F471186

General Info

Members Datasets Scaffolds Average Seq Length
634 258 1268 94

Family's Representative Sequence

Representative Sequence 3300041492|Ga0451835_1151736|Ga0451835_1151736_297_575
Length 92
Sequence MKQAAKMQEQVQKQAAQTRAEGTAGGGAVTIVINGLKQVQSLTIDPEVVNKDDVEILQDMIIAAFVDAQKKVDEDMKKQMGGLLGGMGLPGL

Samples

Sample ID Description Type Environment
1 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
150 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
153 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
155 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
156 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
159 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
167 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
168 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
189 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
192 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
197 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
219 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
220 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
221 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 1.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.37
Rhizosphere 89.75
Stem 0
Stem Tuber 0
Unclassified 11.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451835_1151736 3300041492 Bacteria 592
2 Ga0070658_10868414 3300005327 Bacteria 784
3 Ga0070658_10950837 3300005327 Bacteria 747
4 Ga0070676_10784128 3300005328 Bacteria 702
5 Ga0070683_100010411 3300005329 Bacteria 7998
6 Ga0070683_100549849 3300005329 Bacteria 1104
7 Ga0070683_100619100 3300005329 Bacteria 1036
8 Ga0070683_100790107 3300005329 Bacteria 910
9 Ga0070683_102008359 3300005329 Bacteria 556
10 Ga0070690_100760655 3300005330 Bacteria 749
11 Ga0068869_100875972 3300005334 Bacteria 776
12 Ga0070666_10409379 3300005335 Bacteria 976
13 Ga0068868_100034862 3300005338 Bacteria 3887
14 Ga0068868_100325879 3300005338 Unclassified 1310
15 Ga0068868_100724130 3300005338 Bacteria 892
16 Ga0070660_100015095 3300005339 Bacteria 5574
17 Ga0070689_100202224 3300005340 Bacteria 1622
18 Ga0070689_100302376 3300005340 Bacteria 1332
19 Ga0070689_100673181 3300005340 Bacteria 902
20 Ga0070687_100621156 3300005343 Bacteria 745
21 Ga0070671_100121530 3300005355 Bacteria 2198
22 Ga0070674_101952398 3300005356 Unclassified 534
23 Ga0070673_100060705 3300005364 Bacteria 2997
24 Ga0070673_100898865 3300005364 Bacteria 821
25 Ga0070688_100131658 3300005365 Bacteria 1688
26 Ga0070688_100596001 3300005365 Bacteria 845
27 Ga0070659_100013719 3300005366 Bacteria 6040
28 Ga0070659_100092758 3300005366 Bacteria 2422
29 Ga0070659_101342163 3300005366 Unclassified 635
30 Ga0070667_100156307 3300005367 Bacteria 2006
31 Ga0070667_100183215 3300005367 Bacteria 1853
32 Ga0070709_10028286 3300005434 Bacteria 3342
33 Ga0070709_11122000 3300005434 Bacteria 630
34 Ga0070710_11243593 3300005437 Bacteria 552
35 Ga0070711_100125623 3300005439 Bacteria 1904
36 Ga0070711_100269964 3300005439 Bacteria 1342
37 Ga0070705_101743168 3300005440 Bacteria 527
38 Ga0070694_100805304 3300005444 Bacteria 770
39 Ga0070694_101419648 3300005444 Bacteria 586
40 Ga0070663_100031840 3300005455 Bacteria 3628
41 Ga0070663_100128003 3300005455 Bacteria 1925
42 Ga0070663_100400825 3300005455 Bacteria 1121
43 Ga0070678_100603667 3300005456 Bacteria 980
44 Ga0070678_101228500 3300005456 Bacteria 696
45 Ga0070678_102308917 3300005456 Bacteria 511
46 Ga0070662_100150920 3300005457 Bacteria 1809
47 Ga0070662_101822049 3300005457 Bacteria 526
48 Ga0070681_10045451 3300005458 Bacteria 4393
49 Ga0070681_10069265 3300005458 Bacteria 3494
50 Ga0070681_10257065 3300005458 Bacteria 1659
51 Ga0070681_10319898 3300005458 Unclassified 1461
52 Ga0070681_10413191 3300005458 Bacteria 1261
53 Ga0070681_11149579 3300005458 Bacteria 698
54 Ga0070681_11623956 3300005458 Bacteria 572
55 Ga0068867_100046218 3300005459 Bacteria 3197
56 Ga0068867_100436219 3300005459 Bacteria 1113
57 Ga0070698_101495190 3300005471 Bacteria 627
58 Ga0070699_101040834 3300005518 Bacteria 751
59 Ga0070679_100093521 3300005530 Bacteria 2994
60 Ga0070679_100127295 3300005530 Bacteria 2529
61 Ga0070679_100223079 3300005530 Unclassified 1845
62 Ga0070679_100312499 3300005530 Bacteria 1521
63 Ga0070679_100367494 3300005530 Unclassified 1386
64 Ga0070679_100415362 3300005530 Bacteria 1291
65 Ga0070679_101405912 3300005530 Bacteria 644
66 Ga0070679_102202820 3300005530 Bacteria 501
67 Ga0070684_100224853 3300005535 Bacteria 1713
68 Ga0070684_100251801 3300005535 Bacteria 1614
69 Ga0070684_100253516 3300005535 Bacteria 1608
70 Ga0070697_101770435 3300005536 Unclassified 553
71 Ga0068853_100096953 3300005539 Bacteria 2602
72 Ga0068853_100304248 3300005539 Bacteria 1474
73 Ga0068853_100428870 3300005539 Bacteria 1241
74 Ga0068853_100721319 3300005539 Bacteria 952
75 Ga0070672_101421245 3300005543 Bacteria 621
76 Ga0070686_100414450 3300005544 Bacteria 1028
77 Ga0070695_101313187 3300005545 Bacteria 598
78 Ga0070693_100589954 3300005547 Unclassified 801
79 Ga0070665_100010110 3300005548 Bacteria 9544
80 Ga0070665_100127363 3300005548 Bacteria 2549
81 Ga0070665_100351836 3300005548 Bacteria 1479
82 Ga0070665_100580684 3300005548 Bacteria 1134
83 Ga0070665_100812797 3300005548 Bacteria 948
84 Ga0070704_100188505 3300005549 Bacteria 1656
85 Ga0068855_100018469 3300005563 Bacteria 8380
86 Ga0068855_100023314 3300005563 Bacteria 7413
87 Ga0068855_100156336 3300005563 Bacteria 2590
88 Ga0068855_100601822 3300005563 Unclassified 1185
89 Ga0068855_100853643 3300005563 Bacteria 965
90 Ga0068855_100985583 3300005563 Bacteria 886
91 Ga0068855_101148531 3300005563 Bacteria 810
92 Ga0068855_102248981 3300005563 Bacteria 547
93 Ga0070664_100111271 3300005564 Bacteria 2390
94 Ga0070664_100238481 3300005564 Bacteria 1632
95 Ga0070664_101632895 3300005564 Bacteria 611
96 Ga0070664_101924737 3300005564 Bacteria 561
97 Ga0068857_100057260 3300005577 Bacteria 3459
98 Ga0068857_100401948 3300005577 Bacteria 1275
