F471182
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 634 | 316 | 634 | 91 |
Family's Representative Sequence
| Representative Sequence | 3300039450|Ga0436363_0078425|Ga0436363_0078425_167_499 |
| Length | 110 |
| Sequence | VQAHPVRIDRGRVLAISRLCFMCRNIRTLYNFDPPATEEEVRSAALQYVRKISGFNKPSRANEEAFARAVDAVALASTLLLDELRTTAPAKNRDVEAAKARARAAERFAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 126 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 127 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 128 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 195 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 200 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 213 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 215 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 217 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 218 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 219 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 220 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 221 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 222 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 223 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 224 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 225 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 226 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 227 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 228 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 229 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 230 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 231 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 232 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 233 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 234 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 235 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 236 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 237 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 238 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 239 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 240 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 241 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 242 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 243 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 244 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 245 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 265 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 266 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 267 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 268 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 272 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 273 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 274 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 275 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 276 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 277 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 278 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 307 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 308 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 309 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 310 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 311 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 312 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 313 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 314 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.21 |
| Metatranscriptomes | 0.79 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.42 |
| Nodule | 0 |
| Rhizoplane | 3.63 |
| Rhizosphere | 90.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_104125 | 2162886012 | Bacteria | 1271 |
| 2 | MBSR1b_contig_2996384 | 2162886012 | Bacteria | 1335 |
| 3 | MBSR1b_contig_3421288 | 2162886012 | Bacteria | 1897 |
| 4 | LJNas_1003048 | 3300000546 | Bacteria | 1959 |
| 5 | JGI25406J46586_10051518 | 3300003203 | Bacteria | 1377 |
| 6 | Ga0065704_10086353 | 3300005289 | Bacteria | 3122 |
| 7 | Ga0065715_10143431 | 3300005293 | Bacteria | 1820 |
| 8 | Ga0065715_10221217 | 3300005293 | Bacteria | 1271 |
| 9 | Ga0065707_10095199 | 3300005295 | Bacteria | 3401 |
