F471197

General Info

Members Datasets Scaffolds Average Seq Length
634 265 1268 473

Family's Representative Sequence

Representative Sequence 3300047319|Ga0495674_0010437|Ga0495674_0010437_5236_6573
Length 445
Sequence VAPLESHAEFAPTGSRDPIGLLLGQAQSRVPELVPVRHGRMLVSAFTFYRGAALPMAADQATTPSSGLRVQLCGDAHLSNFGAFASPERRLVFDVNDFDETLPGPFEWDVKRLAASLAVAGRDNGFPAKDRRKIVLAAAEGYRSAMRAFADQPLLEVWYAHLDIEQAIGDFRSQMKAKRFKKAGALLAKAHTADSTKALRKLTTTVDGGQRRIISDPPMIMPIEDVFADVQASAIYQEIRTVLGKYRRTLQSDRRHLLEQFTLLQVARKVVGVGSVGTRAWIVLMDAGDGTEPLFLQAKEAQPSVLAKYCGRSRYTSQGERVVAGQHLMQAQSDIFLGWTRAAGPDKVDRDFYVRQLKDWKFSAPIELMIPSGMAVYAGLCGWTLARAHARSGDRVALAAYLGGSDKFGQAIADFAETYADQNERDYAALQAAVKDGRAEAASEI

Samples

Sample ID Description Type Environment
1 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
165 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
166 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
168 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
170 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
171 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
172 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
173 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
215 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
245 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
256 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.16
Metatranscriptomes 2.68
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.99
Rhizosphere 90.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495674_0010437 3300047319 Bacteria 8795
2 JGI24746J21847_1006539 3300001977 Bacteria 1802
3 JGI24737J22298_10006846 3300001990 Bacteria 3872
4 JGI24745J21846_1000328 3300002073 Bacteria 4102
5 Ga0070658_10018079 3300005327 Bacteria 5638
6 Ga0070658_10024391 3300005327 Bacteria 4851
7 Ga0070683_100141278 3300005329 Bacteria 2281
8 Ga0070683_100172654 3300005329 Bacteria 2052
9 Ga0068869_100017464 3300005334 Bacteria 4864
10 Ga0070666_10028394 3300005335 Bacteria 3670
11 Ga0070680_100109216 3300005336 Bacteria 2302
12 Ga0070682_100013332 3300005337 Bacteria 4726
13 Ga0070682_100053765 3300005337 Bacteria 2525
14 Ga0070682_100062089 3300005337 Bacteria 2366
15 Ga0068868_100020307 3300005338 Bacteria 4987
16 Ga0070660_100014115 3300005339 Bacteria 5751
17 Ga0070660_100069824 3300005339 Bacteria 2741
18 Ga0070689_100034176 3300005340 Bacteria 3878
19 Ga0070689_100124482 3300005340 Bacteria 2062
20 Ga0070691_10020281 3300005341 Bacteria 3071
21 Ga0070661_100044612 3300005344 Bacteria 3239
22 Ga0070692_10048775 3300005345 Bacteria 2195
23 Ga0070668_100031324 3300005347 Bacteria 4045
24 Ga0070668_100183050 3300005347 Bacteria 1712
25 Ga0070669_100040575 3300005353 Bacteria 3383
26 Ga0070659_100005728 3300005366 Bacteria 8946
27 Ga0070659_100019747 3300005366 Bacteria 5113
28 Ga0070659_100038323 3300005366 Bacteria 3738
29 Ga0070659_100058394 3300005366 Bacteria 3044
30 Ga0070667_100077543 3300005367 Bacteria 2837
31 Ga0070667_100159971 3300005367 Bacteria 1983
32 Ga0070709_10001104 3300005434 Bacteria 14876
33 Ga0070709_10009681 3300005434 Bacteria 5323
34 Ga0070709_10013032 3300005434 Bacteria 4667
35 Ga0070714_100022613 3300005435 Bacteria 5155
36 Ga0070714_100038910 3300005435 Bacteria 4001
37 Ga0070714_100083491 3300005435 Bacteria 2785
38 Ga0070714_100162812 3300005435 Bacteria 2020
39 Ga0070713_100021765 3300005436 Bacteria 4941
40 Ga0070713_100057620 3300005436 Bacteria 3236
41 Ga0070710_10004709 3300005437 Bacteria 6451
42 Ga0070710_10014234 3300005437 Bacteria 4000
43 Ga0070710_10017343 3300005437 Bacteria 3682
44 Ga0070710_10018438 3300005437 Bacteria 3591
45 Ga0070711_100016690 3300005439 Bacteria 4665
46 Ga0070711_100023369 3300005439 Bacteria 4019
47 Ga0070705_100043929 3300005440 Bacteria 2564
48 Ga0070705_100050083 3300005440 Bacteria 2428
49 Ga0070708_100093819 3300005445 Bacteria 2737
50 Ga0070708_100182401 3300005445 Bacteria 1962
51 Ga0070663_100011978 3300005455 Bacteria 5470
52 Ga0070678_100028566 3300005456 Bacteria 3806
53 Ga0070678_100042172 3300005456 Bacteria 3242
54 Ga0070678_100080076 3300005456 Bacteria 2472
55 Ga0070662_100021197 3300005457 Bacteria 4435
56 Ga0070662_100035096 3300005457 Bacteria 3540
57 Ga0070662_100151314 3300005457 Bacteria 1807
58 Ga0070681_10018418 3300005458 Bacteria 6979
59 Ga0070685_10029959 3300005466 Bacteria 3027
60 Ga0070707_100033988 3300005468 Bacteria 4863
61 Ga0070698_100006876 3300005471 Bacteria 12321
62 Ga0070698_100057642 3300005471 Bacteria 3930
63 Ga0070698_100132033 3300005471 Bacteria 2452
64 Ga0070699_100078408 3300005518 Bacteria 2877
65 Ga0070699_100137403 3300005518 Bacteria 2156
66 Ga0070699_100200464 3300005518 Bacteria 1774
67 Ga0070679_100064368 3300005530 Bacteria 3655
68 Ga0070679_100122543 3300005530 Bacteria 2584
69 Ga0070679_100244992 3300005530 Bacteria 1749
70 Ga0070684_100096219 3300005535 Bacteria 2639
71 Ga0070684_100112614 3300005535 Bacteria 2441
72 Ga0068853_100038399 3300005539 Bacteria 4078
73 Ga0070672_100027548 3300005543 Bacteria 4240
74 Ga0070672_100033089 3300005543 Bacteria 3911
75 Ga0070696_100010650 3300005546 Bacteria 6158
76 Ga0070693_100013069 3300005547 Bacteria 4220
77 Ga0070665_100057560 3300005548 Bacteria 3897
78 Ga0070704_100012383 3300005549 Bacteria 5268
79 Ga0070704_100175584 3300005549 Bacteria 1708
80 Ga0068855_100024852 3300005563 Bacteria 7167
81 Ga0068855_100107749 3300005563 Bacteria 3201
82 Ga0068855_100239953 3300005563 Bacteria 2026
83 Ga0070664_100085867 3300005564 Bacteria 2718
84 Ga0068857_100030104 3300005577 Bacteria 4790
85 Ga0068857_100068045 3300005577 Bacteria 3170
86 Ga0068854_100015654 3300005578 Bacteria 5033
87 Ga0068854_100088388 3300005578 Bacteria 2301
88 Ga0068854_100108830 3300005578 Bacteria 2088
89 Ga0070702_100050631 3300005615 Bacteria 2373
90 Ga0070702_100057918 3300005615 Bacteria 2242
91 Ga0068852_100040618 3300005616 Bacteria 3926
92 Ga0068852_100065726 3300005616 Bacteria 3165
93 Ga0068859_100068176 3300005617 Bacteria 3593
94 Ga0068859_100140497 3300005617 Bacteria 2488