99 Ga0068857_100402984 3300005577 Bacteria 1273
100 Ga0068857_101076426 3300005577 Bacteria 776
101 Ga0068856_100001755 3300005614 Bacteria 22674
102 Ga0068856_100022608 3300005614 Bacteria 6113
103 Ga0068856_100122998 3300005614 Bacteria 2597
104 Ga0068856_100492693 3300005614 Bacteria 1246
105 Ga0068856_100529965 3300005614 Bacteria 1199
106 Ga0068856_101834332 3300005614 Bacteria 618
107 Ga0070702_101417385 3300005615 Bacteria 569
108 Ga0068852_100835130 3300005616 Bacteria 936
109 Ga0068852_101644754 3300005616 Bacteria 665
110 Ga0068859_100111352 3300005617 Bacteria 2800
111 Ga0068859_101829065 3300005617 Bacteria 671
112 Ga0068864_100010446 3300005618 Bacteria 7671
113 Ga0068864_100356843 3300005618 Bacteria 1381
114 Ga0068864_100436581 3300005618 Bacteria 1250
115 Ga0068866_10082256 3300005718 Bacteria 1732
116 Ga0068866_10475186 3300005718 Unclassified 822
117 Ga0068866_10503600 3300005718 Bacteria 802
118 Ga0068861_101077811 3300005719 Bacteria 771
119 Ga0068851_10074235 3300005834 Bacteria 1765
120 Ga0068863_100047600 3300005841 Bacteria 4067
121 Ga0068863_100155890 3300005841 Bacteria 2186
122 Ga0068863_101920807 3300005841 Bacteria 602
123 Ga0068858_100021987 3300005842 Bacteria 5957
124 Ga0068858_100360788 3300005842 Unclassified 1393
125 Ga0068858_101093572 3300005842 Bacteria 783
126 Ga0068860_100388481 3300005843 Unclassified 1379
127 Ga0068860_100409779 3300005843 Bacteria 1342
128 Ga0068860_100663124 3300005843 Bacteria 1051
129 Ga0068860_102090583 3300005843 Bacteria 587
130 Ga0081540_1133892 3300005983 Bacteria 1007
131 Ga0070717_10054054 3300006028 Unclassified 3311
132 Ga0070715_10857548 3300006163 Bacteria 556
133 Ga0070712_100304352 3300006175 Bacteria 1291
134 Ga0070712_101141971 3300006175 Bacteria 677
135 Ga0097621_100004895 3300006237 Bacteria 9389
136 Ga0097621_100033233 3300006237 Bacteria 4106
137 Ga0097621_100066138 3300006237 Bacteria 2976
138 Ga0097621_100128077 3300006237 Bacteria 2158
139 Ga0097621_100128103 3300006237 Bacteria 2157
140 Ga0097621_100349462 3300006237 Bacteria 1315
141 Ga0097621_100405364 3300006237 Bacteria 1221
142 Ga0097621_102200059 3300006237 Bacteria 527
143 Ga0068871_100003469 3300006358 Bacteria 10838
144 Ga0068871_100125799 3300006358 Bacteria 2169
145 Ga0068871_100180089 3300006358 Bacteria 1816
146 Ga0068871_101046415 3300006358 Bacteria 762
147 Ga0068871_101525736 3300006358 Bacteria 632
148 Ga0075430_100095041 3300006846 Unclassified 2491
149 Ga0075431_100032058 3300006847 Bacteria 5415
150 Ga0075434_100535661 3300006871 Bacteria 1191
151 Ga0075434_102445936 3300006871 Bacteria 524
152 Ga0068865_100200272 3300006881 Bacteria 1550
153 Ga0068865_101332805 3300006881 Unclassified 639
154 Ga0097620_100111353 3300006931 Bacteria 2800
155 Ga0097620_101828816 3300006931 Bacteria 671
156 Ga0075435_101841903 3300007076 Bacteria 531
157 Ga0105240_10002132 3300009093 Bacteria 32323
158 Ga0105240_10005509 3300009093 Bacteria 18864
159 Ga0105240_10005577 3300009093 Bacteria 18707
160 Ga0105240_10262921 3300009093 Bacteria 1990
161 Ga0105240_10369795 3300009093 Bacteria 1621
162 Ga0105240_10786746 3300009093 Bacteria 1031
163 Ga0105240_11218400 3300009093 Bacteria 796
164 Ga0105245_10032993 3300009098 Bacteria 4585
165 Ga0105245_10110493 3300009098 Unclassified 2556
166 Ga0105245_10149779 3300009098 Bacteria 2205
167 Ga0105245_10206104 3300009098 Bacteria 1890
168 Ga0105245_10615439 3300009098 Bacteria 1114
169 Ga0105245_10739452 3300009098 Bacteria 1019
170 Ga0105247_10112516 3300009101 Bacteria 1754
171 Ga0105247_10172955 3300009101 Bacteria 1437
172 Ga0105243_10011515 3300009148 Bacteria 6693
173 Ga0105243_10095253 3300009148 Bacteria 2460
174 Ga0105243_10483924 3300009148 Unclassified 1169
175 Ga0105243_11251653 3300009148 Bacteria 757
176 Ga0105241_10049952 3300009174 Bacteria 3187
177 Ga0105241_10056037 3300009174 Bacteria 3021
178 Ga0105241_10306147 3300009174 Bacteria 1365
179 Ga0105241_10402518 3300009174 Bacteria 1201
180 Ga0105241_10595226 3300009174 Bacteria 998
181 Ga0105242_10035269 3300009176 Bacteria 4012
182 Ga0105242_10042188 3300009176 Bacteria 3683
183 Ga0105242_10105231 3300009176 Bacteria 2396
184 Ga0105248_10542339 3300009177 Bacteria 1312
185 Ga0105248_10580000 3300009177 Bacteria 1265
186 Ga0105248_10999867 3300009177 Bacteria 945
187 Ga0105248_11305756 3300009177 Bacteria 821
188 Ga0105248_11437602 3300009177 Bacteria 780
189 Ga0105237_10001641 3300009545 Bacteria 29041
190 Ga0105237_10206619 3300009545 Bacteria 1964
191 Ga0105237_10280136 3300009545 Bacteria 1670
192 Ga0105237_10459285 3300009545 Bacteria 1279
193 Ga0105237_10491976 3300009545 Bacteria 1233
194 Ga0105237_10546830 3300009545 Bacteria 1164
195 Ga0105237_10771924 3300009545 Bacteria 968
196 Ga0105237_11440274 3300009545 Bacteria 695
197 Ga0105238_10024088 3300009551 Bacteria 6206
198 Ga0105238_10029359 3300009551 Bacteria 5602
199 Ga0105238_10169675 3300009551 Bacteria 2158
200 Ga0105238_10329126 3300009551 Bacteria 1514
201 Ga0105238_11432995 3300009551 Bacteria 718
202 Ga0105249_10247348 3300009553 Bacteria 1766
203 Ga0105239_10035735 3300010375 Bacteria 5455
204 Ga0105239_10051805 3300010375 Bacteria 4499
205 Ga0105239_10156846 3300010375 Bacteria 2542
206 Ga0105239_10195280 3300010375 Bacteria 2266
207 Ga0105239_11890344 3300010375 Bacteria 692
208 Ga0105239_12307068 3300010375 Bacteria 626
209 Ga0105246_10017625 3300011119 Bacteria 4542
210 Ga0105246_10529037 3300011119 Bacteria 1006
211 Ga0157373_10055773 3300013100 Bacteria 2807
212 Ga0157373_10221445 3300013100 Unclassified 1335
213 Ga0157373_10242654 3300013100 Bacteria 1274
214 Ga0157371_10113175 3300013102 Unclassified 1927
215 Ga0157371_10167702 3300013102 Bacteria 1569
216 Ga0157371_11026595 3300013102 Unclassified 630
217 Ga0157370_10085202 3300013104 Bacteria 2968
218 Ga0157370_10146922 3300013104 Bacteria 2195
219 Ga0157370_10207497 3300013104 Bacteria 1816
220 Ga0157370_10229766 3300013104 Bacteria 1717
221 Ga0157370_10418470 3300013104 Bacteria 1233
222 Ga0157369_10002412 3300013105 Bacteria 22451