| 10 | Ga0070658_10766877 | 3300005327 | Bacteria | 838 |
| 11 | Ga0070676_10009857 | 3300005328 | Bacteria | 5169 |
| 12 | Ga0070676_10041510 | 3300005328 | Bacteria | 2668 |
| 13 | Ga0070683_100813630 | 3300005329 | Bacteria | 896 |
| 14 | Ga0070683_101805545 | 3300005329 | Bacteria | 588 |
| 15 | Ga0070683_101920826 | 3300005329 | Unclassified | 569 |
| 16 | Ga0070690_100006698 | 3300005330 | Bacteria | 6544 |
| 17 | Ga0070690_100473012 | 3300005330 | Bacteria | 933 |
| 18 | Ga0070670_100002355 | 3300005331 | Bacteria | 15575 |
| 19 | Ga0070670_100034764 | 3300005331 | Bacteria | 4338 |
| 20 | Ga0068869_100002790 | 3300005334 | Bacteria | 10583 |
| 21 | Ga0068869_100118708 | 3300005334 | Bacteria | 2020 |
| 22 | Ga0070666_10170492 | 3300005335 | Bacteria | 1524 |
| 23 | Ga0070666_10367533 | 3300005335 | Unclassified | 1031 |
| 24 | Ga0070680_100029552 | 3300005336 | Bacteria | 4402 |
| 25 | Ga0070682_100001736 | 3300005337 | Bacteria | 12126 |
| 26 | Ga0068868_100021200 | 3300005338 | Bacteria | 4892 |
| 27 | Ga0068868_100053819 | 3300005338 | Bacteria | 3171 |
| 28 | Ga0070660_100024521 | 3300005339 | Bacteria | 4474 |
| 29 | Ga0070689_100008100 | 3300005340 | Bacteria | 7383 |
| 30 | Ga0070689_100038414 | 3300005340 | Unclassified | 3663 |
| 31 | Ga0070691_11055848 | 3300005341 | Bacteria | 510 |
| 32 | Ga0070687_101485726 | 3300005343 | Bacteria | 509 |
| 33 | Ga0070661_100008091 | 3300005344 | Bacteria | 7254 |
| 34 | Ga0070661_100008363 | 3300005344 | Bacteria | 7149 |
| 35 | Ga0070692_10153850 | 3300005345 | Bacteria | 1312 |
| 36 | Ga0070692_10217213 | 3300005345 | Bacteria | 1128 |
| 37 | Ga0070692_10828770 | 3300005345 | Bacteria | 634 |
| 38 | Ga0070668_100055509 | 3300005347 | Bacteria | 3057 |
| 39 | Ga0070669_100003871 | 3300005353 | Bacteria | 10821 |
| 40 | Ga0070669_100051843 | 3300005353 | Bacteria | 3000 |
| 41 | Ga0070669_100102332 | 3300005353 | Unclassified | 2163 |
| 42 | Ga0070675_101346700 | 3300005354 | Unclassified | 658 |
| 43 | Ga0070671_100294056 | 3300005355 | Bacteria | 1382 |
| 44 | Ga0070674_100779752 | 3300005356 | Unclassified | 824 |
| 45 | Ga0070674_102069444 | 3300005356 | Bacteria | 519 |
| 46 | Ga0070673_100013779 | 3300005364 | Bacteria | 5608 |
| 47 | Ga0070673_100361818 | 3300005364 | Unclassified | 1290 |
| 48 | Ga0070659_100004587 | 3300005366 | Bacteria | 9884 |
| 49 | Ga0070659_100106780 | 3300005366 | Bacteria | 2257 |
| 50 | Ga0070659_100263651 | 3300005366 | Unclassified | 1430 |
| 51 | Ga0070667_100164838 | 3300005367 | Bacteria | 1954 |
| 52 | Ga0070703_10004880 | 3300005406 | Bacteria | 3747 |
| 53 | Ga0070709_10105418 | 3300005434 | Bacteria | 1885 |
| 54 | Ga0070709_10813100 | 3300005434 | Unclassified | 734 |
| 55 | Ga0070714_100018859 | 3300005435 | Bacteria | 5612 |
| 56 | Ga0070714_100495330 | 3300005435 | Bacteria | 1165 |
| 57 | Ga0070713_100110388 | 3300005436 | Bacteria | 2397 |
| 58 | Ga0070713_100253800 | 3300005436 | Bacteria | 1605 |
| 59 | Ga0070713_100946618 | 3300005436 | Bacteria | 829 |
| 60 | Ga0070713_100962330 | 3300005436 | Bacteria | 823 |
| 61 | Ga0070713_101424173 | 3300005436 | Bacteria | 672 |
| 62 | Ga0070710_10028231 | 3300005437 | Bacteria | 2999 |
| 63 | Ga0070710_10267863 | 3300005437 | Bacteria | 1104 |
| 64 | Ga0070710_10268253 | 3300005437 | Bacteria | 1103 |
| 65 | Ga0070710_10559373 | 3300005437 | Bacteria | 791 |
| 66 | Ga0070701_10005017 | 3300005438 | Bacteria | 5427 |
| 67 | Ga0070701_10052223 | 3300005438 | Bacteria | 2123 |
| 68 | Ga0070701_10377923 | 3300005438 | Unclassified | 892 |
| 69 | Ga0070711_100365898 | 3300005439 | Unclassified | 1162 |
| 70 | Ga0070711_100463548 | 3300005439 | Bacteria | 1039 |
| 71 | Ga0070711_100666069 | 3300005439 | Bacteria | 874 |
| 72 | Ga0070705_100004665 | 3300005440 | Bacteria | 6674 |
| 73 | Ga0070700_100285073 | 3300005441 | Bacteria | 1199 |
| 74 | Ga0070700_100305595 | 3300005441 | Bacteria | 1163 |
| 75 | Ga0070700_100391751 | 3300005441 | Bacteria | 1042 |
| 76 | Ga0070700_101398380 | 3300005441 | Unclassified | 591 |
| 77 | Ga0070694_100001325 | 3300005444 | Bacteria | 14426 |
| 78 | Ga0070694_100087251 | 3300005444 | Bacteria | 2182 |
| 79 | Ga0070708_100009402 | 3300005445 | Bacteria | 7881 |
| 80 | Ga0070678_100527176 | 3300005456 | Bacteria | 1046 |