95 Ga0068864_100280355 3300005618 Bacteria 1555
96 Ga0068866_10016495 3300005718 Bacteria 3303
97 Ga0068866_10048600 3300005718 Bacteria 2146
98 Ga0068861_100021951 3300005719 Bacteria 4593
99 Ga0068861_100023895 3300005719 Bacteria 4413
100 Ga0068870_10016879 3300005840 Bacteria 3500
101 Ga0068863_100171907 3300005841 Bacteria 2079
102 Ga0068858_100039866 3300005842 Bacteria 4354
103 Ga0068858_100086798 3300005842 Bacteria 2910
104 Ga0068858_100091191 3300005842 Bacteria 2836
105 Ga0068860_100042010 3300005843 Bacteria 4369
106 Ga0068860_100048995 3300005843 Bacteria 4026
107 Ga0068860_100109990 3300005843 Bacteria 2633
108 Ga0068862_100066183 3300005844 Bacteria 3113
109 Ga0081455_10000790 3300005937 Bacteria 40666
110 Ga0081455_10036212 3300005937 Bacteria 4398
111 Ga0070717_10011925 3300006028 Bacteria 6614
112 Ga0070717_10020958 3300006028 Bacteria 5147
113 Ga0070717_10032585 3300006028 Bacteria 4200
114 Ga0070717_10087559 3300006028 Bacteria 2623
115 Ga0070715_10001290 3300006163 Bacteria 7182
116 Ga0070716_100000667 3300006173 Bacteria 14594
117 Ga0070716_100004254 3300006173 Bacteria 6816
118 Ga0070712_100017792 3300006175 Bacteria 4604
119 Ga0070712_100030400 3300006175 Bacteria 3628
120 Ga0070712_100082252 3300006175 Bacteria 2335
121 Ga0070712_100092116 3300006175 Bacteria 2222
122 Ga0097621_100080487 3300006237 Bacteria 2710
123 Ga0068871_100032893 3300006358 Bacteria 4101
124 Ga0075428_100006480 3300006844 Bacteria 13016
125 Ga0075428_100014687 3300006844 Bacteria 8699
126 Ga0075430_100065858 3300006846 Bacteria 3043
127 Ga0075431_100044020 3300006847 Bacteria 4604
128 Ga0075429_100005849 3300006880 Bacteria 10611
129 Ga0068865_100077252 3300006881 Bacteria 2379
130 Ga0075436_100014899 3300006914 Bacteria 5327
131 Ga0097620_100068173 3300006931 Bacteria 3593
132 Ga0097620_100140499 3300006931 Bacteria 2488
133 Ga0075435_100065187 3300007076 Bacteria 2961
134 Ga0105251_10048588 3300009011 Bacteria 2033
135 Ga0105240_10113637 3300009093 Bacteria 3272
136 Ga0111539_10001924 3300009094 Bacteria 27666
137 Ga0111539_10014869 3300009094 Bacteria 9704
138 Ga0105245_10003733 3300009098 Bacteria 13565
139 Ga0105245_10010104 3300009098 Bacteria 8220
140 Ga0105245_10081348 3300009098 Bacteria 2961
141 Ga0105245_10243200 3300009098 Bacteria 1745
142 Ga0105247_10019567 3300009101 Bacteria 4065
143 Ga0105247_10030129 3300009101 Bacteria 3289
144 Ga0114129_10018916 3300009147 Bacteria 9814
145 Ga0105243_10044720 3300009148 Bacteria 3475
146 Ga0105243_10089373 3300009148 Bacteria 2532
147 Ga0105241_10065560 3300009174 Bacteria 2806
148 Ga0105242_10190502 3300009176 Bacteria 1815
149 Ga0105248_10017901 3300009177 Bacteria 7818
150 Ga0105248_10354462 3300009177 Bacteria 1652
151 Ga0105237_10027730 3300009545 Bacteria 5775
152 Ga0105237_10057372 3300009545 Bacteria 3897
153 Ga0105237_10139292 3300009545 Bacteria 2420
154 Ga0105238_10123949 3300009551 Bacteria 2563
155 Ga0105238_10200027 3300009551 Bacteria 1973
156 Ga0105249_10083358 3300009553 Bacteria 2976
157 Ga0105239_10024554 3300010375 Bacteria 6640
158 Ga0105239_10203230 3300010375 Bacteria 2220
159 Ga0105246_10004723 3300011119 Bacteria 8297
160 Ga0157371_10035201 3300013102 Bacteria 3589
161 Ga0157371_10053064 3300013102 Bacteria 2879
162 Ga0157370_10049432 3300013104 Bacteria 4025
163 Ga0157370_10206254 3300013104 Bacteria 1822
164 Ga0157369_10007793 3300013105 Bacteria 12322
165 Ga0157369_10024320 3300013105 Bacteria 6741
166 Ga0157369_10044437 3300013105 Bacteria 4835
167 Ga0157369_10162737 3300013105 Bacteria 2354
168 Ga0157374_10005810 3300013296 Bacteria 10423
169 Ga0157374_10020547 3300013296 Bacteria 5861
170 Ga0157374_10076006 3300013296 Bacteria 3175
171 Ga0157374_10080985 3300013296 Bacteria 3081
172 Ga0157378_10088192 3300013297 Bacteria 2815
173 Ga0157378_10111740 3300013297 Bacteria 2506
174 Ga0157378_10121507 3300013297 Bacteria 2408
175 Ga0163162_10029268 3300013306 Bacteria 5451
176 Ga0163162_10153229 3300013306 Bacteria 2423
177 Ga0157372_10065990 3300013307 Bacteria 4065
178 Ga0157372_10090105 3300013307 Bacteria 3486
179 Ga0157372_10119670 3300013307 Bacteria 3023
180 Ga0157372_10275750 3300013307 Bacteria 1955
181 Ga0157375_10040812 3300013308 Bacteria 4476
182 Ga0157375_10126272 3300013308 Bacteria 2673
183 Ga0163163_10001252 3300014325 Bacteria 21402
184 Ga0163163_10010692 3300014325 Bacteria 8273
185 Ga0163163_10036578 3300014325 Bacteria 4770
186 Ga0163163_10041125 3300014325 Bacteria 4519
187 Ga0157380_10016965 3300014326 Bacteria 5379
188 Ga0157380_10034670 3300014326 Bacteria 3894
189 Ga0157377_10005568 3300014745 Bacteria 5931
190 Ga0157377_10081896 3300014745 Bacteria 1889
191 Ga0157379_10029936 3300014968 Bacteria 4842
192 Ga0157379_10047553 3300014968 Bacteria 3827
193 Ga0157376_10029367 3300014969 Bacteria 4379
194 Ga0157376_10216314 3300014969 Bacteria 1772
195 Ga0163161_10016475 3300017792 Bacteria 5160
196 Ga0163161_10029148 3300017792 Bacteria 3923
197 Ga0197907_11024867 3300020069 Bacteria 3282
198 Ga0206356_10282889 3300020070 Bacteria 1930
199 Ga0206349_1574627 3300020075 Bacteria 2071
200 Ga0206352_10613437 3300020078 Bacteria 1771
201 Ga0206350_10853901 3300020080 Bacteria 2778
202 Ga0206350_11651250 3300020080 Bacteria 3199
203 Ga0206354_11250888 3300020081 Bacteria 2102
204 Ga0154015_1627625 3300020610 Bacteria 1761
205 Ga0224712_10012144 3300022467 Bacteria 2699
206 Ga0224712_10018382 3300022467 Bacteria 2336
207 Ga0207692_10001120 3300025898 Bacteria 9859
208 Ga0207692_10003640 3300025898 Bacteria 6036
209 Ga0207692_10004210 3300025898 Bacteria 5684
210 Ga0207692_10010551 3300025898 Bacteria 3898
211 Ga0207688_10013782 3300025901 Bacteria 4394
212 Ga0207688_10014511 3300025901 Bacteria 4282
213 Ga0207680_10084930 3300025903 Bacteria 1998
214 Ga0207685_10001118 3300025905 Bacteria 5334
215 Ga0207685_10004206 3300025905 Bacteria 3624
216 Ga0207699_10001310 3300025906 Bacteria 11826
217 Ga0207699_10002072 3300025906 Bacteria 9472
218 Ga0207699_10020770 3300025906 Bacteria 3526
219 Ga0207699_10066661 3300025906 Bacteria 2186