223 Ga0157369_10079538 3300013105 Bacteria 3511
224 Ga0157369_10183057 3300013105 Bacteria 2204
225 Ga0157369_10320375 3300013105 Unclassified 1612
226 Ga0157369_10339288 3300013105 Bacteria 1561
227 Ga0157369_11043203 3300013105 Bacteria 836
228 Ga0157369_11079173 3300013105 Bacteria 821
229 Ga0157374_10018232 3300013296 Bacteria 6193
230 Ga0157374_10096930 3300013296 Bacteria 2821
231 Ga0157374_10308105 3300013296 Bacteria 1567
232 Ga0157374_11838296 3300013296 Bacteria 631
233 Ga0157378_10296067 3300013297 Bacteria 1564
234 Ga0157378_11642851 3300013297 Bacteria 689
235 Ga0163162_10032302 3300013306 Bacteria 5198
236 Ga0163162_10051884 3300013306 Bacteria 4117
237 Ga0163162_10385663 3300013306 Bacteria 1534
238 Ga0163162_11176079 3300013306 Bacteria 870
239 Ga0163162_12725947 3300013306 Bacteria 569
240 Ga0157372_10101910 3300013307 Bacteria 3278
241 Ga0157372_10231329 3300013307 Bacteria 2143
242 Ga0157372_10378575 3300013307 Bacteria 1649
243 Ga0157372_10783737 3300013307 Bacteria 1108
244 Ga0157372_12309904 3300013307 Bacteria 618
245 Ga0157372_13334233 3300013307 Bacteria 511
246 Ga0157375_10126797 3300013308 Bacteria 2668
247 Ga0157375_10266736 3300013308 Bacteria 1874
248 Ga0157375_11015337 3300013308 Bacteria 969
249 Ga0157375_11044175 3300013308 Archaea 955
250 Ga0163163_10005820 3300014325 Bacteria 10715
251 Ga0163163_10879475 3300014325 Bacteria 959
252 Ga0163163_11166311 3300014325 Bacteria 833
253 Ga0163163_11432941 3300014325 Bacteria 752
254 Ga0163163_12623102 3300014325 Bacteria 561
255 Ga0157380_10468907 3300014326 Bacteria 1214
256 Ga0157380_12596182 3300014326 Bacteria 573
257 Ga0157380_13052876 3300014326 Unclassified 534
258 Ga0157379_10251986 3300014968 Bacteria 1603
259 Ga0157379_10961162 3300014968 Bacteria 813
260 Ga0157376_10015634 3300014969 Bacteria 5739
261 Ga0157376_10184993 3300014969 Bacteria 1907
262 Ga0157376_10210295 3300014969 Bacteria 1795
263 Ga0157376_10233204 3300014969 Bacteria 1711
264 Ga0157376_10835245 3300014969 Unclassified 936
265 Ga0157376_11133671 3300014969 Bacteria 809
266 Ga0157376_11250753 3300014969 Bacteria 771
267 Ga0157376_11381492 3300014969 Bacteria 735
268 Ga0157376_11420835 3300014969 Bacteria 726
269 Ga0157376_12736628 3300014969 Bacteria 533
270 Ga0163161_10989776 3300017792 Bacteria 717
271 Ga0197907_10155810 3300020069 Bacteria 552
272 Ga0206349_1764162 3300020075 Bacteria 533
273 Ga0206352_11203009 3300020078 Bacteria 1080
274 Ga0206353_11494669 3300020082 Bacteria 808
275 Ga0213873_10260469 3300021358 Unclassified 551
276 Ga0213872_10127618 3300021361 Bacteria 1122
277 Ga0213874_10406411 3300021377 Bacteria 531
278 Ga0213876_10001745 3300021384 Bacteria 13192
279 Ga0213876_10003328 3300021384 Bacteria 9211
280 Ga0213876_10495612 3300021384 Bacteria 650
281 Ga0213875_10002100 3300021388 Bacteria 12220
282 Ga0213875_10015687 3300021388 Bacteria 3685
283 Ga0213875_10043211 3300021388 Bacteria 2116
284 Ga0213875_10049507 3300021388 Bacteria 1969
285 Ga0213875_10062124 3300021388 Bacteria 1747
286 Ga0213875_10174328 3300021388 Bacteria 1010
287 Ga0213875_10179522 3300021388 Bacteria 994
288 Ga0213875_10382580 3300021388 Bacteria 670
289 Ga0213875_10576386 3300021388 Bacteria 543
290 Ga0213875_10579307 3300021388 Bacteria 541
291 Ga0213871_10117468 3300021441 Bacteria 790
292 Ga0224712_10159436 3300022467 Bacteria 1005
293 Ga0207642_10562656 3300025899 Bacteria 705
294 Ga0207680_10012685 3300025903 Bacteria 4301
295 Ga0207647_10217247 3300025904 Unclassified 1102
296 Ga0207645_10570859 3300025907 Bacteria 768
297 Ga0207705_10780868 3300025909 Bacteria 742
298 Ga0207654_10032216 3300025911 Bacteria 2894
299 Ga0207654_10041210 3300025911 Bacteria 2606
300 Ga0207654_10059331 3300025911 Bacteria 2231
301 Ga0207654_11015404 3300025911 Bacteria 603
302 Ga0207707_10055505 3300025912 Bacteria 3446
303 Ga0207707_10070674 3300025912 Bacteria 3041
304 Ga0207707_10188531 3300025912 Bacteria 1799
305 Ga0207707_10351058 3300025912 Bacteria 1271
306 Ga0207707_10481519 3300025912 Unclassified 1060
307 Ga0207707_10605742 3300025912 Bacteria 927
308 Ga0207695_10007356 3300025913 Bacteria 14049
309 Ga0207695_10014863 3300025913 Bacteria 9191
310 Ga0207695_10019753 3300025913 Bacteria 7745
311 Ga0207695_10169081 3300025913 Bacteria 2113
312 Ga0207695_10263238 3300025913 Bacteria 1621
313 Ga0207695_10518958 3300025913 Bacteria 1073
314 Ga0207695_10735354 3300025913 Unclassified 867
315 Ga0207671_10130027 3300025914 Unclassified 1932
316 Ga0207671_10398834 3300025914 Bacteria 1094
317 Ga0207671_10729089 3300025914 Unclassified 788
318 Ga0207693_10552137 3300025915 Bacteria 898
319 Ga0207693_10744615 3300025915 Bacteria 757
320 Ga0207660_10171058 3300025917 Unclassified 1682
321 Ga0207657_10249608 3300025919 Bacteria 1415
322 Ga0207652_10172124 3300025921 Bacteria 1943
323 Ga0207652_10692723 3300025921 Bacteria 909
324 Ga0207652_11023794 3300025921 Bacteria 725
325 Ga0207694_10054961 3300025924 Bacteria 3090
326 Ga0207694_10346756 3300025924 Bacteria 1229
327 Ga0207694_10812915 3300025924 Unclassified 790
328 Ga0207659_10273528 3300025926 Unclassified 1379
329 Ga0207659_10289013 3300025926 Bacteria 1343
330 Ga0207687_10048444 3300025927 Bacteria 2951
331 Ga0207687_10084275 3300025927 Bacteria 2303
332 Ga0207687_10219347 3300025927 Bacteria 1496
333 Ga0207687_10458658 3300025927 Bacteria 1058
334 Ga0207687_11051405 3300025927 Bacteria 699
335 Ga0207700_10009991 3300025928 Bacteria 5963
336 Ga0207690_10024516 3300025932 Bacteria 3779
337 Ga0207706_11691413 3300025933 Bacteria 510
338 Ga0207686_10009485 3300025934 Bacteria 5281
339 Ga0207686_10056016 3300025934 Bacteria 2476
340 Ga0207686_10066266 3300025934 Bacteria 2306
341 Ga0207686_10075090 3300025934 Bacteria 2187
342 Ga0207686_10940185 3300025934 Bacteria 699
343 Ga0207709_10035196 3300025935 Bacteria 2959
344 Ga0207709_10077111 3300025935 Bacteria 2135
345 Ga0207670_10069556 3300025936 Bacteria 2429
346 Ga0207670_10322354 3300025936 Bacteria 1216
347 Ga0207670_10354299 3300025936 Bacteria 1163