| 81 | Ga0070678_100675651 | 3300005456 | Unclassified | 928 |
| 82 | Ga0070662_100009319 | 3300005457 | Bacteria | 6416 |
| 83 | Ga0070662_100075190 | 3300005457 | Unclassified | 2501 |
| 84 | Ga0070662_100258263 | 3300005457 | Unclassified | 1403 |
| 85 | Ga0070681_10013232 | 3300005458 | Bacteria | 8198 |
| 86 | Ga0070681_11802011 | 3300005458 | Unclassified | 539 |
| 87 | Ga0068867_100019066 | 3300005459 | Bacteria | 4884 |
| 88 | Ga0068867_100670483 | 3300005459 | Unclassified | 912 |
| 89 | Ga0068867_101842279 | 3300005459 | Unclassified | 569 |
| 90 | Ga0070685_10311886 | 3300005466 | Unclassified | 1063 |
| 91 | Ga0070706_100093860 | 3300005467 | Bacteria | 2784 |
| 92 | Ga0070706_100153517 | 3300005467 | Bacteria | 2150 |
| 93 | Ga0070707_100010243 | 3300005468 | Bacteria | 8730 |
| 94 | Ga0070698_100001773 | 3300005471 | Bacteria | 24065 |
| 95 | Ga0070698_100005766 | 3300005471 | Bacteria | 13541 |
| 96 | Ga0070698_100013373 | 3300005471 | Bacteria | 8688 |
| 97 | Ga0070698_100124822 | 3300005471 | Bacteria | 2531 |
| 98 | Ga0070698_100403485 | 3300005471 | Bacteria | 1300 |
| 99 | Ga0070698_100434165 | 3300005471 | Bacteria | 1248 |
| 100 | Ga0070699_100008100 | 3300005518 | Bacteria | 9125 |
| 101 | Ga0070699_100014890 | 3300005518 | Bacteria | 6686 |
| 102 | Ga0070699_100650562 | 3300005518 | Bacteria | 962 |
| 103 | Ga0070699_101109977 | 3300005518 | Bacteria | 725 |
| 104 | Ga0070679_100095939 | 3300005530 | Unclassified | 2953 |
| 105 | Ga0070679_100188270 | 3300005530 | Bacteria | 2033 |
| 106 | Ga0070684_100178225 | 3300005535 | Bacteria | 1932 |
| 107 | Ga0070697_100150157 | 3300005536 | Bacteria | 1963 |
| 108 | Ga0070697_100267237 | 3300005536 | Bacteria | 1465 |
| 109 | Ga0070697_101078919 | 3300005536 | Bacteria | 714 |
| 110 | Ga0068853_100001254 | 3300005539 | Bacteria | 18128 |
| 111 | Ga0068853_100035656 | 3300005539 | Bacteria | 4226 |
| 112 | Ga0068853_100176501 | 3300005539 | Bacteria | 1935 |
| 113 | Ga0070672_100058839 | 3300005543 | Unclassified | 3022 |
| 114 | Ga0070672_101026309 | 3300005543 | Unclassified | 731 |
| 115 | Ga0070672_101302223 | 3300005543 | Bacteria | 649 |
| 116 | Ga0070686_100133801 | 3300005544 | Bacteria | 1718 |
| 117 | Ga0070686_100574030 | 3300005544 | Bacteria | 885 |
| 118 | Ga0070686_101118342 | 3300005544 | Bacteria | 651 |
| 119 | Ga0070695_100059343 | 3300005545 | Bacteria | 2476 |
| 120 | Ga0070695_100092549 | 3300005545 | Bacteria | 2021 |
| 121 | Ga0070695_100648881 | 3300005545 | Unclassified | 833 |
| 122 | Ga0070695_100849832 | 3300005545 | Bacteria | 734 |
| 123 | Ga0070696_100008469 | 3300005546 | Bacteria | 6882 |
| 124 | Ga0070696_100210842 | 3300005546 | Bacteria | 1454 |
| 125 | Ga0070696_100440023 | 3300005546 | Bacteria | 1027 |
| 126 | Ga0070696_101353376 | 3300005546 | Unclassified | 606 |
| 127 | Ga0070693_100000335 | 3300005547 | Bacteria | 21488 |
| 128 | Ga0070693_100006162 | 3300005547 | Bacteria | 5809 |
| 129 | Ga0070693_101156594 | 3300005547 | Unclassified | 592 |
| 130 | Ga0070665_100281208 | 3300005548 | Bacteria | 1666 |
| 131 | Ga0070704_100002702 | 3300005549 | Bacteria | 10024 |
| 132 | Ga0070704_100038598 | 3300005549 | Bacteria | 3273 |
| 133 | Ga0070704_100170849 | 3300005549 | Bacteria | 1729 |
| 134 | Ga0070704_100212046 | 3300005549 | Bacteria | 1570 |
| 135 | Ga0070704_100417639 | 3300005549 | Bacteria | 1148 |
| 136 | Ga0070704_100703663 | 3300005549 | Unclassified | 896 |
| 137 | Ga0070704_101030125 | 3300005549 | Bacteria | 745 |
| 138 | Ga0068855_100025398 | 3300005563 | Bacteria | 7089 |
| 139 | Ga0068855_100028649 | 3300005563 | Bacteria | 6663 |
| 140 | Ga0068855_100586151 | 3300005563 | Bacteria | 1204 |
| 141 | Ga0068855_100649612 | 3300005563 | Unclassified | 1133 |
| 142 | Ga0070664_100016128 | 3300005564 | Bacteria | 6124 |
| 143 | Ga0070664_101994409 | 3300005564 | Unclassified | 551 |
| 144 | Ga0068857_100008113 | 3300005577 | Bacteria | 9065 |
| 145 | Ga0068857_100305365 | 3300005577 | Bacteria | 1467 |
| 146 | Ga0068857_100485090 | 3300005577 | Unclassified | 1159 |
| 147 | Ga0068857_100722783 | 3300005577 | Bacteria | 947 |
| 148 | Ga0068854_100033226 | 3300005578 | Bacteria | 3596 |
| 149 | Ga0068854_100354843 | 3300005578 | Bacteria | 1201 |
| 150 | Ga0068854_100584774 | 3300005578 | Unclassified | 951 |
