1000951933 315
53 3300005618 Ga0068864_100020063 Ga0068864_1000200632 315
54 3300005719 Ga0068861_100229987 Ga0068861_1002299872 315
55 3300005841 Ga0068863_100084423 Ga0068863_1000844232 315
56 3300005843 Ga0068860_100295273 Ga0068860_1002952731 315
57 3300005844 Ga0068862_100029053 Ga0068862_1000290533 315
58 3300005937 Ga0081455_10201456 Ga0081455_102014561 315
59 3300006195 Ga0075366_10003192 Ga0075366_100031925 315
60 3300006195 Ga0075366_10012497 Ga0075366_100124974 315
61 3300006237 Ga0097621_100301299 Ga0097621_1003012991 315
62 3300009098 Ga0105245_10161527 Ga0105245_101615272 315
63 3300009148 Ga0105243_10074398 Ga0105243_100743982 315
64 3300009177 Ga0105248_10202094 Ga0105248_102020942 315
65 3300009553 Ga0105249_10225001 Ga0105249_102250012 315
66 3300013296 Ga0157374_10197456 Ga0157374_101974561 315
67 3300013306 Ga0163162_10415229 Ga0163162_104152292 315
68 3300025935 Ga0207709_10099662 Ga0207709_100996622 315
69 3300025961 Ga0207712_10208347 Ga0207712_102083472 315
70 3300026023 Ga0207677_10144708 Ga0207677_101447082 315
71 3300026088 Ga0207641_10024286 Ga0207641_100242866 315
72 3300026095 Ga0207676_10062960 Ga0207676_100629602 315
73 3300026118 Ga0207675_100326192 Ga0207675_1003261922 315
74 3300028379 Ga0268266_10031733 Ga0268266_100317333 315
75 3300028380 Ga0268265_10022117 Ga0268265_100221172 315
76 3300028794 Ga0307515_10004747 Ga0307515_1000474724 315
77 3300031730 Ga0307516_10006620 Ga0307516_100066203 315
78 3300037471 Ga0395905_0052404 Ga0395905_0052404_1710_2678 315
79 3300044712 Ga0453684_0006348 Ga0453684_0006348_10968_11951 315
80 3300046524 Ga0495648_0086812 Ga0495648_0086812_579_1547 315
81 3300048921 Ga0496118_0194452 Ga0496118_0194452_43_1056 315
82 3300050493 nmdc:mga0k408_18695_c1 nmdc:mga0k408_18695_c1_940_1911 315
83 3300050493 nmdc:mga0k408_7245_c1 nmdc:mga0k408_7245_c1_4228_5199 315
84 iso_pu_bacteria 2831864461 2831866635 315
85 3300005327 Ga0070658_10242221 Ga0070658_102422212 316
86 3300005356 Ga0070674_100089375 Ga0070674_1000893752 316
87 3300006038 Ga0075365_10024035 Ga0075365_100240353 316
88 3300025937 Ga0207669_10060585 Ga0207669_100605852 316
89 3300039437 Ga0436365_1263409 Ga0436365_1263409_871_1836 316
90 3300039438 Ga0436360_0547977 Ga0436360_0547977_1627_2628 316
91 3300039438 Ga0436360_0675949 Ga0436360_0675949_743_1744 316
92 3300047443 Ga0495687_020920 Ga0495687_020920_11_961 316
93 3300048916 Ga0496113_0267308 Ga0496113_0267308_384_1334 316
94 iso_pu_bacteria 2643221639 2644221672 316
95 iso_pu_bacteria 3004289098 3004290919 316
96 3300028379 Ga0268266_10353183 Ga0268266_103531831 317
97 3300039447 Ga0436361_0397141 Ga0436361_0397141_2471_3508 317
98 3300003322 rootL2_10007895 rootL2_100078952 318
99 3300003792 Ga0055540_1020501 Ga0055540_10205011 318
100 3300003794 Ga0055531_10000172 Ga0055531_1000017257 318
101 3300005337 Ga0070682_100023714 Ga0070682_1000237142 318
102 3300006195 Ga0075366_10032564 Ga0075366_100325642 318
103 3300006353 Ga0075370_10014969 Ga0075370_100149692 318
104 3300006944 Ga0099823_1002035 Ga0099823_10020355 318
105 3300025273 Ga0209673_1015054 Ga0209673_10150542 318
106 3300025298 Ga0209050_1001494 Ga0209050_100149425 318
107 3300025298 Ga0209050_1005118 Ga0209050_10051183 318
108 3300025303 Ga0209051_1024372 Ga0209051_10243722 318
109 3300025304 Ga0209257_1000017 Ga0209257_1000017512 318
110 3300025304 Ga0209257_1008066 Ga0209257_10080663 318
111 3300027296 Ga0209389_1016780 Ga0209389_10167803 318
112 3300028794 Ga0307515_10148502 Ga0307515_101485022 318
113 3300031249 Ga0265339_10014502 Ga0265339_100145022 318
114 3300031344 Ga0265316_10049280 Ga0265316_100492802 318
115 3300032004 Ga0307414_10348555 Ga0307414_103485551 318
116 3300032005 Ga0307411_10004426 Ga0307411_100044262 318
117 3300034820 Ga0373959_0016865 Ga0373959_0016865_16_990 318
118 3300035114 Ga0373939_0000017 Ga0373939_0000017_8318_9292 318
119 3300035691 Ga0373931_0000641 Ga0373931_0000641_2763_3737 318
120 3300037471 Ga0395905_0000733 Ga0395905_0000733_2031_3005 318
121 3300039437 Ga0436365_1049200 Ga0436365_1049200_523_1545 318
122 3300042000 Ga0439437_005862 Ga0439437_005862_68_1042 318