348 Ga0207670_10814858 3300025936 Bacteria 778
349 Ga0207669_11703281 3300025937 Unclassified 538
350 Ga0207704_10073091 3300025938 Unclassified 2182
351 Ga0207704_10394205 3300025938 Unclassified 1091
352 Ga0207711_10155179 3300025941 Bacteria 2069
353 Ga0207711_10241059 3300025941 Bacteria 1658
354 Ga0207711_10413022 3300025941 Bacteria 1255
355 Ga0207711_10635003 3300025941 Bacteria 996
356 Ga0207661_10009339 3300025944 Bacteria 7029
357 Ga0207661_10363661 3300025944 Bacteria 1307
358 Ga0207661_10464503 3300025944 Bacteria 1154
359 Ga0207661_10554910 3300025944 Bacteria 1052
360 Ga0207661_11684950 3300025944 Bacteria 579
361 Ga0207661_11753891 3300025944 Unclassified 566
362 Ga0207661_11871332 3300025944 Bacteria 546
363 Ga0207679_10069901 3300025945 Bacteria 2644
364 Ga0207679_10343011 3300025945 Bacteria 1300
365 Ga0207667_10010408 3300025949 Bacteria 10874
366 Ga0207667_10074323 3300025949 Bacteria 3531
367 Ga0207667_10120834 3300025949 Bacteria 2700
368 Ga0207667_10641540 3300025949 Bacteria 1068
369 Ga0207667_10643600 3300025949 Unclassified 1066
370 Ga0207651_10075666 3300025960 Bacteria 2403
371 Ga0207651_10427469 3300025960 Bacteria 1132
372 Ga0207651_10828371 3300025960 Bacteria 821
373 Ga0207712_10154473 3300025961 Bacteria 1776
374 Ga0207658_10246636 3300025986 Bacteria 1516
375 Ga0207658_10343622 3300025986 Bacteria 1298
376 Ga0207658_11434469 3300025986 Bacteria 631
377 Ga0207677_10253825 3300026023 Unclassified 1430
378 Ga0207677_10661000 3300026023 Bacteria 923
379 Ga0207703_10011093 3300026035 Bacteria 7019
380 Ga0207703_10051823 3300026035 Bacteria 3329
381 Ga0207703_10160971 3300026035 Bacteria 1966
382 Ga0207703_10283120 3300026035 Bacteria 1506
383 Ga0207703_10416216 3300026035 Unclassified 1250
384 Ga0207639_10362579 3300026041 Bacteria 1297
385 Ga0207639_10797475 3300026041 Bacteria 880
386 Ga0207678_10106105 3300026067 Bacteria 2397
387 Ga0207678_10256780 3300026067 Bacteria 1497
388 Ga0207678_10568962 3300026067 Bacteria 992
389 Ga0207678_10751012 3300026067 Bacteria 860
390 Ga0207678_11730969 3300026067 Bacteria 548
391 Ga0207708_10612855 3300026075 Bacteria 923
392 Ga0207702_10012972 3300026078 Bacteria 6932
393 Ga0207702_10028665 3300026078 Bacteria 4628
394 Ga0207702_10170476 3300026078 Bacteria 1995
395 Ga0207702_10211796 3300026078 Bacteria 1802
396 Ga0207702_10344498 3300026078 Bacteria 1424
397 Ga0207702_10640984 3300026078 Bacteria 1044
398 Ga0207641_10130444 3300026088 Bacteria 2256
399 Ga0207641_10239130 3300026088 Bacteria 1691
400 Ga0207648_10089742 3300026089 Bacteria 2685
401 Ga0207648_10166054 3300026089 Unclassified 1951
402 Ga0207676_10009235 3300026095 Bacteria 7016
403 Ga0207676_10282081 3300026095 Bacteria 1509
404 Ga0207676_10285600 3300026095 Bacteria 1500
405 Ga0207674_10001360 3300026116 Bacteria 31646
406 Ga0207674_10034500 3300026116 Bacteria 5287
407 Ga0207674_10061761 3300026116 Bacteria 3785
408 Ga0207674_10357096 3300026116 Bacteria 1413
409 Ga0207674_10596329 3300026116 Bacteria 1067
410 Ga0207674_10668003 3300026116 Unclassified 1003
411 Ga0207674_12208324 3300026116 Bacteria 513
412 Ga0207675_100264228 3300026118 Bacteria 1668
413 Ga0207683_10453855 3300026121 Bacteria 1182
414 Ga0207683_11511896 3300026121 Bacteria 620
415 Ga0207683_12072415 3300026121 Unclassified 517
416 Ga0207698_10860877 3300026142 Bacteria 912
417 Ga0207698_11216535 3300026142 Bacteria 767
418 Ga0207698_11602123 3300026142 Bacteria 666
419 Ga0268266_10012734 3300028379 Bacteria 7268
420 Ga0268266_10130314 3300028379 Bacteria 2249
421 Ga0268266_10735570 3300028379 Bacteria 952
422 Ga0268264_10437451 3300028381 Bacteria 1264
423 Ga0268264_10631037 3300028381 Bacteria 1059
424 Ga0268264_11083331 3300028381 Bacteria 809
425 Ga0265318_10025155 3300028577 Bacteria 2354
426 Ga0265336_10132916 3300028666 Bacteria 741
427 Ga0265338_10038888 3300028800 Bacteria 4499
428 Ga0265338_10071461 3300028800 Bacteria 2968
429 Ga0265338_10442113 3300028800 Bacteria 922
430 Ga0265338_10864499 3300028800 Bacteria 617
431 Ga0265338_11001403 3300028800 Bacteria 566
432 Ga0265324_10022740 3300029957 Bacteria 2239
433 Ga0265762_1153596 3300030760 Unclassified 550
434 Ga0265762_1171340 3300030760 Unclassified 529
435 Ga0265332_10037525 3300031238 Bacteria 2101
436 Ga0265328_10005577 3300031239 Bacteria 5382
437 Ga0265320_10000699 3300031240 Bacteria 25600
438 Ga0265320_10342298 3300031240 Unclassified 661
439 Ga0265325_10108259 3300031241 Unclassified 1354
440 Ga0265325_10119908 3300031241 Bacteria 1269
441 Ga0265325_10187196 3300031241 Unclassified 961
442 Ga0265329_10046769 3300031242 Bacteria 1382
443 Ga0265340_10005654 3300031247 Bacteria 6915
444 Ga0265339_10038529 3300031249 Bacteria 2666
445 Ga0265331_10001349 3300031250 Bacteria 18084
446 Ga0265331_10232046 3300031250 Bacteria 829
447 Ga0265316_10011374 3300031344 Bacteria 8031
448 Ga0265316_10203129 3300031344 Bacteria 1468
449 Ga0265316_10602408 3300031344 Bacteria 779
450 Ga0265313_10077692 3300031595 Bacteria 1515
451 Ga0265314_10016159 3300031711 Bacteria 5909
452 Ga0265314_10487302 3300031711 Bacteria 651
453 Ga0307411_12016861 3300032005 Bacteria 539
454 Ga0373940_0302350 3300035088 Bacteria 551
455 Ga0373944_0302461 3300035089 Bacteria 600
456 Ga0373944_0403357 3300035089 Bacteria 527
457 Ga0373923_0107895 3300035111 Bacteria 1234
458 Ga0373954_0084127 3300035118 Bacteria 1523
459 Ga0373954_0103674 3300035118 Bacteria 1373
460 Ga0373946_0163278 3300035171 Unclassified 1047
461 Ga0373946_0338071 3300035171 Bacteria 751
462 Ga0373946_0405126 3300035171 Bacteria 689
463 Ga0373924_0349506 3300035410 Bacteria 659
464 Ga0373931_0907677 3300035691 Bacteria 592
465 Ga0373935_0345919 3300035692 Bacteria 1059
466 Ga0373927_0003515 3300035695 Bacteria 11212
467 Ga0373927_0334210 3300035695 Bacteria 998
468 Ga0373927_0508020 3300035695 Unclassified 796
469 Ga0373933_0286079 3300035724 Bacteria 1066
470 Ga0373947_0268700 3300035725 Bacteria 1132
471 Ga0373937_0219478 3300036401 Bacteria 1790
472 Ga0373937_1614458 3300036401 Bacteria 596