220 Ga0207699_10091092 3300025906 Bacteria 1914
221 Ga0207643_10010970 3300025908 Bacteria 4889
222 Ga0207643_10021485 3300025908 Bacteria 3547
223 Ga0207705_10014888 3300025909 Bacteria 5594
224 Ga0207705_10033397 3300025909 Bacteria 3675
225 Ga0207684_10168619 3300025910 Bacteria 1887
226 Ga0207654_10047705 3300025911 Bacteria 2448
227 Ga0207671_10040065 3300025914 Bacteria 3468
228 Ga0207693_10014454 3300025915 Bacteria 6346
229 Ga0207693_10014703 3300025915 Bacteria 6287
230 Ga0207693_10032929 3300025915 Bacteria 4091
231 Ga0207693_10043542 3300025915 Bacteria 3531
232 Ga0207693_10044543 3300025915 Bacteria 3488
233 Ga0207663_10000655 3300025916 Bacteria 15334
234 Ga0207663_10005020 3300025916 Bacteria 6642
235 Ga0207663_10025494 3300025916 Bacteria 3419
236 Ga0207663_10058487 3300025916 Bacteria 2433
237 Ga0207662_10048043 3300025918 Bacteria 2528
238 Ga0207662_10080116 3300025918 Bacteria 1991
239 Ga0207657_10000634 3300025919 Bacteria 37262
240 Ga0207657_10007486 3300025919 Bacteria 11190
241 Ga0207657_10010923 3300025919 Bacteria 9035
242 Ga0207657_10012161 3300025919 Bacteria 8504
243 Ga0207657_10026682 3300025919 Bacteria 5302
244 Ga0207657_10071172 3300025919 Bacteria 2945
245 Ga0207652_10280127 3300025921 Bacteria 1504
246 Ga0207646_10017366 3300025922 Bacteria 6735
247 Ga0207646_10101009 3300025922 Bacteria 2586
248 Ga0207681_10008893 3300025923 Bacteria 6135
249 Ga0207694_10083281 3300025924 Bacteria 2515
250 Ga0207694_10126373 3300025924 Bacteria 2046
251 Ga0207687_10002667 3300025927 Bacteria 12075
252 Ga0207687_10058558 3300025927 Bacteria 2711
253 Ga0207687_10135059 3300025927 Bacteria 1865
254 Ga0207687_10151826 3300025927 Bacteria 1768
255 Ga0207687_10194044 3300025927 Bacteria 1583
256 Ga0207700_10000861 3300025928 Bacteria 17456
257 Ga0207700_10001084 3300025928 Bacteria 15672
258 Ga0207700_10008174 3300025928 Bacteria 6462
259 Ga0207700_10042094 3300025928 Bacteria 3346
260 Ga0207664_10000815 3300025929 Bacteria 21138
261 Ga0207664_10004135 3300025929 Bacteria 9792
262 Ga0207664_10009378 3300025929 Bacteria 6866
263 Ga0207664_10019237 3300025929 Bacteria 5044
264 Ga0207664_10060733 3300025929 Bacteria 3013
265 Ga0207664_10066620 3300025929 Bacteria 2887
266 Ga0207664_10072220 3300025929 Bacteria 2782
267 Ga0207664_10140457 3300025929 Bacteria 2043
268 Ga0207664_10156550 3300025929 Bacteria 1940
269 Ga0207644_10049830 3300025931 Bacteria 3000
270 Ga0207690_10059049 3300025932 Bacteria 2597
271 Ga0207706_10031296 3300025933 Bacteria 4740
272 Ga0207706_10032823 3300025933 Bacteria 4620
273 Ga0207706_10094009 3300025933 Bacteria 2637
274 Ga0207706_10114677 3300025933 Bacteria 2370
275 Ga0207686_10061092 3300025934 Bacteria 2388
276 Ga0207686_10078501 3300025934 Bacteria 2147
277 Ga0207709_10053673 3300025935 Bacteria 2481
278 Ga0207709_10060513 3300025935 Bacteria 2362
279 Ga0207670_10014765 3300025936 Bacteria 4647
280 Ga0207665_10000412 3300025939 Bacteria 29458
281 Ga0207665_10062126 3300025939 Bacteria 2534
282 Ga0207691_10027194 3300025940 Bacteria 5366
283 Ga0207691_10116021 3300025940 Bacteria 2377
284 Ga0207711_10163829 3300025941 Bacteria 2014
285 Ga0207689_10007561 3300025942 Bacteria 9529
286 Ga0207689_10021171 3300025942 Bacteria 5467
287 Ga0207689_10040427 3300025942 Bacteria 3860
288 Ga0207661_10094750 3300025944 Bacteria 2494
289 Ga0207661_10117823 3300025944 Bacteria 2256
290 Ga0207679_10055502 3300025945 Bacteria 2920
291 Ga0207667_10013997 3300025949 Bacteria 9160
292 Ga0207667_10224436 3300025949 Bacteria 1925
293 Ga0207651_10136934 3300025960 Bacteria 1885
294 Ga0207668_10025533 3300025972 Bacteria 3825
295 Ga0207640_10010662 3300025981 Bacteria 5183
296 Ga0207640_10034963 3300025981 Bacteria 3140
297 Ga0207677_10020980 3300026023 Bacteria 3982
298 Ga0207639_10037969 3300026041 Bacteria 3580
299 Ga0207639_10215517 3300026041 Bacteria 1655
300 Ga0207678_10035090 3300026067 Bacteria 4367
301 Ga0207678_10035545 3300026067 Bacteria 4338
302 Ga0207708_10006715 3300026075 Bacteria 8511
303 Ga0207702_10016168 3300026078 Bacteria 6179
304 Ga0207702_10106484 3300026078 Bacteria 2484
305 Ga0207702_10117283 3300026078 Bacteria 2377
306 Ga0207702_10176035 3300026078 Bacteria 1966
307 Ga0207676_10063185 3300026095 Bacteria 2940
308 Ga0207676_10101726 3300026095 Bacteria 2383
309 Ga0207674_10010076 3300026116 Bacteria 10747
310 Ga0207674_10035074 3300026116 Bacteria 5237
311 Ga0207674_10076263 3300026116 Bacteria 3361
312 Ga0207675_100004594 3300026118 Bacteria 13305
313 Ga0207675_100038013 3300026118 Bacteria 4492
314 Ga0207675_100095823 3300026118 Bacteria 2793
315 Ga0207683_10008113 3300026121 Bacteria 8978
316 Ga0207683_10009001 3300026121 Bacteria 8505
317 Ga0207683_10025765 3300026121 Bacteria 5073
318 Ga0207683_10083739 3300026121 Bacteria 2834
319 Ga0207683_10110064 3300026121 Bacteria 2466
320 Ga0207698_10056435 3300026142 Bacteria 3033
321 Ga0207428_10018747 3300027907 Bacteria 5904
322 Ga0268266_10018524 3300028379 Bacteria 5933
323 Ga0268266_10078047 3300028379 Bacteria 2880
324 Ga0268264_10048701 3300028381 Bacteria 3525
325 Ga0268264_10113167 3300028381 Bacteria 2380
326 Ga0265338_10021050 3300028800 Bacteria 6820
327 Ga0265327_10014803 3300031251 Bacteria 5080
328 Ga0307513_10123028 3300031456 Bacteria 2557
329 Ga0373958_0004257 3300034819 Bacteria 2110
330 Ga0373926_0016511 3300035083 Bacteria 2526
331 Ga0373923_0008943 3300035111 Bacteria 3593
332 Ga0373932_0007528 3300035112 Bacteria 2594
333 Ga0373936_0010725 3300035113 Bacteria 3460
334 Ga0373939_0010617 3300035114 Bacteria 2308
335 Ga0373941_0019865 3300035115 Bacteria 1877
336 Ga0373945_0001523 3300035116 Bacteria 7080
337 Ga0373945_0011840 3300035116 Bacteria 2889
338 Ga0373953_0000347 3300035117 Bacteria 12507
339 Ga0373954_0000186 3300035118 Bacteria 22463
340 Ga0373956_0003515 3300035119 Bacteria 6307
341 Ga0373943_0020357 3300035170 Bacteria 3057
342 Ga0373946_0001121 3300035171 Bacteria 9268
343 Ga0373946_0002358 3300035171 Bacteria 6677
344 Ga0373955_0003150 3300035172 Bacteria 7215
345 Ga0373955_0008391 3300035172 Bacteria 4797