| 151 | Ga0068854_102012297 | 3300005578 | Unclassified | 532 |
| 152 | Ga0068856_100006379 | 3300005614 | Bacteria | 11569 |
| 153 | Ga0068856_100196451 | 3300005614 | Bacteria | 2031 |
| 154 | Ga0068856_100586400 | 3300005614 | Unclassified | 1136 |
| 155 | Ga0070702_100084587 | 3300005615 | Bacteria | 1908 |
| 156 | Ga0068852_102237791 | 3300005616 | Unclassified | 568 |
| 157 | Ga0068859_100002405 | 3300005617 | Bacteria | 19058 |
| 158 | Ga0068859_100968764 | 3300005617 | Unclassified | 933 |
| 159 | Ga0068859_102211091 | 3300005617 | Unclassified | 607 |
| 160 | Ga0068864_100040924 | 3300005618 | Bacteria | 3963 |
| 161 | Ga0068864_100212170 | 3300005618 | Bacteria | 1783 |
| 162 | Ga0068864_102490985 | 3300005618 | Unclassified | 524 |
| 163 | Ga0068866_10034207 | 3300005718 | Bacteria | 2473 |
| 164 | Ga0068861_100000163 | 3300005719 | Bacteria | 34909 |
| 165 | Ga0068861_100057055 | 3300005719 | Bacteria | 2982 |
| 166 | Ga0068861_100070432 | 3300005719 | Bacteria | 2708 |
| 167 | Ga0068861_100100594 | 3300005719 | Bacteria | 2298 |
| 168 | Ga0068851_10170100 | 3300005834 | Bacteria | 1202 |
| 169 | Ga0068851_10414898 | 3300005834 | Bacteria | 794 |
| 170 | Ga0068870_10001702 | 3300005840 | Bacteria | 8994 |
| 171 | Ga0068870_10013234 | 3300005840 | Unclassified | 3874 |
| 172 | Ga0068870_11462542 | 3300005840 | Unclassified | 502 |
| 173 | Ga0068863_100004794 | 3300005841 | Bacteria | 13325 |
| 174 | Ga0068863_100065655 | 3300005841 | Bacteria | 3433 |
| 175 | Ga0068858_100132018 | 3300005842 | Bacteria | 2342 |
| 176 | Ga0068858_101258941 | 3300005842 | Bacteria | 728 |
| 177 | Ga0068860_100002551 | 3300005843 | Bacteria | 19035 |
| 178 | Ga0068860_100168623 | 3300005843 | Bacteria | 2114 |
| 179 | Ga0068860_101047112 | 3300005843 | Bacteria | 834 |
| 180 | Ga0068862_100003160 | 3300005844 | Bacteria | 14318 |
| 181 | Ga0068862_100053469 | 3300005844 | Bacteria | 3457 |
| 182 | Ga0068862_100253313 | 3300005844 | Bacteria | 1605 |
| 183 | Ga0068862_100553702 | 3300005844 | Bacteria | 1098 |
| 184 | Ga0081538_10022655 | 3300005981 | Bacteria | 4545 |
| 185 | Ga0081539_10000062 | 3300005985 | Bacteria | 249871 |
| 186 | Ga0081539_10003923 | 3300005985 | Bacteria | 17274 |
| 187 | Ga0070717_10003878 | 3300006028 | Bacteria | 10751 |
| 188 | Ga0070717_10012210 | 3300006028 | Bacteria | 6550 |
| 189 | Ga0070717_10662004 | 3300006028 | Unclassified | 948 |
| 190 | Ga0070717_10759689 | 3300006028 | Bacteria | 881 |
| 191 | Ga0070717_11209429 | 3300006028 | Bacteria | 687 |
| 192 | Ga0070717_11268331 | 3300006028 | Bacteria | 670 |
| 193 | Ga0075365_10396674 | 3300006038 | Bacteria | 974 |
| 194 | Ga0070715_10076171 | 3300006163 | Bacteria | 1511 |
| 195 | Ga0070712_100014619 | 3300006175 | Bacteria | 5038 |
| 196 | Ga0070712_100086099 | 3300006175 | Bacteria | 2289 |
| 197 | Ga0070712_100236816 | 3300006175 | Bacteria | 1452 |
| 198 | Ga0070712_100279665 | 3300006175 | Bacteria | 1344 |
| 199 | Ga0070712_101113261 | 3300006175 | Bacteria | 686 |
| 200 | Ga0097621_100230914 | 3300006237 | Bacteria | 1615 |
| 201 | Ga0068871_100152968 | 3300006358 | Bacteria | 1968 |
| 202 | Ga0068871_100743294 | 3300006358 | Bacteria | 901 |
| 203 | Ga0075428_102583565 | 3300006844 | Bacteria | 519 |
| 204 | Ga0075431_100102179 | 3300006847 | Unclassified | 2958 |
| 205 | Ga0075431_101242366 | 3300006847 | Bacteria | 707 |
| 206 | Ga0075433_10172524 | 3300006852 | Bacteria | 1924 |
| 207 | Ga0075433_10370015 | 3300006852 | Bacteria | 1266 |
| 208 | Ga0075433_10426633 | 3300006852 | Bacteria | 1169 |
| 209 | Ga0075434_100006197 | 3300006871 | Bacteria | 10954 |
| 210 | Ga0075434_100902266 | 3300006871 | Bacteria | 899 |
| 211 | Ga0075434_101326629 | 3300006871 | Bacteria | 730 |
| 212 | Ga0075434_101975356 | 3300006871 | Bacteria | 589 |
| 213 | Ga0068865_100101094 | 3300006881 | Bacteria | 2111 |
| 214 | Ga0068865_100610102 | 3300006881 | Bacteria | 923 |
| 215 | Ga0068865_100656989 | 3300006881 | Bacteria | 892 |
| 216 | Ga0075436_100037583 | 3300006914 | Bacteria | 3342 |
| 217 | Ga0075436_100581710 | 3300006914 | Bacteria | 824 |
| 218 | Ga0075436_101486330 | 3300006914 | Unclassified | 514 |
| 219 | Ga0097620_100002405 | 3300006931 | Bacteria | 19058 |
| 220 | Ga0097620_100968740 | 3300006931 | Unclassified | 933 |