473 Ga0373937_1749189 3300036401 Unclassified 568
474 Ga0373925_0227329 3300037068 Bacteria 1491
475 Ga0373925_0697114 3300037068 Bacteria 837
476 Ga0373925_1299479 3300037068 Bacteria 597
477 Ga0395899_0855342 3300037312 Unclassified 558
478 Ga0395900_1360897 3300037418 Unclassified 623
479 Ga0395898_0526628 3300037466 Bacteria 1123
480 Ga0436364_0035099 3300037853 Bacteria 1696
481 Ga0436364_0048051 3300037853 Bacteria 2456
482 Ga0436364_0070019 3300037853 Unclassified 690
483 Ga0436364_0229975 3300037853 Bacteria 5848
484 Ga0436364_0377636 3300037853 Bacteria 1512
485 Ga0436364_0528777 3300037853 Bacteria 1813
486 Ga0436364_0622909 3300037853 Bacteria 3250
487 Ga0436364_0623247 3300037853 Bacteria 508
488 Ga0436364_0664919 3300037853 Bacteria 1415
489 Ga0436364_0667848 3300037853 Bacteria 4084
490 Ga0436364_0734554 3300037853 Bacteria 2620
491 Ga0436364_0751776 3300037853 Bacteria 1521
492 Ga0436364_0794034 3300037853 Bacteria 588
493 Ga0436364_0863882 3300037853 Bacteria 888
494 Ga0436364_0870750 3300037853 Bacteria 4065
495 Ga0436364_1061626 3300037853 Bacteria 2407
496 Ga0436364_1215117 3300037853 Bacteria 5349
497 Ga0436364_1215714 3300037853 Bacteria 690
498 Ga0436364_1548942 3300037853 Bacteria 22734
499 Ga0395901_0230857 3300038443 Bacteria 1932
500 Ga0436365_0202626 3300039437 Bacteria 36993
501 Ga0436365_0421335 3300039437 Bacteria 1089
502 Ga0436365_0998177 3300039437 Bacteria 578
503 Ga0436365_1501250 3300039437 Bacteria 1560
504 Ga0436365_1537436 3300039437 Bacteria 1204
505 Ga0436365_1554089 3300039437 Bacteria 1190
506 Ga0436365_1729618 3300039437 Bacteria 5017
507 Ga0436365_1931431 3300039437 Bacteria 2745
508 Ga0436360_0083561 3300039438 Bacteria 1039
509 Ga0436360_0172559 3300039438 Bacteria 969
510 Ga0436360_0271132 3300039438 Bacteria 1047
511 Ga0436360_0694917 3300039438 Unclassified 777
512 Ga0436360_0904588 3300039438 Unclassified 546
513 Ga0436361_0444282 3300039447 Bacteria 5811
514 Ga0436363_0045959 3300039450 Bacteria 2206
515 Ga0436363_0183618 3300039450 Unclassified 552
516 Ga0436363_0281991 3300039450 Bacteria 3746
517 Ga0436363_0517945 3300039450 Bacteria 701
518 Ga0436363_0622206 3300039450 Bacteria 1137
519 Ga0436363_1040338 3300039450 Bacteria 665
520 Ga0436363_1621455 3300039450 Bacteria 836
521 Ga0436362_0195703 3300039453 Bacteria 4763
522 Ga0436362_0315222 3300039453 Unclassified 1905
523 Ga0436362_1115860 3300039453 Bacteria 685
524 Ga0436362_1216928 3300039453 Unclassified 607
525 Ga0451798_0911612 3300041458 Bacteria 898
526 Ga0451577_1069650 3300042876 Bacteria 723
527 Ga0451577_1166675 3300042876 Bacteria 688
528 Ga0466966_0068852 3300044684 Unclassified 2221
529 Ga0466966_0461341 3300044684 Bacteria 764
530 Ga0466961_0414517 3300044693 Bacteria 817
531 Ga0453684_0909293 3300044712 Bacteria 942
532 Ga0466970_0265902 3300044765 Bacteria 963
533 Ga0466957_0205634 3300044842 Bacteria 1295
534 Ga0466957_0789482 3300044842 Bacteria 674
535 Ga0466960_0560111 3300044901 Bacteria 675
536 Ga0466959_0144865 3300045049 Bacteria 1677
537 Ga0466959_0318226 3300045049 Bacteria 1064
538 Ga0451576_0154940 3300045051 Bacteria 2390
539 Ga0451576_1254715 3300045051 Bacteria 773
540 Ga0466958_0410847 3300045836 Bacteria 874
541 Ga0466958_0724633 3300045836 Bacteria 648
542 Ga0466967_0412100 3300045976 Unclassified 1316
543 Ga0466967_0910184 3300045976 Bacteria 875
544 Ga0495592_0732044 3300046454 Unclassified 593
545 Ga0495603_0404208 3300046455 Bacteria 783
546 Ga0495651_0261647 3300046462 Bacteria 1177
547 Ga0495651_0641739 3300046462 Bacteria 666
548 Ga0495653_0589979 3300046463 Bacteria 684
549 Ga0495580_0005635 3300046472 Bacteria 10300
550 Ga0495580_0329599 3300046472 Unclassified 1037
551 Ga0495580_0372946 3300046472 Bacteria 965
552 Ga0495580_0988153 3300046472 Bacteria 537
553 Ga0495582_0208830 3300046473 Bacteria 1116
554 Ga0495664_0155778 3300046477 Unclassified 1386
555 Ga0495664_0913519 3300046477 Bacteria 513
556 Ga0495585_0426185 3300046492 Unclassified 637
557 Ga0495594_0411618 3300046499 Bacteria 769
558 Ga0495618_0281931 3300046514 Unclassified 1036
559 Ga0495628_0335911 3300046516 Bacteria 1113
560 Ga0495630_1215090 3300046517 Bacteria 570
561 Ga0495666_0096975 3300046526 Bacteria 1390
562 Ga0495666_0330427 3300046526 Bacteria 688
563 Ga0495665_0100640 3300046531 Bacteria 1517
564 Ga0495665_0155522 3300046531 Unclassified 1193
565 Ga0495640_0148406 3300046533 Unclassified 1508
566 Ga0495640_0338544 3300046533 Bacteria 930
567 Ga0495587_0092842 3300046536 Bacteria 1743
568 Ga0495587_0747872 3300046536 Bacteria 535
569 Ga0495645_0395876 3300046543 Bacteria 881
570 Ga0495645_0826182 3300046543 Bacteria 554
571 Ga0495645_0885064 3300046543 Unclassified 531
572 Ga0495667_0107680 3300046559 Bacteria 1801
573 Ga0495667_0906349 3300046559 Bacteria 540
574 Ga0495635_0396738 3300046663 Bacteria 917
575 Ga0495657_0319465 3300046675 Bacteria 923
576 Ga0495599_0469316 3300046678 Unclassified 743
577 Ga0495658_0150784 3300046683 Bacteria 1428
578 Ga0495613_0356765 3300046689 Unclassified 1003
579 Ga0495581_0543303 3300047315 Bacteria 675
580 Ga0495604_0819217 3300047317 Unclassified 585
581 Ga0495674_0072156 3300047319 Bacteria 2978
582 Ga0495674_0120964 3300047319 Bacteria 2212
583 Ga0495674_0849899 3300047319 Bacteria 707
584 Ga0495684_0001750 3300047471 Bacteria 17435
585 Ga0495684_0034344 3300047471 Unclassified 3891
586 Ga0495593_0333074 3300047673 Bacteria 759
587 Ga0495602_0083989 3300048088 Bacteria 2665
588 Ga0495614_0375688 3300048089 Bacteria 665
589 Ga0496104_0260956 3300048907 Bacteria 1645
590 Ga0496106_0381410 3300048909 Bacteria 1133
591 Ga0496106_0939571 3300048909 Bacteria 682
592 Ga0496107_0809189 3300048910 Bacteria 686
593 Ga0496110_1921623 3300048913 Bacteria 502
594 Ga0496112_0011140 3300048915 Bacteria 8199
595 Ga0496112_0186259 3300048915 Bacteria 2039
596 Ga0496112_0723718 3300048915 Bacteria 922
597 Ga0496114_0257164 3300048917 Bacteria 1537
598 Ga0496114_0400681 3300048917 Bacteria 1215
599 Ga0496114_0432321 3300048917 Bacteria 1166