123 3300042126 Ga0450888_000847 Ga0450888_000847_599_1573 318
124 3300044694 Ga0466963_0103442 Ga0466963_0103442_181_1173 318
125 3300044901 Ga0466960_0099047 Ga0466960_0099047_373_1347 318
126 3300049128 Ga0501308_002325 Ga0501308_002325_426_1400 318
127 3300049130 Ga0501310_003373 Ga0501310_003373_241_1215 318
128 3300049523 Ga0501300_004505 Ga0501300_004505_880_1854 318
129 3300049665 Ga0501227_005998 Ga0501227_005998_397_1374 318
130 3300049668 Ga0501233_015665 Ga0501233_015665_172_1146 318
131 3300049684 Ga0501255_007753 Ga0501255_007753_148_1122 318
132 3300049687 Ga0501258_000656 Ga0501258_000656_614_1588 318
133 3300049704 Ga0501221_001003 Ga0501221_001003_2289_3263 318
134 3300049766 Ga0501269_002542 Ga0501269_002542_153_1127 318
135 3300050496 nmdc:mga07m45_13801_c1 nmdc:mga07m45_13801_c1_1710_2687 318
136 iso_pu_bacteria 2643221646 2644257563 318
137 iso_pu_bacteria 2738541337 2739058549 318
138 3300003316 rootH1_10070327 rootH1_100703272 319
139 3300003323 rootH1_10024633 rootH1_100246332 319
140 3300021384 Ga0213876_10026104 Ga0213876_100261043 319
141 3300028794 Ga0307515_10055328 Ga0307515_100553283 319
142 3300039437 Ga0436365_0205756 Ga0436365_0205756_1197_2207 319
143 iso_pu_bacteria 2840878972 2840884191 319
144 iso_pu_bacteria 2899275550 2899278076 319
145 3300005614 Ga0068856_100377939 Ga0068856_1003779392 320
146 3300009094 Ga0111539_10142462 Ga0111539_101424622 320
147 3300021361 Ga0213872_10000251 Ga0213872_1000025128 320
148 3300026078 Ga0207702_10374725 Ga0207702_103747252 320
149 3300031250 Ga0265331_10010806 Ga0265331_100108063 320
150 3300031251 Ga0265327_10000144 Ga0265327_10000144102 320
151 3300039447 Ga0436361_0490539 Ga0436361_0490539_31539_32576 320
152 3300044712 Ga0453684_0058606 Ga0453684_0058606_941_1957 320
153 3300050511 nmdc:mga08y16_110794_c1 nmdc:mga08y16_110794_c1_611_1660 320
154 3300009094 Ga0111539_10382921 Ga0111539_103829212 321
155 3300021361 Ga0213872_10000147 Ga0213872_1000014710 321
156 3300031548 Ga0307408_100000086 Ga0307408_10000008676 321
157 3300039447 Ga0436361_0848343 Ga0436361_0848343_120673_121662 321
158 iso_pu_bacteria 2713897090 2715499779 321
159 iso_pu_bacteria 2854681122 2854683950 321
160 iso_pu_bacteria 2898795034 2898796637 321
161 iso_pu_bacteria 2899259804 2899262097 321
162 iso_pu_bacteria 2965062239 2965068897 321
163 iso_pu_bacteria 3000405567 3000407812 321
164 iso_pu_bacteria 8057132660 8057136128 321
165 3300039062 Ga0400483_233109 Ga0400483_233109_2391_3377 322
166 3300039453 Ga0436362_0275278 Ga0436362_0275278_122_1120 322
167 3300041486 Ga0451807_0112059 Ga0451807_0112059_1379_2365 322
168 3300010375 Ga0105239_10394739 Ga0105239_103947392 323
169 3300039438 Ga0436360_0860095 Ga0436360_0860095_1051_2034 323
170 3300039062 Ga0400483_202022 Ga0400483_202022_309_1301 324
171 3300039447 Ga0436361_1200524 Ga0436361_1200524_2953_3951 324
172 3300039450 Ga0436363_0929338 Ga0436363_0929338_327_1325 324
173 3300045051 Ga0451576_0000728 Ga0451576_0000728_56765_57757 324
174 3300047472 Ga0495686_0090426 Ga0495686_0090426_201_1175 324
175 iso_pu_bacteria 2894817345 2894817378 324
176 3300031727 Ga0316576_10213940 Ga0316576_102139402 325
177 3300039062 Ga0400483_027468 Ga0400483_027468_670_1665 325
178 3300039062 Ga0400483_259287 Ga0400483_259287_901_1896 325
179 iso_pu_bacteria 2503198000 2503199864 325
180 iso_pu_bacteria 2508501123 2509114662 325
181 iso_pu_bacteria 2508501127 2509142323 325
182 iso_pu_bacteria 2509276018 2509369666 325
183 iso_pu_bacteria 2509276022 2509394779 325
184 iso_pu_bacteria 2510065059 2510318621 325
185 iso_pu_bacteria 2511231027 2511392159 325
186 iso_pu_bacteria 2512875016 2512932681 325
187 iso_pu_bacteria 2512875024 2512960738 325
188 iso_pu_bacteria 2513237090 2513608785 325
189 iso_pu_bacteria 2513237164 2514036509 325
190 iso_pu_bacteria 2513237305 2514420009 325
191 iso_pu_bacteria 2513237351 2514585806 325
192 iso_pu_bacteria 2516143018 2516204871 325
193 iso_pu_bacteria 2558860983 2561469129 325
194 iso_pu_bacteria 2599185301 2599936530 325
195 iso_pu_bacteria 2643221550 2643769908 325
196 iso_pu_bacteria 2643221551 2643776683 325