| 221 | Ga0097620_102210937 | 3300006931 | Unclassified | 607 |
| 222 | Ga0075435_100016421 | 3300007076 | Bacteria | 5582 |
| 223 | Ga0075435_100019798 | 3300007076 | Bacteria | 5148 |
| 224 | Ga0099794_10152978 | 3300007265 | Bacteria | 1171 |
| 225 | Ga0099794_10565215 | 3300007265 | Bacteria | 601 |
| 226 | Ga0105240_10723779 | 3300009093 | Bacteria | 1084 |
| 227 | Ga0111539_10013648 | 3300009094 | Bacteria | 10147 |
| 228 | Ga0111539_10413431 | 3300009094 | Bacteria | 1571 |
| 229 | Ga0111539_11746667 | 3300009094 | Bacteria | 721 |
| 230 | Ga0105245_10061912 | 3300009098 | Unclassified | 3375 |
| 231 | Ga0105245_11556027 | 3300009098 | Bacteria | 713 |
| 232 | Ga0105247_10005587 | 3300009101 | Bacteria | 7896 |
| 233 | Ga0105247_10008746 | 3300009101 | Bacteria | 6179 |
| 234 | Ga0105247_11402760 | 3300009101 | Bacteria | 565 |
| 235 | Ga0105247_11678451 | 3300009101 | Unclassified | 524 |
| 236 | Ga0114129_10136578 | 3300009147 | Bacteria | 3364 |
| 237 | Ga0114129_10407162 | 3300009147 | Bacteria | 1792 |
| 238 | Ga0114129_11113868 | 3300009147 | Bacteria | 988 |
| 239 | Ga0105243_10312776 | 3300009148 | Unclassified | 1428 |
| 240 | Ga0105243_10667833 | 3300009148 | Bacteria | 1009 |
| 241 | Ga0105243_11181270 | 3300009148 | Bacteria | 777 |
| 242 | Ga0105241_10017336 | 3300009174 | Bacteria | 5290 |
| 243 | Ga0105242_10358714 | 3300009176 | Unclassified | 1349 |
| 244 | Ga0105248_10012708 | 3300009177 | Bacteria | 9292 |
| 245 | Ga0105248_10803476 | 3300009177 | Bacteria | 1062 |
| 246 | Ga0105237_10159675 | 3300009545 | Bacteria | 2252 |
| 247 | Ga0105238_10023340 | 3300009551 | Bacteria | 6306 |
| 248 | Ga0105249_10029307 | 3300009553 | Unclassified | 4970 |
| 249 | Ga0105249_10328769 | 3300009553 | Bacteria | 1542 |
| 250 | Ga0105249_11505123 | 3300009553 | Bacteria | 745 |
| 251 | Ga0105249_13524712 | 3300009553 | Bacteria | 504 |
| 252 | Ga0105239_10076899 | 3300010375 | Bacteria | 3671 |
| 253 | Ga0105239_10229682 | 3300010375 | Unclassified | 2082 |
| 254 | Ga0105239_10805186 | 3300010375 | Bacteria | 1076 |
| 255 | Ga0105246_10056067 | 3300011119 | Bacteria | 2722 |
| 256 | Ga0105246_10179775 | 3300011119 | Bacteria | 1628 |
| 257 | Ga0105246_10371983 | 3300011119 | Bacteria | 1178 |
| 258 | Ga0105246_11436328 | 3300011119 | Bacteria | 645 |
| 259 | Ga0157373_10013202 | 3300013100 | Bacteria | 6064 |
| 260 | Ga0157373_10263879 | 3300013100 | Bacteria | 1219 |
| 261 | Ga0157371_10143253 | 3300013102 | Bacteria | 1702 |
| 262 | Ga0157370_10282402 | 3300013104 | Bacteria | 1534 |
| 263 | Ga0157370_10789373 | 3300013104 | Bacteria | 864 |
| 264 | Ga0157369_10026497 | 3300013105 | Bacteria | 6429 |
| 265 | Ga0157369_10087473 | 3300013105 | Unclassified | 3327 |
| 266 | Ga0157369_10380510 | 3300013105 | Unclassified | 1465 |
| 267 | Ga0157374_10722328 | 3300013296 | Bacteria | 1010 |
| 268 | Ga0157378_10079725 | 3300013297 | Bacteria | 2956 |
| 269 | Ga0157378_11503720 | 3300013297 | Bacteria | 718 |
| 270 | Ga0157372_10000063 | 3300013307 | Bacteria | 119595 |
| 271 | Ga0157372_10164276 | 3300013307 | Bacteria | 2567 |
| 272 | Ga0157372_10964378 | 3300013307 | Unclassified | 988 |
| 273 | Ga0157375_10015979 | 3300013308 | Bacteria | 6733 |
| 274 | Ga0163163_10001286 | 3300014325 | Bacteria | 21179 |
| 275 | Ga0163163_10144405 | 3300014325 | Bacteria | 2423 |
| 276 | Ga0163163_10757123 | 3300014325 | Unclassified | 1035 |
| 277 | Ga0157380_10062931 | 3300014326 | Bacteria | 2974 |
| 278 | Ga0157380_10633504 | 3300014326 | Bacteria | 1064 |
| 279 | Ga0157380_10814239 | 3300014326 | Bacteria | 952 |
| 280 | Ga0157380_10910698 | 3300014326 | Bacteria | 906 |
| 281 | Ga0157380_11442168 | 3300014326 | Unclassified | 740 |
| 282 | Ga0157377_10138810 | 3300014745 | Bacteria | 1492 |
| 283 | Ga0157377_11733155 | 3300014745 | Unclassified | 505 |
| 284 | Ga0157379_10142431 | 3300014968 | Unclassified | 2161 |
| 285 | Ga0157379_10145235 | 3300014968 | Bacteria | 2139 |
| 286 | Ga0157379_10653030 | 3300014968 | Unclassified | 985 |
| 287 | Ga0157376_10186242 | 3300014969 | Bacteria | 1901 |
| 288 | Ga0206352_11300773 | 3300020078 | Bacteria | 670 |
| 289 | Ga0206353_10093591 | 3300020082 | Bacteria | 1315 |
| 290 | Ga0213872_10038967 | 3300021361 | Bacteria | 2169 |
| 291 | Ga0213872_10044512 | 3300021361 | Bacteria | 2020 |