346 Ga0373924_0004858 3300035410 Bacteria 4721
347 Ga0373931_0023603 3300035691 Bacteria 3107
348 Ga0373935_0000420 3300035692 Bacteria 22090
349 Ga0373935_0001384 3300035692 Bacteria 13403
350 Ga0373935_0040738 3300035692 Bacteria 2916
351 Ga0373935_0064143 3300035692 Bacteria 2355
352 Ga0373935_0080790 3300035692 Bacteria 2112
353 Ga0373933_0027760 3300035724 Bacteria 3262
354 Ga0373947_0005962 3300035725 Bacteria 7102
355 Ga0373947_0006041 3300035725 Bacteria 7058
356 Ga0373947_0020441 3300035725 Bacteria 3822
357 Ga0373947_0027991 3300035725 Bacteria 3301
358 Ga0373937_0003308 3300036401 Bacteria 13537
359 Ga0373937_0009428 3300036401 Bacteria 8486
360 Ga0373937_0019426 3300036401 Bacteria 6082
361 Ga0373937_0055508 3300036401 Bacteria 3636
362 Ga0373937_0069869 3300036401 Bacteria 3238
363 Ga0373937_0093726 3300036401 Bacteria 2784
364 Ga0373937_0118084 3300036401 Bacteria 2470
365 Ga0373925_0000053 3300037068 Bacteria 125353
366 Ga0373925_0000554 3300037068 Bacteria 36625
367 Ga0373925_0001584 3300037068 Bacteria 19232
368 Ga0373925_0011699 3300037068 Bacteria 6346
369 Ga0373925_0038646 3300037068 Bacteria 3529
370 Ga0373925_0081389 3300037068 Bacteria 2462
371 Ga0373925_0159971 3300037068 Bacteria 1773
372 Ga0436364_0434503 3300037853 Bacteria 1855
373 Ga0395901_0017767 3300038443 Bacteria 7261
374 Ga0495592_0005402 3300046454 Bacteria 9431
375 Ga0495592_0019484 3300046454 Bacteria 5160
376 Ga0495592_0031521 3300046454 Bacteria 4006
377 Ga0495592_0068224 3300046454 Bacteria 2596
378 Ga0495592_0076363 3300046454 Bacteria 2431
379 Ga0495629_0002722 3300046459 Bacteria 13528
380 Ga0495629_0040840 3300046459 Bacteria 3263
381 Ga0495641_0002460 3300046461 Bacteria 14604
382 Ga0495641_0002670 3300046461 Bacteria 13901
383 Ga0495651_0002816 3300046462 Bacteria 13475
384 Ga0495651_0004058 3300046462 Bacteria 11187
385 Ga0495651_0008357 3300046462 Bacteria 7933
386 Ga0495651_0017292 3300046462 Bacteria 5586
387 Ga0495651_0120371 3300046462 Bacteria 1929
388 Ga0495653_0003310 3300046463 Bacteria 12936
389 Ga0495653_0006348 3300046463 Bacteria 9699
390 Ga0495653_0006994 3300046463 Bacteria 9259
391 Ga0495653_0010776 3300046463 Bacteria 7486
392 Ga0495653_0017241 3300046463 Bacteria 5873
393 Ga0495653_0023655 3300046463 Bacteria 4958
394 Ga0495653_0030061 3300046463 Bacteria 4331
395 Ga0495653_0055735 3300046463 Bacteria 3015
396 Ga0495653_0092352 3300046463 Bacteria 2210
397 Ga0495580_0022342 3300046472 Bacteria 4656
398 Ga0495580_0067346 3300046472 Bacteria 2505
399 Ga0495582_0002486 3300046473 Bacteria 10263
400 Ga0495582_0022030 3300046473 Bacteria 3485
401 Ga0495639_0000465 3300046475 Bacteria 19252
402 Ga0495662_0000919 3300046476 Bacteria 14418
403 Ga0495662_0010296 3300046476 Bacteria 4585
404 Ga0495664_0004949 3300046477 Bacteria 7293
405 Ga0495664_0016036 3300046477 Bacteria 4266
406 Ga0495664_0028656 3300046477 Bacteria 3252
407 Ga0495608_0003248 3300046511 Bacteria 11624
408 Ga0495608_0006234 3300046511 Bacteria 8464
409 Ga0495608_0009617 3300046511 Bacteria 6747
410 Ga0495608_0011695 3300046511 Bacteria 6107
411 Ga0495608_0021082 3300046511 Bacteria 4475
412 Ga0495608_0052820 3300046511 Bacteria 2689
413 Ga0495618_0003260 3300046514 Bacteria 10160
414 Ga0495618_0003969 3300046514 Bacteria 9120
415 Ga0495618_0005479 3300046514 Bacteria 7729
416 Ga0495618_0039006 3300046514 Bacteria 2986
417 Ga0495628_0005032 3300046516 Bacteria 11618
418 Ga0495628_0009802 3300046516 Bacteria 8158
419 Ga0495628_0015956 3300046516 Bacteria 6268
420 Ga0495628_0035352 3300046516 Bacteria 4015
421 Ga0495628_0050423 3300046516 Bacteria 3292
422 Ga0495628_0078534 3300046516 Bacteria 2567
423 Ga0495628_0082667 3300046516 Bacteria 2494
424 Ga0495630_0000711 3300046517 Bacteria 23517
425 Ga0495630_0019193 3300046517 Bacteria 5025
426 Ga0495630_0019908 3300046517 Bacteria 4940
427 Ga0495630_0030362 3300046517 Bacteria 4020
428 Ga0495630_0062104 3300046517 Bacteria 2806
429 Ga0495630_0087376 3300046517 Bacteria 2354
430 Ga0495666_0006374 3300046526 Bacteria 5942
431 Ga0495666_0020486 3300046526 Bacteria 3276
432 Ga0495652_0016406 3300046529 Bacteria 6627
433 Ga0495652_0025870 3300046529 Bacteria 5186
434 Ga0495652_0048977 3300046529 Bacteria 3618
435 Ga0495652_0069647 3300046529 Bacteria 2944
436 Ga0495652_0081276 3300046529 Bacteria 2673
437 Ga0495665_0000830 3300046531 Bacteria 16154
438 Ga0495665_0006395 3300046531 Bacteria 6357
439 Ga0495665_0025589 3300046531 Bacteria 3170
440 Ga0495640_0001670 3300046533 Bacteria 17583
441 Ga0495640_0011212 3300046533 Bacteria 6899
442 Ga0495640_0078605 3300046533 Bacteria 2197
443 Ga0495640_0088797 3300046533 Bacteria 2042
444 Ga0495587_0001041 3300046536 Bacteria 18261
445 Ga0495587_0005788 3300046536 Bacteria 8049
446 Ga0495587_0043512 3300046536 Bacteria 2674
447 Ga0495587_0058122 3300046536 Bacteria 2272
448 Ga0495645_0004438 3300046543 Bacteria 9580
449 Ga0495645_0007335 3300046543 Bacteria 7669
450 Ga0495645_0019742 3300046543 Bacteria 4855
451 Ga0495645_0030172 3300046543 Bacteria 3948
452 Ga0495645_0039873 3300046543 Bacteria 3425
453 Ga0495645_0082908 3300046543 Bacteria 2298
454 Ga0495667_0003050 3300046559 Bacteria 11229
455 Ga0495667_0003661 3300046559 Bacteria 10348
456 Ga0495667_0007638 3300046559 Bacteria 7334
457 Ga0495667_0014218 3300046559 Bacteria 5374
458 Ga0495667_0015446 3300046559 Bacteria 5158
459 Ga0495667_0016588 3300046559 Bacteria 4973
460 Ga0495667_0028861 3300046559 Bacteria 3736
461 Ga0495667_0039505 3300046559 Bacteria 3137
462 Ga0495667_0071227 3300046559 Bacteria 2268
463 Ga0495667_0078222 3300046559 Bacteria 2150
464 Ga0495634_0016331 3300046642 Bacteria 5310
465 Ga0495634_0022114 3300046642 Bacteria 4483
466 Ga0495634_0046697 3300046642 Bacteria 2921
467 Ga0495634_0054974 3300046642 Bacteria 2663
468 Ga0495625_0127703 3300046660 Bacteria 1725
469 Ga0495635_0003084 3300046663 Bacteria 11466
470 Ga0495635_0006332 3300046663 Bacteria 8252
471 Ga0495635_0012044 3300046663 Bacteria 6063
472 Ga0495635_0018664 3300046663 Bacteria 4837