197 iso_pu_bacteria 2643221555 2643795131 325
198 iso_pu_bacteria 2643221564 2643837710 325
199 iso_pu_bacteria 2643221595 2643987458 325
200 iso_pu_bacteria 2643221623 2644133870 325
201 iso_pu_bacteria 2643221627 2644158022 325
202 iso_pu_bacteria 2687453392 2688597115 325
203 iso_pu_bacteria 2690316117 2692319614 325
204 iso_pu_bacteria 2693429783 2694628818 325
205 iso_pu_bacteria 2693429784 2694637268 325
206 iso_pu_bacteria 2721755686 2723574315 325
207 iso_pu_bacteria 2738543024 2739307795 325
208 iso_pu_bacteria 2756170246 2756671189 325
209 iso_pu_bacteria 2765235802 2765467674 325
210 iso_pu_bacteria 2767802442 2770198492 325
211 iso_pu_bacteria 2775506902 2776269149 325
212 iso_pu_bacteria 2775506904 2776283712 325
213 iso_pu_bacteria 2791355123 2792748131 325
214 iso_pu_bacteria 2837651117 2837651549 325
215 iso_pu_bacteria 2839993093 2839993646 325
216 iso_pu_bacteria 2840764183 2840766700 325
217 iso_pu_bacteria 2841734538 2841738017 325
218 iso_pu_bacteria 2842871566 2842875191 325
219 iso_pu_bacteria 2844002411 2844008817 325
220 iso_pu_bacteria 2844009547 2844012471 325
221 iso_pu_bacteria 2847417321 2847421163 325
222 iso_pu_bacteria 2847670302 2847674918 325
223 iso_pu_bacteria 2847686936 2847691009 325
224 iso_pu_bacteria 2848992105 2848996001 325
225 iso_pu_bacteria 2855872281 2855877716 325
226 iso_pu_bacteria 2856314179 2856320637 325
227 iso_pu_bacteria 2856320880 2856322960 325
228 iso_pu_bacteria 2856328259 2856334735 325
229 iso_pu_bacteria 2856334872 2856339609 325
230 iso_pu_bacteria 2856342000 2856345889 325
231 iso_pu_bacteria 2856349417 2856350709 325
232 iso_pu_bacteria 2856356410 2856361128 325
233 iso_pu_bacteria 2856364286 2856367932 325
234 iso_pu_bacteria 2857349434 2857351944 325
235 iso_pu_bacteria 2857367948 2857372525 325
236 iso_pu_bacteria 2869162929 2869164787 325
237 iso_pu_bacteria 2869242130 2869244887 325
238 iso_pu_bacteria 2869249662 2869252417 325
239 iso_pu_bacteria 2869256925 2869259740 325
240 iso_pu_bacteria 2869264136 2869271097 325
241 iso_pu_bacteria 2869271264 2869276584 325
242 iso_pu_bacteria 2869278585 2869282511 325
243 iso_pu_bacteria 2869285874 2869290449 325
244 iso_pu_bacteria 2871429161 2871432733 325
245 iso_pu_bacteria 2871435913 2871438494 325
246 iso_pu_bacteria 2871444079 2871451426 325
247 iso_pu_bacteria 2871451962 2871452149 325
248 iso_pu_bacteria 2871459585 2871466498 325
249 iso_pu_bacteria 2871466892 2871474293 325
250 iso_pu_bacteria 2871474448 2871477411 325
251 iso_pu_bacteria 2871481445 2871484897 325
252 iso_pu_bacteria 2871488783 2871493342 325
253 iso_pu_bacteria 2871495908 2871499067 325
254 iso_pu_bacteria 2874102143 2874108977 325
255 iso_pu_bacteria 2874116593 2874117148 325
256 iso_pu_bacteria 2874123672 2874126714 325
257 iso_pu_bacteria 2874139085 2874142166 325
258 iso_pu_bacteria 2874146452 2874152700 325
259 iso_pu_bacteria 2874155637 2874160100 325
260 iso_pu_bacteria 2874162495 2874168087 325
261 iso_pu_bacteria 2874168670 2874174918 325
262 iso_pu_bacteria 2876363079 2876365067 325
263 iso_pu_bacteria 2876369609 2876374442 325
264 iso_pu_bacteria 2876386047 2876386753 325
265 iso_pu_bacteria 2876392853 2876397905 325
266 iso_pu_bacteria 2876399893 2876402729 325
267 iso_pu_bacteria 2876413966 2876418616 325
268 iso_pu_bacteria 2876420981 2876427783 325
269 iso_pu_bacteria 2878035449 2878036060 325
270 iso_pu_bacteria 2878738818 2878744648 325
271 iso_pu_bacteria 2878745973 2878750347 325
272 iso_pu_bacteria 2878753008 2878757386 325
273 iso_pu_bacteria 2878760144 2878763266 325
274 iso_pu_bacteria 2878767105 2878770254 325
275 iso_pu_bacteria 2878774303 2878779736 325
276 iso_pu_bacteria 2878781027 2878783967 325
277 iso_pu_bacteria 2878788777 2878790949 325
278 iso_pu_bacteria 2881147464 2881149798 325
279 iso_pu_bacteria 2881155292 2881160944 325
280 iso_pu_bacteria 2881161766 2881166684 325
281 iso_pu_bacteria 2881845957 2881848444 325
282 iso_pu_bacteria 2881853255 2881857236 325
283 iso_pu_bacteria 2881861095 2881863680 325
284 iso_pu_bacteria 2882632389 2882636869 325
285 iso_pu_bacteria 2882912400 2882913067 325
286 iso_pu_bacteria 2885305155 2885308202 325