| 292 | Ga0213872_10233128 | 3300021361 | Bacteria | 780 |
| 293 | Ga0213874_10022247 | 3300021377 | Bacteria | 1757 |
| 294 | Ga0213874_10190889 | 3300021377 | Bacteria | 733 |
| 295 | Ga0213874_10224840 | 3300021377 | Bacteria | 683 |
| 296 | Ga0213876_10229679 | 3300021384 | Bacteria | 986 |
| 297 | Ga0213875_10058786 | 3300021388 | Unclassified | 1800 |
| 298 | Ga0207656_10049889 | 3300025321 | Bacteria | 1806 |
| 299 | Ga0207653_10004981 | 3300025885 | Bacteria | 4149 |
| 300 | Ga0207692_10103749 | 3300025898 | Bacteria | 1566 |
| 301 | Ga0207692_10272457 | 3300025898 | Bacteria | 1021 |
| 302 | Ga0207692_10550315 | 3300025898 | Unclassified | 737 |
| 303 | Ga0207692_10734870 | 3300025898 | Bacteria | 642 |
| 304 | Ga0207642_11107656 | 3300025899 | Unclassified | 512 |
| 305 | Ga0207710_10001953 | 3300025900 | Bacteria | 9853 |
| 306 | Ga0207710_10681950 | 3300025900 | Unclassified | 539 |
| 307 | Ga0207680_10312889 | 3300025903 | Unclassified | 1097 |
| 308 | Ga0207680_10569875 | 3300025903 | Bacteria | 809 |
| 309 | Ga0207647_10415468 | 3300025904 | Bacteria | 757 |
| 310 | Ga0207647_10436298 | 3300025904 | Unclassified | 735 |
| 311 | Ga0207685_10800853 | 3300025905 | Unclassified | 519 |
| 312 | Ga0207699_10050922 | 3300025906 | Unclassified | 2445 |
| 313 | Ga0207699_10166597 | 3300025906 | Bacteria | 1471 |
| 314 | Ga0207699_10657546 | 3300025906 | Bacteria | 766 |
| 315 | Ga0207645_10017421 | 3300025907 | Unclassified | 4742 |
| 316 | Ga0207645_10035422 | 3300025907 | Bacteria | 3205 |
| 317 | Ga0207643_10001827 | 3300025908 | Bacteria | 11804 |
| 318 | Ga0207643_10001973 | 3300025908 | Bacteria | 11330 |
| 319 | Ga0207643_10746381 | 3300025908 | Unclassified | 633 |
| 320 | Ga0207684_10005173 | 3300025910 | Bacteria | 12147 |
| 321 | Ga0207684_10112084 | 3300025910 | Bacteria | 2335 |
| 322 | Ga0207684_10931306 | 3300025910 | Unclassified | 729 |
| 323 | Ga0207654_10007965 | 3300025911 | Bacteria | 5342 |
| 324 | Ga0207707_10000752 | 3300025912 | Bacteria | 31930 |
| 325 | Ga0207695_10522208 | 3300025913 | Bacteria | 1069 |
| 326 | Ga0207693_10012195 | 3300025915 | Bacteria | 6943 |
| 327 | Ga0207693_10120635 | 3300025915 | Bacteria | 2059 |
| 328 | Ga0207693_10276681 | 3300025915 | Bacteria | 1315 |
| 329 | Ga0207693_10684301 | 3300025915 | Bacteria | 795 |
| 330 | Ga0207693_11053696 | 3300025915 | Bacteria | 619 |
| 331 | Ga0207663_10117030 | 3300025916 | Bacteria | 1818 |
| 332 | Ga0207663_11202632 | 3300025916 | Bacteria | 610 |
| 333 | Ga0207663_11280850 | 3300025916 | Bacteria | 590 |
| 334 | Ga0207660_10001549 | 3300025917 | Bacteria | 15399 |
| 335 | Ga0207660_11481036 | 3300025917 | Unclassified | 549 |
| 336 | Ga0207662_11308526 | 3300025918 | Bacteria | 515 |
| 337 | Ga0207657_10013830 | 3300025919 | Bacteria | 7898 |
| 338 | Ga0207657_10293976 | 3300025919 | Unclassified | 1288 |
| 339 | Ga0207657_11249874 | 3300025919 | Bacteria | 563 |
| 340 | Ga0207649_10005791 | 3300025920 | Bacteria | 6691 |
| 341 | Ga0207649_10067083 | 3300025920 | Unclassified | 2277 |
| 342 | Ga0207652_10006951 | 3300025921 | Bacteria | 9116 |
| 343 | Ga0207652_10112774 | 3300025921 | Unclassified | 2413 |
| 344 | Ga0207646_10000263 | 3300025922 | Bacteria | 71413 |
| 345 | Ga0207646_11494549 | 3300025922 | Bacteria | 585 |
| 346 | Ga0207681_10030119 | 3300025923 | Bacteria | 3535 |
| 347 | Ga0207681_10039611 | 3300025923 | Bacteria | 3130 |
| 348 | Ga0207681_10352080 | 3300025923 | Unclassified | 1179 |
| 349 | Ga0207694_10142565 | 3300025924 | Bacteria | 1927 |
| 350 | Ga0207650_10028481 | 3300025925 | Bacteria | 4006 |
| 351 | Ga0207650_10384600 | 3300025925 | Unclassified | 1159 |
| 352 | Ga0207659_10890320 | 3300025926 | Bacteria | 765 |
| 353 | Ga0207687_11023751 | 3300025927 | Bacteria | 708 |
| 354 | Ga0207687_11255429 | 3300025927 | Bacteria | 637 |
| 355 | Ga0207700_10015511 | 3300025928 | Bacteria | 5030 |
| 356 | Ga0207700_10062636 | 3300025928 | Bacteria | 2825 |
| 357 | Ga0207700_10682204 | 3300025928 | Bacteria | 917 |
| 358 | Ga0207700_11095464 | 3300025928 | Bacteria | 712 |
| 359 | Ga0207700_11503620 | 3300025928 | Bacteria | 597 |
| 360 | Ga0207700_12019378 | 3300025928 | Bacteria | 503 |
| 361 | Ga0207664_10148543 | 3300025929 | Bacteria | 1989 |