473 Ga0495635_0050181 3300046663 Bacteria 2876
474 Ga0495635_0068287 3300046663 Bacteria 2438
475 Ga0495635_0068573 3300046663 Bacteria 2432
476 Ga0495588_0004064 3300046674 Bacteria 6439
477 Ga0495657_0004378 3300046675 Bacteria 11267
478 Ga0495657_0007323 3300046675 Bacteria 8536
479 Ga0495657_0015261 3300046675 Bacteria 5624
480 Ga0495657_0040735 3300046675 Bacteria 3183
481 Ga0495657_0106868 3300046675 Bacteria 1776
482 Ga0495599_0001250 3300046678 Bacteria 14421
483 Ga0495599_0002625 3300046678 Bacteria 10473
484 Ga0495599_0006482 3300046678 Bacteria 7065
485 Ga0495599_0010865 3300046678 Bacteria 5580
486 Ga0495599_0015120 3300046678 Bacteria 4784
487 Ga0495599_0016716 3300046678 Bacteria 4556
488 Ga0495599_0023636 3300046678 Bacteria 3842
489 Ga0495599_0025326 3300046678 Bacteria 3712
490 Ga0495623_0010557 3300046679 Bacteria 5976
491 Ga0495623_0012511 3300046679 Bacteria 5490
492 Ga0495646_0001358 3300046680 Bacteria 14465
493 Ga0495646_0011241 3300046680 Bacteria 5684
494 Ga0495646_0022801 3300046680 Bacteria 3945
495 Ga0495646_0052494 3300046680 Bacteria 2462
496 Ga0495646_0066536 3300046680 Bacteria 2131
497 Ga0495613_0013922 3300046689 Bacteria 5968
498 Ga0495624_0103285 3300046690 Bacteria 1754
499 Ga0495600_0003515 3300046809 Bacteria 9208
500 Ga0495600_0012557 3300046809 Bacteria 5300
501 Ga0495600_0015004 3300046809 Bacteria 4893
502 Ga0495600_0038938 3300046809 Bacteria 3095
503 Ga0495600_0045192 3300046809 Bacteria 2873
504 Ga0495600_0116317 3300046809 Bacteria 1740
505 Ga0495581_0001545 3300047315 Bacteria 12848
506 Ga0495581_0002419 3300047315 Bacteria 10543
507 Ga0495604_0002672 3300047317 Bacteria 14308
508 Ga0495604_0065788 3300047317 Bacteria 2758
509 Ga0495604_0076869 3300047317 Bacteria 2510
510 Ga0495604_0087967 3300047317 Bacteria 2312
511 Ga0495674_0006775 3300047319 Bacteria 10970
512 Ga0495674_0006834 3300047319 Bacteria 10925
513 Ga0495674_0008086 3300047319 Bacteria 10037
514 Ga0495674_0011433 3300047319 Bacteria 8375
515 Ga0495674_0016644 3300047319 Bacteria 6861
516 Ga0495674_0023377 3300047319 Bacteria 5697
517 Ga0495674_0030681 3300047319 Bacteria 4886
518 Ga0495674_0030814 3300047319 Bacteria 4874
519 Ga0495674_0038735 3300047319 Bacteria 4277
520 Ga0495674_0076096 3300047319 Bacteria 2887
521 Ga0495674_0108329 3300047319 Bacteria 2357
522 Ga0495676_0016982 3300047321 Bacteria 6444
523 Ga0495680_0003521 3300047322 Bacteria 15354
524 Ga0495680_0006590 3300047322 Bacteria 10772
525 Ga0495680_0008711 3300047322 Bacteria 9191
526 Ga0495680_0012875 3300047322 Bacteria 7330
527 Ga0495680_0018959 3300047322 Bacteria 5826
528 Ga0495680_0020972 3300047322 Bacteria 5478
529 Ga0495680_0024472 3300047322 Bacteria 5009
530 Ga0495680_0044513 3300047322 Bacteria 3509
531 Ga0495680_0044600 3300047322 Bacteria 3505
532 Ga0495684_0002514 3300047471 Bacteria 14609
533 Ga0495684_0014903 3300047471 Bacteria 5987
534 Ga0495684_0021597 3300047471 Bacteria 4956
535 Ga0495684_0025242 3300047471 Bacteria 4569
536 Ga0495684_0043735 3300047471 Bacteria 3430
537 Ga0495684_0061965 3300047471 Bacteria 2845
538 Ga0495684_0093701 3300047471 Bacteria 2275
539 Ga0495593_0000755 3300047673 Bacteria 18754
540 Ga0495593_0014152 3300047673 Bacteria 4539
541 Ga0495593_0021988 3300047673 Bacteria 3558
542 Ga0495602_0018525 3300048088 Bacteria 6950
543 Ga0495602_0024927 3300048088 Bacteria 5796
544 Ga0495602_0038612 3300048088 Bacteria 4412
545 Ga0495602_0062800 3300048088 Bacteria 3221
546 Ga0495602_0087869 3300048088 Bacteria 2589
547 Ga0495614_0052627 3300048089 Bacteria 1745
548 Ga0495614_0062491 3300048089 Bacteria 1600
549 Ga0496101_0027983 3300048904 Bacteria 3932
550 Ga0496102_0022860 3300048905 Bacteria 5544
551 Ga0496102_0089418 3300048905 Bacteria 2849
552 Ga0496102_0138434 3300048905 Bacteria 2281
553 Ga0496103_0021763 3300048906 Bacteria 3859
554 Ga0496104_0012668 3300048907 Bacteria 7593
555 Ga0496104_0029475 3300048907 Bacteria 5092
556 Ga0496104_0044583 3300048907 Bacteria 4167
557 Ga0496104_0057082 3300048907 Bacteria 3694
558 Ga0496105_0002230 3300048908 Bacteria 14044
559 Ga0496105_0009158 3300048908 Bacteria 7725
560 Ga0496105_0167027 3300048908 Bacteria 1805
561 Ga0496106_0005039 3300048909 Bacteria 9772
562 Ga0496106_0007161 3300048909 Bacteria 8238
563 Ga0496106_0012001 3300048909 Bacteria 6394
564 Ga0496106_0093894 3300048909 Bacteria 2319
565 Ga0496106_0109021 3300048909 Bacteria 2154
566 Ga0496107_0033297 3300048910 Bacteria 3687
567 Ga0496107_0069916 3300048910 Bacteria 2548
568 Ga0496108_0008709 3300048911 Bacteria 8224
569 Ga0496108_0013878 3300048911 Bacteria 6570
570 Ga0496108_0015210 3300048911 Bacteria 6278
571 Ga0496108_0032088 3300048911 Bacteria 4360
572 Ga0496108_0033796 3300048911 Bacteria 4247
573 Ga0496108_0038819 3300048911 Bacteria 3967
574 Ga0496108_0188895 3300048911 Bacteria 1785
575 Ga0496109_0006605 3300048912 Bacteria 9767
576 Ga0496109_0037108 3300048912 Bacteria 4402
577 Ga0496109_0117154 3300048912 Bacteria 2479
578 Ga0496109_0133262 3300048912 Bacteria 2320
579 Ga0496110_0000573 3300048913 Bacteria 25240
580 Ga0496110_0001913 3300048913 Bacteria 15404
581 Ga0496110_0037937 3300048913 Bacteria 4190
582 Ga0496110_0063751 3300048913 Bacteria 3256
583 Ga0496110_0067754 3300048913 Bacteria 3158
584 Ga0496110_0073814 3300048913 Bacteria 3028
585 Ga0496110_0078027 3300048913 Bacteria 2948
586 Ga0496111_0014233 3300048914 Bacteria 5429
587 Ga0496111_0021546 3300048914 Bacteria 4502
588 Ga0496111_0036694 3300048914 Bacteria 3505
589 Ga0496111_0075980 3300048914 Bacteria 2448
590 Ga0496111_0141899 3300048914 Bacteria 1780
591 Ga0496112_0004325 3300048915 Bacteria 12010
592 Ga0496112_0004423 3300048915 Bacteria 11903
593 Ga0496112_0066975 3300048915 Bacteria 3543
594 Ga0496112_0105250 3300048915 Bacteria 2791
595 Ga0496113_0012710 3300048916 Bacteria 5667
596 Ga0496113_0029459 3300048916 Bacteria 3964
597 Ga0496113_0078398 3300048916 Bacteria 2527
598 Ga0496113_0133712 3300048916 Bacteria 1948
599 Ga0496114_0006060 3300048917 Bacteria 9515
600 Ga0496114_0034920 3300048917 Bacteria 4151