287 iso_pu_bacteria 2885312484 2885312988 325
288 iso_pu_bacteria 2885318864 2885324533 325
289 iso_pu_bacteria 2885326080 2885332749 325
290 iso_pu_bacteria 2885334103 2885342339 325
291 iso_pu_bacteria 2885342637 2885345590 325
292 iso_pu_bacteria 2885350715 2885353520 325
293 iso_pu_bacteria 2888337043 2888338193 325
294 iso_pu_bacteria 2888343758 2888345775 325
295 iso_pu_bacteria 2888350351 2888355035 325
296 iso_pu_bacteria 2889016732 2889018318 325
297 iso_pu_bacteria 2894652903 2894653376 325
298 iso_pu_bacteria 2903448605 2903450077 325
299 iso_pu_bacteria 2903492973 2903499985 325
300 iso_pu_bacteria 2903492973 2903501114 325
301 iso_pu_bacteria 2903513507 2903521489 325
302 iso_pu_bacteria 2903521522 2903522198 325
303 iso_pu_bacteria 2903528002 2903528576 325
304 iso_pu_bacteria 2903540706 2903543869 325
305 iso_pu_bacteria 2904578770 2904579617 325
306 iso_pu_bacteria 2904659560 2904664556 325
307 iso_pu_bacteria 2906308376 2906312705 325
308 iso_pu_bacteria 2906321335 2906325414 325
309 iso_pu_bacteria 2906328253 2906330798 325
310 iso_pu_bacteria 2906354277 2906362382 325
311 iso_pu_bacteria 2906363423 2906367509 325
312 iso_pu_bacteria 2906370794 2906373665 325
313 iso_pu_bacteria 2906386501 2906387687 325
314 iso_pu_bacteria 2906393657 2906395317 325
315 iso_pu_bacteria 2906401398 2906401466 325
316 iso_pu_bacteria 2906408224 2906411015 325
317 iso_pu_bacteria 2906414383 2906419914 325
318 iso_pu_bacteria 2906427513 2906428093 325
319 iso_pu_bacteria 2909042592 2909042730 325
320 iso_pu_bacteria 2919119836 2919120717 325
321 iso_pu_bacteria 2922130491 2922130619 325
322 iso_pu_bacteria 2922151315 2922157147 325
323 iso_pu_bacteria 2922158528 2922164271 325
324 iso_pu_bacteria 2922172374 2922172866 325
325 iso_pu_bacteria 2922185730 2922189469 325
326 iso_pu_bacteria 2924710171 2924716966 325
327 iso_pu_bacteria 2924718760 2924725488 325
328 iso_pu_bacteria 2924726620 2924726847 325
329 iso_pu_bacteria 2924733363 2924738028 325
330 iso_pu_bacteria 2924741084 2924741960 325
331 iso_pu_bacteria 2924748358 2924754425 325
332 iso_pu_bacteria 2924754689 2924760825 325
333 iso_pu_bacteria 2924762789 2924767067 325
334 iso_pu_bacteria 2924776078 2924782678 325
335 iso_pu_bacteria 2924784321 2924786692 325
336 iso_pu_bacteria 2928521798 2928522418 325
337 iso_pu_bacteria 2937813078 2937819150 325
338 iso_pu_bacteria 2937822353 2937827696 325
339 iso_pu_bacteria 2937836603 2937837322 325
340 iso_pu_bacteria 2937843397 2937843401 325
341 iso_pu_bacteria 2937848649 2937852160 325
342 iso_pu_bacteria 2937861824 2937866570 325
343 iso_pu_bacteria 2937877337 2937881323 325
344 iso_pu_bacteria 2937891427 2937897492 325
345 iso_pu_bacteria 2937972304 2937977414 325
346 iso_pu_bacteria 2937994558 2937997718 325
347 iso_pu_bacteria 2938014810 2938018184 325
348 iso_pu_bacteria 2954011201 2954014160 325
349 iso_pu_bacteria 2958034702 2958039293 325
350 iso_pu_bacteria 2958041894 2958053077 325
351 iso_pu_bacteria 2958064165 2958070489 325
352 iso_pu_bacteria 2958071322 2958073911 325
353 iso_pu_bacteria 2958084443 2958088120 325
354 iso_pu_bacteria 2958092219 2958100075 325
355 iso_pu_bacteria 2958100919 2958107461 325
356 iso_pu_bacteria 2958108152 2958110107 325
357 iso_pu_bacteria 2958115193 2958121078 325
358 iso_pu_bacteria 2958122699 2958127411 325
359 iso_pu_bacteria 2958130278 2958134837 325
360 iso_pu_bacteria 2958144490 2958150175 325
361 iso_pu_bacteria 2958165035 2958168191 325
362 iso_pu_bacteria 2958172287 2958177868 325
363 iso_pu_bacteria 2958179912 2958186383 325
364 iso_pu_bacteria 2961077736 2961084882 325
365 iso_pu_bacteria 2961114664 2961119555 325
366 iso_pu_bacteria 2961127735 2961130879 325
367 iso_pu_bacteria 2961136820 2961140280 325
368 iso_pu_bacteria 2961163497 2961166657 325
369 iso_pu_bacteria 2961170736 2961175285 325
370 iso_pu_bacteria 2961183825 2961186016 325
371 iso_pu_bacteria 2963644680 2963646522 325
372 iso_pu_bacteria 2965018300 2965021480 325
373 iso_pu_bacteria 2965025482 2965027490 325
374 iso_pu_bacteria 2965032056 2965037037 325
375 iso_pu_bacteria 2965040258 2965042167 325
376 iso_pu_bacteria 2965047637 2965049613 325