| 362 | Ga0207664_10248028 | 3300025929 | Bacteria | 1553 |
| 363 | Ga0207664_10325017 | 3300025929 | Bacteria | 1358 |
| 364 | Ga0207664_10377801 | 3300025929 | Bacteria | 1258 |
| 365 | Ga0207664_10897940 | 3300025929 | Bacteria | 796 |
| 366 | Ga0207664_11123172 | 3300025929 | Bacteria | 702 |
| 367 | Ga0207664_11826331 | 3300025929 | Bacteria | 530 |
| 368 | Ga0207644_10310956 | 3300025931 | Bacteria | 1272 |
| 369 | Ga0207644_10502120 | 3300025931 | Bacteria | 1001 |
| 370 | Ga0207690_10007312 | 3300025932 | Bacteria | 6556 |
| 371 | Ga0207706_10027435 | 3300025933 | Bacteria | 5091 |
| 372 | Ga0207706_10041618 | 3300025933 | Bacteria | 4072 |
| 373 | Ga0207706_10390766 | 3300025933 | Bacteria | 1207 |
| 374 | Ga0207709_11331879 | 3300025935 | Unclassified | 594 |
| 375 | Ga0207670_10004245 | 3300025936 | Bacteria | 7686 |
| 376 | Ga0207670_10064667 | 3300025936 | Bacteria | 2508 |
| 377 | Ga0207704_10503075 | 3300025938 | Unclassified | 977 |
| 378 | Ga0207704_10527801 | 3300025938 | Bacteria | 956 |
| 379 | Ga0207665_10082307 | 3300025939 | Bacteria | 2218 |
| 380 | Ga0207665_10646635 | 3300025939 | Bacteria | 829 |
| 381 | Ga0207691_10168009 | 3300025940 | Bacteria | 1922 |
| 382 | Ga0207711_10033379 | 3300025941 | Bacteria | 4354 |
| 383 | Ga0207711_10456428 | 3300025941 | Bacteria | 1190 |
| 384 | Ga0207689_10000161 | 3300025942 | Bacteria | 57831 |
| 385 | Ga0207689_10154485 | 3300025942 | Bacteria | 1892 |
| 386 | Ga0207661_11090842 | 3300025944 | Bacteria | 735 |
| 387 | Ga0207661_11548294 | 3300025944 | Unclassified | 607 |
| 388 | Ga0207679_10002658 | 3300025945 | Bacteria | 11030 |
| 389 | Ga0207667_10001995 | 3300025949 | Bacteria | 25601 |
| 390 | Ga0207667_10245138 | 3300025949 | Bacteria | 1833 |
| 391 | Ga0207667_10353734 | 3300025949 | Unclassified | 1498 |
| 392 | Ga0207651_10101206 | 3300025960 | Unclassified | 2138 |
| 393 | Ga0207712_11156179 | 3300025961 | Unclassified | 690 |
| 394 | Ga0207712_11601701 | 3300025961 | Unclassified | 584 |
| 395 | Ga0207712_12071885 | 3300025961 | Bacteria | 509 |
| 396 | Ga0207668_10040530 | 3300025972 | Bacteria | 3143 |
| 397 | Ga0207668_10746590 | 3300025972 | Unclassified | 863 |
| 398 | Ga0207640_10006649 | 3300025981 | Bacteria | 6352 |
| 399 | Ga0207658_10032287 | 3300025986 | Unclassified | 3725 |
| 400 | Ga0207658_10126668 | 3300025986 | Bacteria | 2045 |
| 401 | Ga0207677_10022615 | 3300026023 | Unclassified | 3867 |
| 402 | Ga0207677_11676084 | 3300026023 | Bacteria | 589 |
| 403 | Ga0207703_10016833 | 3300026035 | Bacteria | 5703 |
| 404 | Ga0207639_10040715 | 3300026041 | Bacteria | 3470 |
| 405 | Ga0207639_10050166 | 3300026041 | Bacteria | 3168 |
| 406 | Ga0207639_10099434 | 3300026041 | Unclassified | 2347 |
| 407 | Ga0207678_10918816 | 3300026067 | Bacteria | 774 |
| 408 | Ga0207708_11314589 | 3300026075 | Bacteria | 633 |
| 409 | Ga0207708_11848115 | 3300026075 | Bacteria | 530 |
| 410 | Ga0207702_10002368 | 3300026078 | Bacteria | 17999 |
| 411 | Ga0207702_11982187 | 3300026078 | Unclassified | 573 |
| 412 | Ga0207641_10006063 | 3300026088 | Bacteria | 10236 |
| 413 | Ga0207641_10017765 | 3300026088 | Bacteria | 5828 |
| 414 | Ga0207648_10000348 | 3300026089 | Bacteria | 50841 |
| 415 | Ga0207648_10001541 | 3300026089 | Bacteria | 25367 |
| 416 | Ga0207648_11185121 | 3300026089 | Bacteria | 717 |
| 417 | Ga0207676_10013379 | 3300026095 | Bacteria | 5893 |
| 418 | Ga0207676_10367369 | 3300026095 | Bacteria | 1335 |
| 419 | Ga0207676_10978764 | 3300026095 | Bacteria | 833 |
| 420 | Ga0207674_10051680 | 3300026116 | Bacteria | 4194 |
| 421 | Ga0207674_10091046 | 3300026116 | Bacteria | 3041 |
| 422 | Ga0207675_100001024 | 3300026118 | Bacteria | 27687 |
| 423 | Ga0207675_100008900 | 3300026118 | Bacteria | 9418 |
| 424 | Ga0207675_100029048 | 3300026118 | Bacteria | 5152 |
| 425 | Ga0207675_100080962 | 3300026118 | Bacteria | 3044 |
| 426 | Ga0207683_11567157 | 3300026121 | Bacteria | 608 |
| 427 | Ga0207698_10387213 | 3300026142 | Bacteria | 1332 |
| 428 | Ga0207698_11856221 | 3300026142 | Unclassified | 618 |
| 429 | Ga0209983_1054816 | 3300027665 | Bacteria | 875 |
| 430 | Ga0268266_10522878 | 3300028379 | Unclassified | 1135 |
| 431 | Ga0268265_10007886 | 3300028380 | Bacteria | 7185 |
| 432 | Ga0268265_10021317 | 3300028380 | Unclassified | 4537 |