600 Ga0496115_0014350 3300048918 Bacteria 5997
601 Ga0496115_0374873 3300048918 Bacteria 1158
602 Ga0496115_1230816 3300048918 Bacteria 561
603 Ga0496126_0048076 3300048929 Bacteria 3902
604 Ga0501032_0095030 3300049569 Bacteria 1976
605 Ga0501032_0502281 3300049569 Bacteria 775
606 Ga0501033_0024564 3300049570 Bacteria 4547
607 Ga0501034_0012244 3300049571 Bacteria 8864
608 Ga0501034_0371075 3300049571 Bacteria 1357
609 Ga0501036_0386874 3300049572 Bacteria 1167
610 Ga0501037_0313382 3300049573 Bacteria 1087
611 Ga0501038_0150356 3300049574 Bacteria 1899
612 Ga0501038_0363171 3300049574 Bacteria 1126
613 Ga0501043_0198009 3300049579 Bacteria 1560
614 Ga0501043_0760002 3300049579 Bacteria 704
615 Ga0501047_0013124 3300049581 Bacteria 7847
616 Ga0501047_0200163 3300049581 Bacteria 1858
617 Ga0501048_0464579 3300049582 Bacteria 907
618 Ga0501068_0502059 3300049584 Bacteria 787
619 Ga0501070_0003186 3300049586 Bacteria 14271
620 Ga0501070_0050421 3300049586 Bacteria 3456
621 Ga0501073_0334862 3300049589 Bacteria 1045
622 Ga0501080_0095782 3300049742 Bacteria 2756
623 Ga0501080_0669626 3300049742 Bacteria 917
624 Ga0501083_0507193 3300049744 Bacteria 785
625 Ga0501035_0022462 3300049822 Bacteria 5794
626 Ga0501035_0121583 3300049822 Bacteria 2282
627 Ga0501044_0002342 3300049823 Bacteria 21610
628 Ga0501044_0020698 3300049823 Bacteria 7022
629 Ga0501044_0031527 3300049823 Bacteria 5579
630 Ga0501044_0408407 3300049823 Bacteria 1269
631 nmdc:mga06r32_26665_c1 3300050510 Bacteria 5390
632 Ga0495619_0250657 3300053085 Bacteria 1227
633 Ga0501082_1057504 3300060353 Bacteria 710
634 Ga0466962_0082926 3300061719 Bacteria 1534
635 Ga0451835_1151736
636 Ga0070658_10868414
637 Ga0070658_10950837
638 Ga0070676_10784128
639 Ga0070683_100010411
640 Ga0070683_100549849
641 Ga0070683_100619100
642 Ga0070683_100790107
643 Ga0070683_102008359
644 Ga0070690_100760655
645 Ga0068869_100875972
646 Ga0070666_10409379
647 Ga0068868_100034862
648 Ga0068868_100325879
649 Ga0068868_100724130
650 Ga0070660_100015095
651 Ga0070689_100202224
652 Ga0070689_100302376
653 Ga0070689_100673181
654 Ga0070687_100621156
655 Ga0070671_100121530
656 Ga0070674_101952398
657 Ga0070673_100060705
658 Ga0070673_100898865
659 Ga0070688_100131658
660 Ga0070688_100596001
661 Ga0070659_100013719
662 Ga0070659_100092758
663 Ga0070659_101342163
664 Ga0070667_100156307
665 Ga0070667_100183215
666 Ga0070709_10028286
667 Ga0070709_11122000
668 Ga0070710_11243593
669 Ga0070711_100125623
670 Ga0070711_100269964
671 Ga0070705_101743168
672 Ga0070694_100805304
673 Ga0070694_101419648
674 Ga0070663_100031840
675 Ga0070663_100128003
676 Ga0070663_100400825
677 Ga0070678_100603667
678 Ga0070678_101228500
679 Ga0070678_102308917
680 Ga0070662_100150920
681 Ga0070662_101822049
682 Ga0070681_10045451
683 Ga0070681_10069265
684 Ga0070681_10257065
685 Ga0070681_10319898
686 Ga0070681_10413191
687 Ga0070681_11149579
688 Ga0070681_11623956
689 Ga0068867_100046218
690 Ga0068867_100436219
691 Ga0070698_101495190
692 Ga0070699_101040834
693 Ga0070679_100093521
694 Ga0070679_100127295
695 Ga0070679_100223079
696 Ga0070679_100312499
697 Ga0070679_100367494
698 Ga0070679_100415362
699 Ga0070679_101405912
700 Ga0070679_102202820
701 Ga0070684_100224853
702 Ga0070684_100251801
703 Ga0070684_100253516
704 Ga0070697_101770435
705 Ga0068853_100096953
706 Ga0068853_100304248
707 Ga0068853_100428870
708 Ga0068853_100721319
709 Ga0070672_101421245
710 Ga0070686_100414450
711 Ga0070695_101313187
712 Ga0070693_100589954
713 Ga0070665_100010110
714 Ga0070665_100127363
715 Ga0070665_100351836
716 Ga0070665_100580684
717 Ga0070665_100812797
718 Ga0070704_100188505
719 Ga0068855_100018469
720 Ga0068855_100023314
721 Ga0068855_100156336
722 Ga0068855_100601822
723 Ga0068855_100853643
724 Ga0068855_100985583
725 Ga0068855_101148531
726 Ga0068855_102248981
727 Ga0070664_100111271
728 Ga0070664_100238481
729 Ga0070664_101632895
730 Ga0070664_101924737
731 Ga0068857_100057260
732 Ga0068857_100401948
733 Ga0068857_100402984
734 Ga0068857_101076426
735 Ga0068856_100001755
736 Ga0068856_100022608
737 Ga0068856_100122998
738 Ga0068856_100492693
739 Ga0068856_100529965
740 Ga0068856_101834332
741 Ga0070702_101417385
742 Ga0068852_100835130
743 Ga0068852_101644754
744 Ga0068859_100111352
745 Ga0068859_101829065
746 Ga0068864_100010446
747 Ga0068864_100356843
748 Ga0068864_100436581
749 Ga0068866_10082256
750 Ga0068866_10475186
751 Ga0068866_10503600
752 Ga0068861_101077811
753 Ga0068851_10074235
754 Ga0068863_100047600
755 Ga0068863_100155890
756 Ga0068863_101920807
757 Ga0068858_100021987
758 Ga0068858_100360788
759 Ga0068858_101093572
760 Ga0068860_100388481
761 Ga0068860_100409779
762 Ga0068860_100663124
763 Ga0068860_102090583
764 Ga0081540_1133892
765 Ga0070717_10054054
766 Ga0070715_10857548
767 Ga0070712_100304352
768 Ga0070712_101141971
769 Ga0097621_100004895
770 Ga0097621_100033233
771 Ga0097621_100066138
772 Ga0097621_100128077
773 Ga0097621_100128103
774 Ga0097621_100349462
775 Ga0097621_100405364
776 Ga0097621_102200059
777 Ga0068871_100003469
778 Ga0068871_100125799
779 Ga0068871_100180089
780 Ga0068871_101046415
781 Ga0068871_101525736
782 Ga0075430_100095041
783 Ga0075431_100032058
784 Ga0075434_100535661
785 Ga0075434_102445936
786 Ga0068865_100200272
787 Ga0068865_101332805
788 Ga0097620_100111353
789 Ga0097620_101828816
790 Ga0075435_101841903
791 Ga0105240_10002132
792 Ga0105240_10005509
793 Ga0105240_10005577
794 Ga0105240_10262921
795 Ga0105240_10369795
796 Ga0105240_10786746
797 Ga0105240_11218400
798 Ga0105245_10032993
799 Ga0105245_10110493
800 Ga0105245_10149779
801 Ga0105245_10206104
802 Ga0105245_10615439
803 Ga0105245_10739452
804 Ga0105247_10112516
805 Ga0105247_10172955
806 Ga0105243_10011515
807 Ga0105243_10095253
808 Ga0105243_10483924
809 Ga0105243_11251653
810 Ga0105241_10049952
811 Ga0105241_10056037
812 Ga0105241_10306147
813 Ga0105241_10402518
814 Ga0105241_10595226
815 Ga0105242_10035269
816 Ga0105242_10042188
817 Ga0105242_10105231
818 Ga0105248_10542339