377 iso_pu_bacteria 2965102966 2965107882 325
378 iso_pu_bacteria 2965110997 2965119376 325
379 iso_pu_bacteria 2965119406 2965123448 325
380 iso_pu_bacteria 2967996073 2967999714 325
381 iso_pu_bacteria 2968003550 2968008072 325
382 iso_pu_bacteria 2968016561 2968020618 325
383 iso_pu_bacteria 2968083720 2968090676 325
384 iso_pu_bacteria 2968091066 2968094656 325
385 iso_pu_bacteria 2968097103 2968098034 325
386 iso_pu_bacteria 2968110612 2968115810 325
387 iso_pu_bacteria 2968117919 2968119174 325
388 iso_pu_bacteria 2968128360 2968133774 325
389 iso_pu_bacteria 2968138860 2968140362 325
390 iso_pu_bacteria 2968171901 2968175062 325
391 iso_pu_bacteria 2970469710 2970473915 325
392 iso_pu_bacteria 2970489779 2970490577 325
393 iso_pu_bacteria 2970503327 2970507873 325
394 iso_pu_bacteria 2970510686 2970514356 325
395 iso_pu_bacteria 2970524798 2970527248 325
396 iso_pu_bacteria 2970532167 2970535914 325
397 iso_pu_bacteria 2970540015 2970541880 325
398 iso_pu_bacteria 2970547951 2970548553 325
399 iso_pu_bacteria 2970554993 2970558111 325
400 iso_pu_bacteria 2970593180 2970597120 325
401 iso_pu_bacteria 2970619444 2970623545 325
402 iso_pu_bacteria 2970627176 2970629288 325
403 iso_pu_bacteria 2977821940 2977826545 325
404 iso_pu_bacteria 2977828996 2977832886 325
405 iso_pu_bacteria 2977843712 2977848493 325
406 iso_pu_bacteria 2977851361 2977856001 325
407 iso_pu_bacteria 2977858184 2977864448 325
408 iso_pu_bacteria 2977864932 2977865058 325
409 iso_pu_bacteria 2977872689 2977880138 325
410 iso_pu_bacteria 2977898635 2977904005 325
411 iso_pu_bacteria 2977907340 2977914384 325
412 iso_pu_bacteria 2977915119 2977916594 325
413 iso_pu_bacteria 2977922695 2977926145 325
414 iso_pu_bacteria 2977935797 2977938060 325
415 iso_pu_bacteria 2977942078 2977944900 325
416 iso_pu_bacteria 2977950692 2977956082 325
417 iso_pu_bacteria 2977957713 2977959560 325
418 iso_pu_bacteria 2977971508 2977976037 325
419 iso_pu_bacteria 2977986579 2977988611 325
420 iso_pu_bacteria 2979710463 2979712570 325
421 iso_pu_bacteria 2979742915 2979751962 325
422 iso_pu_bacteria 2979764755 2979770838 325
423 iso_pu_bacteria 2979772303 2979774446 325
424 iso_pu_bacteria 2979779861 2979786478 325
425 iso_pu_bacteria 2979793036 2979800064 325
426 iso_pu_bacteria 2979808191 2979813057 325
427 iso_pu_bacteria 2987636660 2987639128 325
428 iso_pu_bacteria 2987652177 2987654763 325
429 iso_pu_bacteria 2987659509 2987662669 325
430 iso_pu_bacteria 2987666974 2987671567 325
431 iso_pu_bacteria 2987673487 2987679858 325
432 iso_pu_bacteria 2996310559 2996311888 325
433 iso_pu_bacteria 2996336353 2996336892 325
434 iso_pu_bacteria 2996341866 2996344098 325
435 iso_pu_bacteria 2996348954 2996352764 325
436 iso_pu_bacteria 2996386984 2996387334 325
437 iso_pu_bacteria 3000135777 3000139502 325
438 iso_pu_bacteria 3002141150 3002142049 325
439 iso_pu_bacteria 3004167301 3004167510 325
440 iso_pu_bacteria 3004188549 3004191719 325
441 iso_pu_bacteria 3004195979 3004196226 325
442 iso_pu_bacteria 3004203850 3004204629 325
443 iso_pu_bacteria 3004211236 3004217928 325
444 iso_pu_bacteria 3004218560 3004221024 325
445 iso_pu_bacteria 3004232784 3004238629 325
446 iso_pu_bacteria 3004239961 3004244528 325
447 iso_pu_bacteria 3004268573 3004274049 325
448 iso_pu_bacteria 3004275668 3004279446 325
449 iso_pu_bacteria 3004334049 3004335892 325
450 iso_pu_bacteria 637000159 637075765 325
451 iso_pu_bacteria 643692032 643827724 325
452 iso_pu_bacteria 649633066 649871671 325
453 iso_pu_bacteria 8002285264 8002291072 325
454 iso_pu_bacteria 8004300914 8004301511 325
455 iso_pu_bacteria 8004361976 8004367014 325
456 iso_pu_bacteria 8004374579 8004378961 325
457 iso_pu_bacteria 8004387939 8004392655 325
458 iso_pu_bacteria 8004445564 8004447420 325
459 iso_pu_bacteria 8004633249 8004636509 325
460 iso_pu_bacteria 8004640170 8004645261 325
461 iso_pu_bacteria 8004695233 8004700899 325
462 iso_pu_bacteria 8004703790 8004712169 325
463 iso_pu_bacteria 8004714634 8004718964 325
464 iso_pu_bacteria 8004727605 8004730298 325
465 iso_pu_bacteria 8005658619 8005661540 325
466 iso_pu_bacteria 8055617313 8055619331 325