601 Ga0496114_0169825 3300048917 Bacteria 1900
602 Ga0496114_0191593 3300048917 Bacteria 1789
603 Ga0496115_0002783 3300048918 Bacteria 12572
604 Ga0496115_0016847 3300048918 Bacteria 5573
605 Ga0496115_0019362 3300048918 Bacteria 5236
606 Ga0496119_0095421 3300048922 Bacteria 1680
607 Ga0496126_0043534 3300048929 Bacteria 4141
608 Ga0501067_0029240 3300049583 Bacteria 3054
609 Ga0501069_0029020 3300049585 Bacteria 3035
610 nmdc:mga05p37_20718_c1 3300050507 Bacteria 7956
611 nmdc:mga09592_11176_c1 3300050508 Bacteria 7306
612 nmdc:mga0qj67_5266_c1 3300050509 Bacteria 9432
613 nmdc:mga06r32_10247_c1 3300050510 Bacteria 8457
614 nmdc:mga08y16_11134_c1 3300050511 Bacteria 9446
615 nmdc:mga0n895_10511_c1 3300050512 Bacteria 8187
616 nmdc:mga0rr50_109828_c1 3300050513 Bacteria 2181
617 nmdc:mga0rr50_77049_c1 3300050513 Bacteria 2561
618 nmdc:mga0a205_29516_c1 3300050515 Bacteria 5248
619 Ga0495601_0002511 3300053077 Bacteria 10447
620 Ga0495601_0006305 3300053077 Bacteria 6928
621 Ga0495601_0071974 3300053077 Bacteria 2208
622 Ga0495612_0003582 3300053078 Bacteria 6434
623 Ga0495595_0013802 3300053084 Bacteria 3418
624 Ga0495619_0058733 3300053085 Bacteria 2554
625 Ga0495619_0058813 3300053085 Bacteria 2553
626 Ga0495619_0089990 3300053085 Bacteria 2077
627 Ga0587070_004581 3300059491 Bacteria 1758
628 Ga0587073_0007192 3300059492 Bacteria 1749
629 Ga0587083_0006659 3300059505 Bacteria 1732
630 Ga0587092_005796 3300059512 Bacteria 1540
631 Ga0587075_003463 3300059644 Bacteria 1762
632 Ga0587071_007339 3300060344 Bacteria 1754
633 Ga0587111_0010164 3300060346 Bacteria 1609
634 2995469232 2995463766 Bacteria 8577691
635 Ga0495674_0010437
636 JGI24746J21847_1006539
637 JGI24737J22298_10006846
638 JGI24745J21846_1000328
639 Ga0070658_10018079
640 Ga0070658_10024391
641 Ga0070683_100141278
642 Ga0070683_100172654
643 Ga0068869_100017464
644 Ga0070666_10028394
645 Ga0070680_100109216
646 Ga0070682_100013332
647 Ga0070682_100053765
648 Ga0070682_100062089
649 Ga0068868_100020307
650 Ga0070660_100014115
651 Ga0070660_100069824
652 Ga0070689_100034176
653 Ga0070689_100124482
654 Ga0070691_10020281
655 Ga0070661_100044612
656 Ga0070692_10048775
657 Ga0070668_100031324
658 Ga0070668_100183050
659 Ga0070669_100040575
660 Ga0070659_100005728
661 Ga0070659_100019747
662 Ga0070659_100038323
663 Ga0070659_100058394
664 Ga0070667_100077543
665 Ga0070667_100159971
666 Ga0070709_10001104
667 Ga0070709_10009681
668 Ga0070709_10013032
669 Ga0070714_100022613
670 Ga0070714_100038910
671 Ga0070714_100083491
672 Ga0070714_100162812
673 Ga0070713_100021765
674 Ga0070713_100057620
675 Ga0070710_10004709
676 Ga0070710_10014234
677 Ga0070710_10017343
678 Ga0070710_10018438
679 Ga0070711_100016690
680 Ga0070711_100023369
681 Ga0070705_100043929
682 Ga0070705_100050083
683 Ga0070708_100093819
684 Ga0070708_100182401
685 Ga0070663_100011978
686 Ga0070678_100028566
687 Ga0070678_100042172
688 Ga0070678_100080076
689 Ga0070662_100021197
690 Ga0070662_100035096
691 Ga0070662_100151314
692 Ga0070681_10018418
693 Ga0070685_10029959
694 Ga0070707_100033988
695 Ga0070698_100006876
696 Ga0070698_100057642
697 Ga0070698_100132033
698 Ga0070699_100078408
699 Ga0070699_100137403
700 Ga0070699_100200464
701 Ga0070679_100064368
702 Ga0070679_100122543
703 Ga0070679_100244992
704 Ga0070684_100096219
705 Ga0070684_100112614
706 Ga0068853_100038399
707 Ga0070672_100027548
708 Ga0070672_100033089
709 Ga0070696_100010650
710 Ga0070693_100013069
711 Ga0070665_100057560
712 Ga0070704_100012383
713 Ga0070704_100175584
714 Ga0068855_100024852
715 Ga0068855_100107749
716 Ga0068855_100239953
717 Ga0070664_100085867
718 Ga0068857_100030104
719 Ga0068857_100068045
720 Ga0068854_100015654
721 Ga0068854_100088388
722 Ga0068854_100108830
723 Ga0070702_100050631
724 Ga0070702_100057918
725 Ga0068852_100040618
726 Ga0068852_100065726
727 Ga0068859_100068176
728 Ga0068859_100140497
729 Ga0068864_100280355
730 Ga0068866_10016495
731 Ga0068866_10048600
732 Ga0068861_100021951
733 Ga0068861_100023895
734 Ga0068870_10016879
735 Ga0068863_100171907
736 Ga0068858_100039866
737 Ga0068858_100086798
738 Ga0068858_100091191
739 Ga0068860_100042010
740 Ga0068860_100048995
741 Ga0068860_100109990
742 Ga0068862_100066183
743 Ga0081455_10000790
744 Ga0081455_10036212
745 Ga0070717_10011925
746 Ga0070717_10020958
747 Ga0070717_10032585
748 Ga0070717_10087559
749 Ga0070715_10001290
750 Ga0070716_100000667
751 Ga0070716_100004254
752 Ga0070712_100017792
753 Ga0070712_100030400
754 Ga0070712_100082252
755 Ga0070712_100092116
756 Ga0097621_100080487
757 Ga0068871_100032893
758 Ga0075428_100006480
759 Ga0075428_100014687
760 Ga0075430_100065858
761 Ga0075431_100044020
762 Ga0075429_100005849
763 Ga0068865_100077252
764 Ga0075436_100014899
765 Ga0097620_100068173
766 Ga0097620_100140499
767 Ga0075435_100065187
768 Ga0105251_10048588
769 Ga0105240_10113637
770 Ga0111539_10001924
771 Ga0111539_10014869
772 Ga0105245_10003733
773 Ga0105245_10010104
774 Ga0105245_10081348
775 Ga0105245_10243200
776 Ga0105247_10019567
777 Ga0105247_10030129
778 Ga0114129_10018916
779 Ga0105243_10044720
780 Ga0105243_10089373
781 Ga0105241_10065560
782 Ga0105242_10190502
783 Ga0105248_10017901
784 Ga0105248_10354462
785 Ga0105237_10027730
786 Ga0105237_10057372
787 Ga0105237_10139292
788 Ga0105238_10123949
789 Ga0105238_10200027
790 Ga0105249_10083358
791 Ga0105239_10024554
792 Ga0105239_10203230
793 Ga0105246_10004723
794 Ga0157371_10035201
795 Ga0157371_10053064
796 Ga0157370_10049432
797 Ga0157370_10206254
798 Ga0157369_10007793
799 Ga0157369_10024320
800 Ga0157369_10044437
801 Ga0157369_10162737
802 Ga0157374_10005810
803 Ga0157374_10020547
804 Ga0157374_10076006
805 Ga0157374_10080985
806 Ga0157378_10088192
807 Ga0157378_10111740
808 Ga0157378_10121507
809 Ga0163162_10029268
810 Ga0163162_10153229
811 Ga0157372_10065990
812 Ga0157372_10090105
813 Ga0157372_10119670
814 Ga0157372_10275750
815 Ga0157375_10040812
816 Ga0157375_10126272
817 Ga0163163_10001252
818 Ga0163163_10010692
819 Ga0163163_10036578