819 Ga0105248_10580000
820 Ga0105248_10999867
821 Ga0105248_11305756
822 Ga0105248_11437602
823 Ga0105237_10001641
824 Ga0105237_10206619
825 Ga0105237_10280136
826 Ga0105237_10459285
827 Ga0105237_10491976
828 Ga0105237_10546830
829 Ga0105237_10771924
830 Ga0105237_11440274
831 Ga0105238_10024088
832 Ga0105238_10029359
833 Ga0105238_10169675
834 Ga0105238_10329126
835 Ga0105238_11432995
836 Ga0105249_10247348
837 Ga0105239_10035735
838 Ga0105239_10051805
839 Ga0105239_10156846
840 Ga0105239_10195280
841 Ga0105239_11890344
842 Ga0105239_12307068
843 Ga0105246_10017625
844 Ga0105246_10529037
845 Ga0157373_10055773
846 Ga0157373_10221445
847 Ga0157373_10242654
848 Ga0157371_10113175
849 Ga0157371_10167702
850 Ga0157371_11026595
851 Ga0157370_10085202
852 Ga0157370_10146922
853 Ga0157370_10207497
854 Ga0157370_10229766
855 Ga0157370_10418470
856 Ga0157369_10002412
857 Ga0157369_10079538
858 Ga0157369_10183057
859 Ga0157369_10320375
860 Ga0157369_10339288
861 Ga0157369_11043203
862 Ga0157369_11079173
863 Ga0157374_10018232
864 Ga0157374_10096930
865 Ga0157374_10308105
866 Ga0157374_11838296
867 Ga0157378_10296067
868 Ga0157378_11642851
869 Ga0163162_10032302
870 Ga0163162_10051884
871 Ga0163162_10385663
872 Ga0163162_11176079
873 Ga0163162_12725947
874 Ga0157372_10101910
875 Ga0157372_10231329
876 Ga0157372_10378575
877 Ga0157372_10783737
878 Ga0157372_12309904
879 Ga0157372_13334233
880 Ga0157375_10126797
881 Ga0157375_10266736
882 Ga0157375_11015337
883 Ga0157375_11044175
884 Ga0163163_10005820
885 Ga0163163_10879475
886 Ga0163163_11166311
887 Ga0163163_11432941
888 Ga0163163_12623102
889 Ga0157380_10468907
890 Ga0157380_12596182
891 Ga0157380_13052876
892 Ga0157379_10251986
893 Ga0157379_10961162
894 Ga0157376_10015634
895 Ga0157376_10184993
896 Ga0157376_10210295
897 Ga0157376_10233204
898 Ga0157376_10835245
899 Ga0157376_11133671
900 Ga0157376_11250753
901 Ga0157376_11381492
902 Ga0157376_11420835
903 Ga0157376_12736628
904 Ga0163161_10989776
905 Ga0197907_10155810
906 Ga0206349_1764162
907 Ga0206352_11203009
908 Ga0206353_11494669
909 Ga0213873_10260469
910 Ga0213872_10127618
911 Ga0213874_10406411
912 Ga0213876_10001745
913 Ga0213876_10003328
914 Ga0213876_10495612
915 Ga0213875_10002100
916 Ga0213875_10015687
917 Ga0213875_10043211
918 Ga0213875_10049507
919 Ga0213875_10062124
920 Ga0213875_10174328
921 Ga0213875_10179522
922 Ga0213875_10382580
923 Ga0213875_10576386
924 Ga0213875_10579307
925 Ga0213871_10117468
926 Ga0224712_10159436
927 Ga0207642_10562656
928 Ga0207680_10012685
929 Ga0207647_10217247
930 Ga0207645_10570859
931 Ga0207705_10780868
932 Ga0207654_10032216
933 Ga0207654_10041210
934 Ga0207654_10059331
935 Ga0207654_11015404
936 Ga0207707_10055505
937 Ga0207707_10070674
938 Ga0207707_10188531
939 Ga0207707_10351058
940 Ga0207707_10481519
941 Ga0207707_10605742
942 Ga0207695_10007356
943 Ga0207695_10014863
944 Ga0207695_10019753
945 Ga0207695_10169081
946 Ga0207695_10263238
947 Ga0207695_10518958
948 Ga0207695_10735354
949 Ga0207671_10130027
950 Ga0207671_10398834
951 Ga0207671_10729089
952 Ga0207693_10552137
953 Ga0207693_10744615
954 Ga0207660_10171058
955 Ga0207657_10249608
956 Ga0207652_10172124
957 Ga0207652_10692723
958 Ga0207652_11023794
959 Ga0207694_10054961
960 Ga0207694_10346756
961 Ga0207694_10812915
962 Ga0207659_10273528
963 Ga0207659_10289013
964 Ga0207687_10048444
965 Ga0207687_10084275
966 Ga0207687_10219347
967 Ga0207687_10458658
968 Ga0207687_11051405
969 Ga0207700_10009991
970 Ga0207690_10024516
971 Ga0207706_11691413
972 Ga0207686_10009485
973 Ga0207686_10056016
974 Ga0207686_10066266
975 Ga0207686_10075090
976 Ga0207686_10940185
977 Ga0207709_10035196
978 Ga0207709_10077111
979 Ga0207670_10069556
980 Ga0207670_10322354
981 Ga0207670_10354299
982 Ga0207670_10814858
983 Ga0207669_11703281
984 Ga0207704_10073091
985 Ga0207704_10394205
986 Ga0207711_10155179
987 Ga0207711_10241059
988 Ga0207711_10413022
989 Ga0207711_10635003
990 Ga0207661_10009339
991 Ga0207661_10363661
992 Ga0207661_10464503
993 Ga0207661_10554910
994 Ga0207661_11684950
995 Ga0207661_11753891
996 Ga0207661_11871332
997 Ga0207679_10069901
998 Ga0207679_10343011
999 Ga0207667_10010408
1000 Ga0207667_10074323
1001 Ga0207667_10120834
1002 Ga0207667_10641540
1003 Ga0207667_10643600
1004 Ga0207651_10075666
1005 Ga0207651_10427469
1006 Ga0207651_10828371
1007 Ga0207712_10154473
1008 Ga0207658_10246636
1009 Ga0207658_10343622
1010 Ga0207658_11434469
1011 Ga0207677_10253825
1012 Ga0207677_10661000
1013 Ga0207703_10011093
1014 Ga0207703_10051823
1015 Ga0207703_10160971
1016 Ga0207703_10283120
1017 Ga0207703_10416216
1018 Ga0207639_10362579
1019 Ga0207639_10797475
1020 Ga0207678_10106105
1021 Ga0207678_10256780
1022 Ga0207678_10568962
1023 Ga0207678_10751012
1024 Ga0207678_11730969
1025 Ga0207708_10612855
1026 Ga0207702_10012972
1027 Ga0207702_10028665
1028 Ga0207702_10170476
1029 Ga0207702_10211796
1030 Ga0207702_10344498
1031 Ga0207702_10640984
1032 Ga0207641_10130444
1033 Ga0207641_10239130
1034 Ga0207648_10089742
1035 Ga0207648_10166054
1036 Ga0207676_10009235
1037 Ga0207676_10282081
1038 Ga0207676_10285600
1039 Ga0207674_10001360
1040 Ga0207674_10034500
1041 Ga0207674_10061761
1042 Ga0207674_10357096
1043 Ga0207674_10596329
1044 Ga0207674_10668003
1045 Ga0207674_12208324
1046 Ga0207675_100264228
1047 Ga0207683_10453855
1048 Ga0207683_11511896
1049 Ga0207683_12072415
1050 Ga0207698_10860877
1051 Ga0207698_11216535
1052 Ga0207698_11602123
1053 Ga0268266_10012734
1054 Ga0268266_10130314
1055 Ga0268266_10735570
1056 Ga0268264_10437451
1057 Ga0268264_10631037
1058 Ga0268264_11083331
1059 Ga0265318_10025155
1060 Ga0265336_10132916
1061 Ga0265338_10038888
1062 Ga0265338_10071461
1063 Ga0265338_10442113
1064 Ga0265338_10864499
1065 Ga0265338_11001403
1066 Ga0265324_10022740
1067 Ga0265762_1153596
1068 Ga0265762_1171340
1069 Ga0265332_10037525
1070 Ga0265328_10005577
1071 Ga0265320_10000699
1072 Ga0265320_10342298
1073 Ga0265325_10108259
1074 Ga0265325_10119908
1075 Ga0265325_10187196
1076 Ga0265329_10046769