467 3300049569 Ga0501032_0064754 Ga0501032_0064754_535_1521 326
468 3300049581 Ga0501047_0108570 Ga0501047_0108570_194_1180 326
469 3300049822 Ga0501035_0061600 Ga0501035_0061600_1053_2039 326
470 3300049571 Ga0501034_0000139 Ga0501034_0000139_67564_68589 327
471 3300049571 Ga0501034_0108345 Ga0501034_0108345_522_1532 327
472 3300009093 Ga0105240_10119373 Ga0105240_101193733 328
473 3300031090 Ga0265760_10042875 Ga0265760_100428751 328
474 3300031595 Ga0265313_10041988 Ga0265313_100419882 328
475 iso_pu_bacteria 2588253730 2588518767 328
476 3300001989 JGI24739J22299_10018804 JGI24739J22299_100188044 329
477 3300002741 JGI25157J39369_1004295 JGI25157J39369_10042952 329
478 3300003214 JGI25165J46597_1000042 JGI25165J46597_100004215 329
479 3300003578 Ga0006562J51391_1027443 Ga0006562J51391_10274431 329
480 3300003762 Ga0055542_1000592 Ga0055542_10005921 329
481 3300005356 Ga0070674_100231800 Ga0070674_1002318002 329
482 3300005539 Ga0068853_100006660 Ga0068853_10000666010 329
483 3300005548 Ga0070665_100110857 Ga0070665_1001108572 329
484 3300005548 Ga0070665_100385303 Ga0070665_1003853032 329
485 3300005614 Ga0068856_100303104 Ga0068856_1003031042 329
486 3300005983 Ga0081540_1057259 Ga0081540_10572592 329
487 3300006038 Ga0075365_10102201 Ga0075365_101022012 329
488 3300006038 Ga0075365_10140300 Ga0075365_101403003 329
489 3300006051 Ga0075364_10170647 Ga0075364_101706472 329
490 3300006177 Ga0075362_10048001 Ga0075362_100480011 329
491 3300006178 Ga0075367_10034371 Ga0075367_100343715 329
492 3300006186 Ga0075369_10038435 Ga0075369_100384352 329
493 3300006353 Ga0075370_10104906 Ga0075370_101049062 329
494 3300009093 Ga0105240_10033560 Ga0105240_100335604 329
495 3300009545 Ga0105237_10007146 Ga0105237_1000714612 329
496 3300009545 Ga0105237_10084410 Ga0105237_100844101 329
497 3300009551 Ga0105238_10121640 Ga0105238_101216402 329
498 3300010375 Ga0105239_10026367 Ga0105239_100263677 329
499 3300010375 Ga0105239_10171559 Ga0105239_101715591 329
500 3300011119 Ga0105246_10236749 Ga0105246_102367491 329
501 3300013104 Ga0157370_10082493 Ga0157370_100824933 329
502 3300025230 Ga0209563_102197 Ga0209563_1021973 329
503 3300025250 Ga0209026_1000029 Ga0209026_100002939 329
504 3300025254 Ga0209148_1000069 Ga0209148_10000694 329
505 3300025256 Ga0209759_1000637 Ga0209759_100063719 329
506 3300025261 Ga0209233_1000028 Ga0209233_1000028311 329
507 3300025272 Ga0209455_1000219 Ga0209455_100021956 329
508 3300025294 Ga0209025_1050940 Ga0209025_10509402 329
509 3300025297 Ga0209758_1026940 Ga0209758_10269403 329
510 3300025315 Ga0207697_10080239 Ga0207697_100802392 329
511 3300025904 Ga0207647_10006782 Ga0207647_100067825 329
512 3300025907 Ga0207645_10124923 Ga0207645_101249232 329
513 3300025913 Ga0207695_10158786 Ga0207695_101587862 329
514 3300025914 Ga0207671_10009754 Ga0207671_100097548 329
515 3300025914 Ga0207671_10218204 Ga0207671_102182042 329
516 3300025916 Ga0207663_10169980 Ga0207663_101699801 329
517 3300025919 Ga0207657_10085243 Ga0207657_100852432 329
518 3300025924 Ga0207694_10038481 Ga0207694_100384812 329
519 3300025928 Ga0207700_10352000 Ga0207700_103520001 329
520 3300025941 Ga0207711_10313812 Ga0207711_103138121 329
521 3300025949 Ga0207667_10073739 Ga0207667_100737394 329
522 3300026041 Ga0207639_10071953 Ga0207639_100719532 329
523 3300026067 Ga0207678_10036931 Ga0207678_100369314 329
524 3300026067 Ga0207678_10056395 Ga0207678_100563952 329
525 3300026078 Ga0207702_10260776 Ga0207702_102607762 329
526 3300026089 Ga0207648_10219433 Ga0207648_102194332 329
527 3300026116 Ga0207674_10123111 Ga0207674_101231112 329
528 3300028379 Ga0268266_10042043 Ga0268266_100420434 329
529 3300028794 Ga0307515_10000448 Ga0307515_1000044844 329
530 3300031456 Ga0307513_10229873 Ga0307513_102298732 329
531 3300031911 Ga0307412_10196230 Ga0307412_101962302 329
532 3300031911 Ga0307412_10215067 Ga0307412_102150672 329
533 3300035691 Ga0373931_0100090 Ga0373931_0100090_452_1441 329
534 3300035695 Ga0373927_0000541 Ga0373927_0000541_12171_13163 329
535 3300037068 Ga0373925_0000276 Ga0373925_0000276_43706_44698 329