820 Ga0163163_10041125
821 Ga0157380_10016965
822 Ga0157380_10034670
823 Ga0157377_10005568
824 Ga0157377_10081896
825 Ga0157379_10029936
826 Ga0157379_10047553
827 Ga0157376_10029367
828 Ga0157376_10216314
829 Ga0163161_10016475
830 Ga0163161_10029148
831 Ga0197907_11024867
832 Ga0206356_10282889
833 Ga0206349_1574627
834 Ga0206352_10613437
835 Ga0206350_10853901
836 Ga0206350_11651250
837 Ga0206354_11250888
838 Ga0154015_1627625
839 Ga0224712_10012144
840 Ga0224712_10018382
841 Ga0207692_10001120
842 Ga0207692_10003640
843 Ga0207692_10004210
844 Ga0207692_10010551
845 Ga0207688_10013782
846 Ga0207688_10014511
847 Ga0207680_10084930
848 Ga0207685_10001118
849 Ga0207685_10004206
850 Ga0207699_10001310
851 Ga0207699_10002072
852 Ga0207699_10020770
853 Ga0207699_10066661
854 Ga0207699_10091092
855 Ga0207643_10010970
856 Ga0207643_10021485
857 Ga0207705_10014888
858 Ga0207705_10033397
859 Ga0207684_10168619
860 Ga0207654_10047705
861 Ga0207671_10040065
862 Ga0207693_10014454
863 Ga0207693_10014703
864 Ga0207693_10032929
865 Ga0207693_10043542
866 Ga0207693_10044543
867 Ga0207663_10000655
868 Ga0207663_10005020
869 Ga0207663_10025494
870 Ga0207663_10058487
871 Ga0207662_10048043
872 Ga0207662_10080116
873 Ga0207657_10000634
874 Ga0207657_10007486
875 Ga0207657_10010923
876 Ga0207657_10012161
877 Ga0207657_10026682
878 Ga0207657_10071172
879 Ga0207652_10280127
880 Ga0207646_10017366
881 Ga0207646_10101009
882 Ga0207681_10008893
883 Ga0207694_10083281
884 Ga0207694_10126373
885 Ga0207687_10002667
886 Ga0207687_10058558
887 Ga0207687_10135059
888 Ga0207687_10151826
889 Ga0207687_10194044
890 Ga0207700_10000861
891 Ga0207700_10001084
892 Ga0207700_10008174
893 Ga0207700_10042094
894 Ga0207664_10000815
895 Ga0207664_10004135
896 Ga0207664_10009378
897 Ga0207664_10019237
898 Ga0207664_10060733
899 Ga0207664_10066620
900 Ga0207664_10072220
901 Ga0207664_10140457
902 Ga0207664_10156550
903 Ga0207644_10049830
904 Ga0207690_10059049
905 Ga0207706_10031296
906 Ga0207706_10032823
907 Ga0207706_10094009
908 Ga0207706_10114677
909 Ga0207686_10061092
910 Ga0207686_10078501
911 Ga0207709_10053673
912 Ga0207709_10060513
913 Ga0207670_10014765
914 Ga0207665_10000412
915 Ga0207665_10062126
916 Ga0207691_10027194
917 Ga0207691_10116021
918 Ga0207711_10163829
919 Ga0207689_10007561
920 Ga0207689_10021171
921 Ga0207689_10040427
922 Ga0207661_10094750
923 Ga0207661_10117823
924 Ga0207679_10055502
925 Ga0207667_10013997
926 Ga0207667_10224436
927 Ga0207651_10136934
928 Ga0207668_10025533
929 Ga0207640_10010662
930 Ga0207640_10034963
931 Ga0207677_10020980
932 Ga0207639_10037969
933 Ga0207639_10215517
934 Ga0207678_10035090
935 Ga0207678_10035545
936 Ga0207708_10006715
937 Ga0207702_10016168
938 Ga0207702_10106484
939 Ga0207702_10117283
940 Ga0207702_10176035
941 Ga0207676_10063185
942 Ga0207676_10101726
943 Ga0207674_10010076
944 Ga0207674_10035074
945 Ga0207674_10076263
946 Ga0207675_100004594
947 Ga0207675_100038013
948 Ga0207675_100095823
949 Ga0207683_10008113
950 Ga0207683_10009001
951 Ga0207683_10025765
952 Ga0207683_10083739
953 Ga0207683_10110064
954 Ga0207698_10056435
955 Ga0207428_10018747
956 Ga0268266_10018524
957 Ga0268266_10078047
958 Ga0268264_10048701
959 Ga0268264_10113167
960 Ga0265338_10021050
961 Ga0265327_10014803
962 Ga0307513_10123028
963 Ga0373958_0004257
964 Ga0373926_0016511
965 Ga0373923_0008943
966 Ga0373932_0007528
967 Ga0373936_0010725
968 Ga0373939_0010617
969 Ga0373941_0019865
970 Ga0373945_0001523
971 Ga0373945_0011840
972 Ga0373953_0000347
973 Ga0373954_0000186
974 Ga0373956_0003515
975 Ga0373943_0020357
976 Ga0373946_0001121
977 Ga0373946_0002358
978 Ga0373955_0003150
979 Ga0373955_0008391
980 Ga0373924_0004858
981 Ga0373931_0023603
982 Ga0373935_0000420
983 Ga0373935_0001384
984 Ga0373935_0040738
985 Ga0373935_0064143
986 Ga0373935_0080790
987 Ga0373933_0027760
988 Ga0373947_0005962
989 Ga0373947_0006041
990 Ga0373947_0020441
991 Ga0373947_0027991
992 Ga0373937_0003308
993 Ga0373937_0009428
994 Ga0373937_0019426
995 Ga0373937_0055508
996 Ga0373937_0069869
997 Ga0373937_0093726
998 Ga0373937_0118084
999 Ga0373925_0000053
1000 Ga0373925_0000554
1001 Ga0373925_0001584
1002 Ga0373925_0011699
1003 Ga0373925_0038646
1004 Ga0373925_0081389
1005 Ga0373925_0159971
1006 Ga0436364_0434503
1007 Ga0395901_0017767
1008 Ga0495592_0005402
1009 Ga0495592_0019484
1010 Ga0495592_0031521
1011 Ga0495592_0068224
1012 Ga0495592_0076363
1013 Ga0495629_0002722
1014 Ga0495629_0040840
1015 Ga0495641_0002460
1016 Ga0495641_0002670
1017 Ga0495651_0002816
1018 Ga0495651_0004058
1019 Ga0495651_0008357
1020 Ga0495651_0017292
1021 Ga0495651_0120371
1022 Ga0495653_0003310
1023 Ga0495653_0006348
1024 Ga0495653_0006994
1025 Ga0495653_0010776
1026 Ga0495653_0017241
1027 Ga0495653_0023655
1028 Ga0495653_0030061
1029 Ga0495653_0055735
1030 Ga0495653_0092352
1031 Ga0495580_0022342
1032 Ga0495580_0067346
1033 Ga0495582_0002486
1034 Ga0495582_0022030
1035 Ga0495639_0000465
1036 Ga0495662_0000919
1037 Ga0495662_0010296
1038 Ga0495664_0004949
1039 Ga0495664_0016036
1040 Ga0495664_0028656
1041 Ga0495608_0003248
1042 Ga0495608_0006234
1043 Ga0495608_0009617
1044 Ga0495608_0011695
1045 Ga0495608_0021082
1046 Ga0495608_0052820
1047 Ga0495618_0003260
1048 Ga0495618_0003969
1049 Ga0495618_0005479
1050 Ga0495618_0039006
1051 Ga0495628_0005032
1052 Ga0495628_0009802
1053 Ga0495628_0015956
1054 Ga0495628_0035352
1055 Ga0495628_0050423
1056 Ga0495628_0078534
1057 Ga0495628_0082667
1058 Ga0495630_0000711
1059 Ga0495630_0019193
1060 Ga0495630_0019908
1061 Ga0495630_0030362
1062 Ga0495630_0062104
1063 Ga0495630_0087376
1064 Ga0495666_0006374
1065 Ga0495666_0020486
1066 Ga0495652_0016406
1067 Ga0495652_0025870
1068 Ga0495652_0048977
1069 Ga0495652_0069647
1070 Ga0495652_0081276
1071 Ga0495665_0000830
1072 Ga0495665_0006395
1073 Ga0495665_0025589
1074 Ga0495640_0001670
1075 Ga0495640_0011212
1076 Ga0495640_0078605
1077 Ga0495640_0088797
1078 Ga0495587_0001041
1079 Ga0495587_0005788
1080 Ga0495587_0043512
1081 Ga0495587_0058122
1082 Ga0495645_0004438