1077 Ga0265340_10005654
1078 Ga0265339_10038529
1079 Ga0265331_10001349
1080 Ga0265331_10232046
1081 Ga0265316_10011374
1082 Ga0265316_10203129
1083 Ga0265316_10602408
1084 Ga0265313_10077692
1085 Ga0265314_10016159
1086 Ga0265314_10487302
1087 Ga0307411_12016861
1088 Ga0373940_0302350
1089 Ga0373944_0302461
1090 Ga0373944_0403357
1091 Ga0373923_0107895
1092 Ga0373954_0084127
1093 Ga0373954_0103674
1094 Ga0373946_0163278
1095 Ga0373946_0338071
1096 Ga0373946_0405126
1097 Ga0373924_0349506
1098 Ga0373931_0907677
1099 Ga0373935_0345919
1100 Ga0373927_0003515
1101 Ga0373927_0334210
1102 Ga0373927_0508020
1103 Ga0373933_0286079
1104 Ga0373947_0268700
1105 Ga0373937_0219478
1106 Ga0373937_1614458
1107 Ga0373937_1749189
1108 Ga0373925_0227329
1109 Ga0373925_0697114
1110 Ga0373925_1299479
1111 Ga0395899_0855342
1112 Ga0395900_1360897
1113 Ga0395898_0526628
1114 Ga0436364_0035099
1115 Ga0436364_0048051
1116 Ga0436364_0070019
1117 Ga0436364_0229975
1118 Ga0436364_0377636
1119 Ga0436364_0528777
1120 Ga0436364_0622909
1121 Ga0436364_0623247
1122 Ga0436364_0664919
1123 Ga0436364_0667848
1124 Ga0436364_0734554
1125 Ga0436364_0751776
1126 Ga0436364_0794034
1127 Ga0436364_0863882
1128 Ga0436364_0870750
1129 Ga0436364_1061626
1130 Ga0436364_1215117
1131 Ga0436364_1215714
1132 Ga0436364_1548942
1133 Ga0395901_0230857
1134 Ga0436365_0202626
1135 Ga0436365_0421335
1136 Ga0436365_0998177
1137 Ga0436365_1501250
1138 Ga0436365_1537436
1139 Ga0436365_1554089
1140 Ga0436365_1729618
1141 Ga0436365_1931431
1142 Ga0436360_0083561
1143 Ga0436360_0172559
1144 Ga0436360_0271132
1145 Ga0436360_0694917
1146 Ga0436360_0904588
1147 Ga0436361_0444282
1148 Ga0436363_0045959
1149 Ga0436363_0183618
1150 Ga0436363_0281991
1151 Ga0436363_0517945
1152 Ga0436363_0622206
1153 Ga0436363_1040338
1154 Ga0436363_1621455
1155 Ga0436362_0195703
1156 Ga0436362_0315222
1157 Ga0436362_1115860
1158 Ga0436362_1216928
1159 Ga0451798_0911612
1160 Ga0451577_1069650
1161 Ga0451577_1166675
1162 Ga0466966_0068852
1163 Ga0466966_0461341
1164 Ga0466961_0414517
1165 Ga0453684_0909293
1166 Ga0466970_0265902
1167 Ga0466957_0205634
1168 Ga0466957_0789482
1169 Ga0466960_0560111
1170 Ga0466959_0144865
1171 Ga0466959_0318226
1172 Ga0451576_0154940
1173 Ga0451576_1254715
1174 Ga0466958_0410847
1175 Ga0466958_0724633
1176 Ga0466967_0412100
1177 Ga0466967_0910184
1178 Ga0495592_0732044
1179 Ga0495603_0404208
1180 Ga0495651_0261647
1181 Ga0495651_0641739
1182 Ga0495653_0589979
1183 Ga0495580_0005635
1184 Ga0495580_0329599
1185 Ga0495580_0372946
1186 Ga0495580_0988153
1187 Ga0495582_0208830
1188 Ga0495664_0155778
1189 Ga0495664_0913519
1190 Ga0495585_0426185
1191 Ga0495594_0411618
1192 Ga0495618_0281931
1193 Ga0495628_0335911
1194 Ga0495630_1215090
1195 Ga0495666_0096975
1196 Ga0495666_0330427
1197 Ga0495665_0100640
1198 Ga0495665_0155522
1199 Ga0495640_0148406
1200 Ga0495640_0338544
1201 Ga0495587_0092842
1202 Ga0495587_0747872
1203 Ga0495645_0395876
1204 Ga0495645_0826182
1205 Ga0495645_0885064
1206 Ga0495667_0107680
1207 Ga0495667_0906349
1208 Ga0495635_0396738
1209 Ga0495657_0319465
1210 Ga0495599_0469316
1211 Ga0495658_0150784
1212 Ga0495613_0356765
1213 Ga0495581_0543303
1214 Ga0495604_0819217
1215 Ga0495674_0072156
1216 Ga0495674_0120964
1217 Ga0495674_0849899
1218 Ga0495684_0001750
1219 Ga0495684_0034344
1220 Ga0495593_0333074
1221 Ga0495602_0083989
1222 Ga0495614_0375688
1223 Ga0496104_0260956
1224 Ga0496106_0381410
1225 Ga0496106_0939571
1226 Ga0496107_0809189
1227 Ga0496110_1921623
1228 Ga0496112_0011140
1229 Ga0496112_0186259
1230 Ga0496112_0723718
1231 Ga0496114_0257164
1232 Ga0496114_0400681
1233 Ga0496114_0432321
1234 Ga0496115_0014350
1235 Ga0496115_0374873
1236 Ga0496115_1230816
1237 Ga0496126_0048076
1238 Ga0501032_0095030
1239 Ga0501032_0502281
1240 Ga0501033_0024564
1241 Ga0501034_0012244
1242 Ga0501034_0371075
1243 Ga0501036_0386874
1244 Ga0501037_0313382
1245 Ga0501038_0150356
1246 Ga0501038_0363171
1247 Ga0501043_0198009
1248 Ga0501043_0760002
1249 Ga0501047_0013124
1250 Ga0501047_0200163
1251 Ga0501048_0464579
1252 Ga0501068_0502059
1253 Ga0501070_0003186
1254 Ga0501070_0050421
1255 Ga0501073_0334862
1256 Ga0501080_0095782
1257 Ga0501080_0669626
1258 Ga0501083_0507193
1259 Ga0501035_0022462
1260 Ga0501035_0121583
1261 Ga0501044_0002342
1262 Ga0501044_0020698
1263 Ga0501044_0031527
1264 Ga0501044_0408407
1265 nmdc:mga06r32_26665_c1
1266 Ga0495619_0250657
1267 Ga0501082_1057504
1268 Ga0466962_0082926

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02575

YbaB_DNA_bd

YbaB/EbfC DNA-binding family

1

88

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pug-assembly2.cif.gz_D structure of e. coli ybab 0.9385 19 90
1pug-assembly2.cif.gz_C structure of e. coli ybab 0.9235 15 90
1pug-assembly1.cif.gz_B structure of e. coli ybab 0.8999 18 85
5yrx-assembly1.cif.gz_A-2 crystal structure of a hypothetical protein rv3716c from mycobacterium tuberculosis 0.8979 19 85
3sbc-assembly1.cif.gz_E crystal structure of saccharomyces cerevisiae tsa1c47s mutant protein 0.8938 39 55
ID Description Score Start End Superfamily
1pugB00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8999 18 85 3.30.1310.10
5yrxA00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8979 19 85 3.30.1310.10
af_Q4DVG2_30_117_3.30.1310.10 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8932 20 88 3.30.1310.10
1pugA00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8525 15 100 3.30.1310.10
5yrxA00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.84 19 85 3.30.1310.10
ID Description Score Start End GO Terms
AF-A0A7W7CNJ3-F1-model_v4 DNA-binding protein YbaB 0.947 6 83 GO:0003677
AF-A0A7C6ZKC2-F1-model_v4 YbaB/EbfC family nucleoid-associated protein 0.9396 14 93 GO:0003677
AF-A0A3C1A1Q4-F1-model_v4 Nucleoid-associated protein DCP08_05740 0.9383 11 95 GO:0003677
GO:0005829
GO:0043590
AF-A0A4R4W0G7-F1-model_v4 YbaB/EbfC family DNA-binding protein 0.9372 21 87 GO:0003677
AF-A0A376VP66-F1-model_v4 Nucleoid-associated protein YbaB 0.9351 19 92 GO:0003677
GO:0005829
GO:0043590

Map