536 3300037418 Ga0395900_0202913 Ga0395900_0202913_685_1746 329
537 3300037418 Ga0395900_0582108 Ga0395900_0582108_56_1051 329
538 3300037466 Ga0395898_0087263 Ga0395898_0087263_1227_2216 329
539 3300037466 Ga0395898_0089836 Ga0395898_0089836_1524_2585 329
540 3300037471 Ga0395905_0000374 Ga0395905_0000374_23733_24728 329
541 3300037471 Ga0395905_0003446 Ga0395905_0003446_12244_13239 329
542 3300038443 Ga0395901_0119188 Ga0395901_0119188_81_1208 329
543 3300038443 Ga0395901_0140072 Ga0395901_0140072_1314_2375 329
544 3300039438 Ga0436360_0515915 Ga0436360_0515915_39_1052 329
545 3300044658 Ga0466972_0027586 Ga0466972_0027586_130_1119 329
546 3300044901 Ga0466960_0026492 Ga0466960_0026492_725_1714 329
547 3300046460 Ga0495638_0019832 Ga0495638_0019832_1514_2509 329
548 3300046460 Ga0495638_0036259 Ga0495638_0036259_433_1428 329
549 3300046460 Ga0495638_0106210 Ga0495638_0106210_90_1079 329
550 3300046522 Ga0495643_0099530 Ga0495643_0099530_414_1403 329
551 3300046530 Ga0495654_0000314 Ga0495654_0000314_4118_5110 329
552 3300047323 Ga0495683_0121072 Ga0495683_0121072_32_1021 329
553 3300047472 Ga0495686_0151800 Ga0495686_0151800_339_1328 329
554 3300048903 Ga0496100_0018744 Ga0496100_0018744_2756_3817 329
555 3300048914 Ga0496111_0266062 Ga0496111_0266062_186_1199 329
556 3300048915 Ga0496112_0159883 Ga0496112_0159883_516_1574 329
557 3300048915 Ga0496112_0278259 Ga0496112_0278259_182_1171 329
558 3300048918 Ga0496115_0220672 Ga0496115_0220672_109_1170 329
559 3300048921 Ga0496118_0129046 Ga0496118_0129046_86_1075 329
560 3300048923 Ga0496120_0022308 Ga0496120_0022308_196_1185 329
561 3300049568 Ga0501031_0000024 Ga0501031_0000024_82327_83316 329
562 3300049568 Ga0501031_0083815 Ga0501031_0083815_580_1572 329
563 3300049569 Ga0501032_0000007 Ga0501032_0000007_246611_247600 329
564 3300049569 Ga0501032_0016721 Ga0501032_0016721_4065_5054 329
565 3300049569 Ga0501032_0111122 Ga0501032_0111122_76_1077 329
566 3300049570 Ga0501033_0000051 Ga0501033_0000051_104035_105024 329
567 3300049570 Ga0501033_0000260 Ga0501033_0000260_19156_20241 329
568 3300049570 Ga0501033_0007216 Ga0501033_0007216_100_1089 329
569 3300049570 Ga0501033_0029108 Ga0501033_0029108_1859_2848 329
570 3300049571 Ga0501034_0000029 Ga0501034_0000029_6282_7271 329
571 3300049571 Ga0501034_0002910 Ga0501034_0002910_3340_4329 329
572 3300049571 Ga0501034_0006986 Ga0501034_0006986_8405_9394 329
573 3300049572 Ga0501036_0000004 Ga0501036_0000004_6282_7271 329
574 3300049572 Ga0501036_0022455 Ga0501036_0022455_2493_3488 329
575 3300049572 Ga0501036_0030980 Ga0501036_0030980_1859_2848 329
576 3300049572 Ga0501036_0032163 Ga0501036_0032163_3319_4308 329
577 3300049573 Ga0501037_0000004 Ga0501037_0000004_246611_247600 329
578 3300049573 Ga0501037_0000870 Ga0501037_0000870_3330_4319 329
579 3300049573 Ga0501037_0011087 Ga0501037_0011087_2544_3533 329
580 3300049574 Ga0501038_0000005 Ga0501038_0000005_6282_7271 329
581 3300049574 Ga0501038_0001781 Ga0501038_0001781_3340_4329 329
582 3300049574 Ga0501038_0039109 Ga0501038_0039109_1859_2848 329
583 3300049574 Ga0501038_0112099 Ga0501038_0112099_132_1127 329
584 3300049574 Ga0501038_0176200 Ga0501038_0176200_285_1277 329
585 3300049575 Ga0501039_0000009 Ga0501039_0000009_6282_7271 329
586 3300049575 Ga0501039_0001074 Ga0501039_0001074_3340_4329 329
587 3300049579 Ga0501043_0000113 Ga0501043_0000113_3326_4315 329
588 3300049579 Ga0501043_0002269 Ga0501043_0002269_8975_9964 329
589 3300049579 Ga0501043_0047375 Ga0501043_0047375_532_1521 329
590 3300049579 Ga0501043_0075926 Ga0501043_0075926_858_1859 329
591 3300049580 Ga0501046_0022094 Ga0501046_0022094_1128_2117 329
592 3300049580 Ga0501046_0166090 Ga0501046_0166090_561_1553 329
593 3300049581 Ga0501047_0000487 Ga0501047_0000487_36444_37433 329
594 3300049581 Ga0501047_0001923 Ga0501047_0001923_13527_14528 329
595 3300049581 Ga0501047_0042584 Ga0501047_0042584_1082_2074 329
596 3300049582 Ga0501048_0105424 Ga0501048_0105424_685_1677 329
597 3300049584 Ga0501068_0004616 Ga0501068_0004616_4466_5455 329
598 3300049585 Ga0501069_0014211 Ga0501069_0014211_2314_3315 329
599 3300049586 Ga0501070_0000822 Ga0501070_0000822_17792_18793 329