1083 Ga0495645_0007335
1084 Ga0495645_0019742
1085 Ga0495645_0030172
1086 Ga0495645_0039873
1087 Ga0495645_0082908
1088 Ga0495667_0003050
1089 Ga0495667_0003661
1090 Ga0495667_0007638
1091 Ga0495667_0014218
1092 Ga0495667_0015446
1093 Ga0495667_0016588
1094 Ga0495667_0028861
1095 Ga0495667_0039505
1096 Ga0495667_0071227
1097 Ga0495667_0078222
1098 Ga0495634_0016331
1099 Ga0495634_0022114
1100 Ga0495634_0046697
1101 Ga0495634_0054974
1102 Ga0495625_0127703
1103 Ga0495635_0003084
1104 Ga0495635_0006332
1105 Ga0495635_0012044
1106 Ga0495635_0018664
1107 Ga0495635_0050181
1108 Ga0495635_0068287
1109 Ga0495635_0068573
1110 Ga0495588_0004064
1111 Ga0495657_0004378
1112 Ga0495657_0007323
1113 Ga0495657_0015261
1114 Ga0495657_0040735
1115 Ga0495657_0106868
1116 Ga0495599_0001250
1117 Ga0495599_0002625
1118 Ga0495599_0006482
1119 Ga0495599_0010865
1120 Ga0495599_0015120
1121 Ga0495599_0016716
1122 Ga0495599_0023636
1123 Ga0495599_0025326
1124 Ga0495623_0010557
1125 Ga0495623_0012511
1126 Ga0495646_0001358
1127 Ga0495646_0011241
1128 Ga0495646_0022801
1129 Ga0495646_0052494
1130 Ga0495646_0066536
1131 Ga0495613_0013922
1132 Ga0495624_0103285
1133 Ga0495600_0003515
1134 Ga0495600_0012557
1135 Ga0495600_0015004
1136 Ga0495600_0038938
1137 Ga0495600_0045192
1138 Ga0495600_0116317
1139 Ga0495581_0001545
1140 Ga0495581_0002419
1141 Ga0495604_0002672
1142 Ga0495604_0065788
1143 Ga0495604_0076869
1144 Ga0495604_0087967
1145 Ga0495674_0006775
1146 Ga0495674_0006834
1147 Ga0495674_0008086
1148 Ga0495674_0011433
1149 Ga0495674_0016644
1150 Ga0495674_0023377
1151 Ga0495674_0030681
1152 Ga0495674_0030814
1153 Ga0495674_0038735
1154 Ga0495674_0076096
1155 Ga0495674_0108329
1156 Ga0495676_0016982
1157 Ga0495680_0003521
1158 Ga0495680_0006590
1159 Ga0495680_0008711
1160 Ga0495680_0012875
1161 Ga0495680_0018959
1162 Ga0495680_0020972
1163 Ga0495680_0024472
1164 Ga0495680_0044513
1165 Ga0495680_0044600
1166 Ga0495684_0002514
1167 Ga0495684_0014903
1168 Ga0495684_0021597
1169 Ga0495684_0025242
1170 Ga0495684_0043735
1171 Ga0495684_0061965
1172 Ga0495684_0093701
1173 Ga0495593_0000755
1174 Ga0495593_0014152
1175 Ga0495593_0021988
1176 Ga0495602_0018525
1177 Ga0495602_0024927
1178 Ga0495602_0038612
1179 Ga0495602_0062800
1180 Ga0495602_0087869
1181 Ga0495614_0052627
1182 Ga0495614_0062491
1183 Ga0496101_0027983
1184 Ga0496102_0022860
1185 Ga0496102_0089418
1186 Ga0496102_0138434
1187 Ga0496103_0021763
1188 Ga0496104_0012668
1189 Ga0496104_0029475
1190 Ga0496104_0044583
1191 Ga0496104_0057082
1192 Ga0496105_0002230
1193 Ga0496105_0009158
1194 Ga0496105_0167027
1195 Ga0496106_0005039
1196 Ga0496106_0007161
1197 Ga0496106_0012001
1198 Ga0496106_0093894
1199 Ga0496106_0109021
1200 Ga0496107_0033297
1201 Ga0496107_0069916
1202 Ga0496108_0008709
1203 Ga0496108_0013878
1204 Ga0496108_0015210
1205 Ga0496108_0032088
1206 Ga0496108_0033796
1207 Ga0496108_0038819
1208 Ga0496108_0188895
1209 Ga0496109_0006605
1210 Ga0496109_0037108
1211 Ga0496109_0117154
1212 Ga0496109_0133262
1213 Ga0496110_0000573
1214 Ga0496110_0001913
1215 Ga0496110_0037937
1216 Ga0496110_0063751
1217 Ga0496110_0067754
1218 Ga0496110_0073814
1219 Ga0496110_0078027
1220 Ga0496111_0014233
1221 Ga0496111_0021546
1222 Ga0496111_0036694
1223 Ga0496111_0075980
1224 Ga0496111_0141899
1225 Ga0496112_0004325
1226 Ga0496112_0004423
1227 Ga0496112_0066975
1228 Ga0496112_0105250
1229 Ga0496113_0012710
1230 Ga0496113_0029459
1231 Ga0496113_0078398
1232 Ga0496113_0133712
1233 Ga0496114_0006060
1234 Ga0496114_0034920
1235 Ga0496114_0169825
1236 Ga0496114_0191593
1237 Ga0496115_0002783
1238 Ga0496115_0016847
1239 Ga0496115_0019362
1240 Ga0496119_0095421
1241 Ga0496126_0043534
1242 Ga0501067_0029240
1243 Ga0501069_0029020
1244 nmdc:mga05p37_20718_c1
1245 nmdc:mga09592_11176_c1
1246 nmdc:mga0qj67_5266_c1
1247 nmdc:mga06r32_10247_c1
1248 nmdc:mga08y16_11134_c1
1249 nmdc:mga0n895_10511_c1
1250 nmdc:mga0rr50_109828_c1
1251 nmdc:mga0rr50_77049_c1
1252 nmdc:mga0a205_29516_c1
1253 Ga0495601_0002511
1254 Ga0495601_0006305
1255 Ga0495601_0071974
1256 Ga0495612_0003582
1257 Ga0495595_0013802
1258 Ga0495619_0058733
1259 Ga0495619_0058813
1260 Ga0495619_0089990
1261 Ga0587070_004581
1262 Ga0587073_0007192
1263 Ga0587083_0006659
1264 Ga0587092_005796
1265 Ga0587075_003463
1266 Ga0587071_007339
1267 Ga0587111_0010164
1268 2995469232

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10009

DUF2252

Uncharacterized protein conserved in bacteria (DUF2252)

29

433

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j1b-assembly1.cif.gz_B binary complex structure of human tau protein kinase i with amppnp 0.4614 308 400
7qq6-assembly2.cif.gz_C gcn2 (eif2alpha kinase 4, e2ak4) in complex with compound 1 (dovitinib) 0.4599 304 402
7mf0-assembly1.cif.gz_AAA co-crystal structure of perk with inhibitor (r)-2-amino-n-cyclopropyl-5-(4-(2-(3,5-difluorophenyl)-2-hydroxyacetamido)-2-methylphenyl)nicotinamide 0.4534 302 400
5o1v-assembly1.cif.gz_B crystal structure of wnk3 kinase domain in a monophosphorylated apo state (a-loop swapped) 0.4531 322 401
8eqe-assembly1.cif.gz_AAA co-crystal structure of perk with compound 26 0.4479 302 400
ID Description Score Start End Superfamily
af_Q57666_1_149_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.6257 381 402 3.30.1440.10
af_A0A286Y993_137_261_3.10.450.10 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5281 305 347 3.10.450.10
3dm8A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5033 299 350 3.10.450.50
af_P91566_47_365_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.4997 303 401 1.10.510.10
af_Q9SRX1_1_160_3.10.450.10 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.4759 271 349 3.10.450.10
ID Description Score Start End GO Terms
AF-A0A2S9FPT2-F1-model_v4 DUF2252 domain-containing protein 0.9582 118 215
AF-A0A1E4PAM8-F1-model_v4 deleted 0.9549 89 488
AF-A0A538MB38-F1-model_v4 DUF2252 domain-containing protein 0.9473 139 489
AF-A0A401WF67-F1-model_v4 DUF2252 domain-containing protein 0.9432 24 489
AF-A0A359A5M1-F1-model_v4 deleted 0.9422 24 489

Map