600 3300049586 Ga0501070_0021060 Ga0501070_0021060_199_1191 329
601 3300049586 Ga0501070_0024199 Ga0501070_0024199_1332_2321 329
602 3300049587 Ga0501071_0030542 Ga0501071_0030542_1967_2956 329
603 3300049587 Ga0501071_0097852 Ga0501071_0097852_908_1909 329
604 3300049589 Ga0501073_0006747 Ga0501073_0006747_535_1680 329
605 3300049590 Ga0501074_0012168 Ga0501074_0012168_1921_2910 329
606 3300049741 Ga0501079_0187998 Ga0501079_0187998_595_1596 329
607 3300049742 Ga0501080_0011970 Ga0501080_0011970_379_1380 329
608 3300049742 Ga0501080_0042871 Ga0501080_0042871_1871_3016 329
609 3300049742 Ga0501080_0146800 Ga0501080_0146800_324_1313 329
610 3300049742 Ga0501080_0302169 Ga0501080_0302169_87_1079 329
611 3300049742 Ga0501080_0400393 Ga0501080_0400393_15_1004 329
612 3300049744 Ga0501083_0004298 Ga0501083_0004298_5862_7007 329
613 3300049822 Ga0501035_0000014 Ga0501035_0000014_6282_7271 329
614 3300049822 Ga0501035_0000201 Ga0501035_0000201_3324_4313 329
615 3300049822 Ga0501035_0001226 Ga0501035_0001226_12644_13729 329
616 3300049822 Ga0501035_0001287 Ga0501035_0001287_6755_7756 329
617 3300049822 Ga0501035_0012165 Ga0501035_0012165_5645_6634 329
618 3300049822 Ga0501035_0020547 Ga0501035_0020547_910_1902 329
619 3300049822 Ga0501035_0058517 Ga0501035_0058517_586_1575 329
620 3300049823 Ga0501044_0000012 Ga0501044_0000012_246611_247600 329
621 3300049823 Ga0501044_0019827 Ga0501044_0019827_182_1171 329
622 3300049823 Ga0501044_0025056 Ga0501044_0025056_399_1388 329
623 3300049823 Ga0501044_0029809 Ga0501044_0029809_3858_4859 329
624 3300049823 Ga0501044_0046007 Ga0501044_0046007_1859_2848 329
625 3300049823 Ga0501044_0055989 Ga0501044_0055989_2823_3815 329
626 3300050491 nmdc:mga00v17_294043_c1 nmdc:mga00v17_294043_c1_22_1011 329
627 3300050492 nmdc:mga0yw44_5658_c1 nmdc:mga0yw44_5658_c1_3333_4322 329
628 3300050492 nmdc:mga0yw44_94427_c1 nmdc:mga0yw44_94427_c1_468_1625 329
629 3300053079 Ga0500610_0002706 Ga0500610_0002706_1862_2851 329
630 3300053088 Ga0500644_0028051 Ga0500644_0028051_667_1662 329
631 3300053139 Ga0500568_0001046 Ga0500568_0001046_9074_10063 329
632 3300053156 Ga0500622_0000370 Ga0500622_0000370_40695_41690 329
633 3300053158 Ga0500627_0115056 Ga0500627_0115056_12_1001 329
634 iso_pu_bacteria 2597489875 2597810921 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02608

Bmp

ABC transporter substrate-binding protein PnrA-like

80

378

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fqy-assembly1.cif.gz_A pnra from treponema pallidum complexed with adenosine. 0.9213 22 319
7x0r-assembly1.cif.gz_A crystal structure of substrate binding protein lbp complexed wtih guanosine from clostridium thermocellum 0.9176 23 328
6yab-assembly3.cif.gz_BBB crystal structure of pnra from s. pneumoniae in complex with uridine 0.9102 23 320
6shu-assembly1.cif.gz_A borrelia burgdorferi bmpd nucleoside binding protein bound to adenosine 0.9097 22 320
7x0r-assembly1.cif.gz_A crystal structure of substrate binding protein lbp complexed wtih guanosine from clostridium thermocellum 0.9007 23 328
ID Description Score Start End Superfamily
4pevC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9127 23 124 3.40.50.2300
2fqwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8676 126 319 3.40.50.2300
3s99A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8608 126 317 3.40.50.2300
4iilA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8573 126 319 3.40.50.2300
4iilA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8482 126 319 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A5C7U096-F1-model_v4 deleted 0.9833 28 328
AF-A0A496TV96-F1-model_v4 BMP family ABC transporter substrate-binding protein 0.9768 23 325 GO:0005886
AF-A0A349KVF0-F1-model_v4 BMP family ABC transporter substrate-binding protein 0.969 26 201 GO:0005886
AF-A0A1W9UHM6-F1-model_v4 ABC transporter substrate-binding protein PnrA-like domain-containing protein 0.9672 28 320 GO:0005886
AF-A0A7W0QB26-F1-model_v4 BMP family ABC transporter substrate-binding protein 0.9662 23 320 GO:0005886

Feature Viewer

pLDDT pTM Quality
92.23 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map