| 433 | Ga0268265_10439913 | 3300028380 | Bacteria | 1215 |
| 434 | Ga0268264_10008622 | 3300028381 | Bacteria | 8470 |
| 435 | Ga0268264_10011647 | 3300028381 | Bacteria | 7254 |
| 436 | Ga0307515_10000265 | 3300028794 | Bacteria | 129554 |
| 437 | Ga0265338_10552721 | 3300028800 | Bacteria | 806 |
| 438 | Ga0265770_1130481 | 3300030878 | Unclassified | 537 |
| 439 | Ga0265760_10001130 | 3300031090 | Bacteria | 7763 |
| 440 | Ga0265329_10029553 | 3300031242 | Bacteria | 1790 |
| 441 | Ga0307408_100022495 | 3300031548 | Bacteria | 4284 |
| 442 | Ga0307408_100473973 | 3300031548 | Unclassified | 1091 |
| 443 | Ga0316596_1090541 | 3300033541 | Unclassified | 824 |
| 444 | Ga0373948_0150307 | 3300034817 | Bacteria | 581 |
| 445 | Ga0373944_0218559 | 3300035089 | Bacteria | 695 |
| 446 | Ga0373949_0025399 | 3300035090 | Bacteria | 1382 |
| 447 | Ga0373923_0114181 | 3300035111 | Bacteria | 1202 |
| 448 | Ga0373954_0015937 | 3300035118 | Unclassified | 3362 |
| 449 | Ga0373956_0004341 | 3300035119 | Bacteria | 5688 |
| 450 | Ga0373943_0024018 | 3300035170 | Bacteria | 2839 |
| 451 | Ga0373943_0997862 | 3300035170 | Unclassified | 502 |
| 452 | Ga0373942_0342706 | 3300035207 | Bacteria | 527 |
| 453 | Ga0373924_0124064 | 3300035410 | Bacteria | 1122 |
| 454 | Ga0373931_0308689 | 3300035691 | Bacteria | 979 |
| 455 | Ga0373935_0009982 | 3300035692 | Bacteria | 5687 |
| 456 | Ga0373935_0901874 | 3300035692 | Bacteria | 655 |
| 457 | Ga0373935_1218529 | 3300035692 | Unclassified | 561 |
| 458 | Ga0373927_0000413 | 3300035695 | Bacteria | 32824 |
| 459 | Ga0373933_1068725 | 3300035724 | Unclassified | 532 |
| 460 | Ga0373947_0000599 | 3300035725 | Bacteria | 21255 |
| 461 | Ga0373937_0452978 | 3300036401 | Unclassified | 1219 |
| 462 | Ga0373937_0471306 | 3300036401 | Bacteria | 1193 |
| 463 | Ga0395899_0783984 | 3300037312 | Bacteria | 590 |
| 464 | Ga0395898_0165556 | 3300037466 | Bacteria | 2115 |
| 465 | Ga0436364_0552552 | 3300037853 | Bacteria | 1394 |
| 466 | Ga0436364_0906989 | 3300037853 | Bacteria | 2232 |
| 467 | Ga0436364_1507136 | 3300037853 | Bacteria | 1034 |
| 468 | Ga0436364_1542968 | 3300037853 | Unclassified | 2156 |
| 469 | Ga0395901_0099736 | 3300038443 | Bacteria | 3046 |
| 470 | Ga0242420_029350 | 3300038996 | Bacteria | 1015 |
| 471 | Ga0436365_0058541 | 3300039437 | Bacteria | 651 |
| 472 | Ga0436365_0110928 | 3300039437 | Bacteria | 569 |
| 473 | Ga0436365_0210124 | 3300039437 | Bacteria | 557 |
| 474 | Ga0436365_1032723 | 3300039437 | Unclassified | 663 |
| 475 | Ga0436365_1108277 | 3300039437 | Bacteria | 3146 |
| 476 | Ga0436365_1171371 | 3300039437 | Unclassified | 690 |
| 477 | Ga0436365_1446847 | 3300039437 | Bacteria | 1376 |
| 478 | Ga0436365_1528782 | 3300039437 | Bacteria | 1884 |
| 479 | Ga0436365_1670062 | 3300039437 | Bacteria | 6911 |
| 480 | Ga0436365_1930052 | 3300039437 | Bacteria | 12134 |
| 481 | Ga0436361_0491533 | 3300039447 | Bacteria | 4407 |
| 482 | Ga0436361_0599619 | 3300039447 | Bacteria | 25349 |
| 483 | Ga0436361_1189806 | 3300039447 | Bacteria | 31675 |
| 484 | Ga0436363_0078425 | 3300039450 | Bacteria | 1303 |
| 485 | Ga0436363_0087581 | 3300039450 | Bacteria | 1274 |
| 486 | Ga0436363_0377146 | 3300039450 | Bacteria | 1177 |
| 487 | Ga0436363_0555427 | 3300039450 | Bacteria | 3490 |
| 488 | Ga0436363_1035210 | 3300039450 | Bacteria | 1851 |
| 489 | Ga0436363_1212799 | 3300039450 | Bacteria | 1226 |
| 490 | Ga0436363_1223883 | 3300039450 | Bacteria | 684 |
| 491 | Ga0436363_1234560 | 3300039450 | Bacteria | 506 |
| 492 | Ga0436362_0072074 | 3300039453 | Bacteria | 1186 |
| 493 | Ga0451839_1545871 | 3300041496 | Unclassified | 687 |
| 494 | Ga0439437_014709 | 3300042000 | Bacteria | 915 |
| 495 | Ga0439448_0002372 | 3300042005 | Bacteria | 5108 |
| 496 | Ga0439446_0367004 | 3300042156 | Bacteria | 515 |
| 497 | Ga0439459_0007901 | 3300042438 | Bacteria | 1806 |
| 498 | Ga0439464_0203237 | 3300042439 | Bacteria | 632 |
| 499 | Ga0451577_0094721 | 3300042876 | Bacteria | 2666 |
| 500 | Ga0466965_0057823 | 3300044683 | Bacteria | 1933 |
| 501 | Ga0466965_0350679 | 3300044683 | Bacteria | 808 |
| 502 | Ga0466966_0233498 | 3300044684 | Bacteria | 1109 |
| 503 | Ga0466961_0271795 | 3300044693 | Bacteria | 1038 |
| 504 | Ga0466961_0980174 | 3300044693 | Bacteria | 502 |
| 505 | Ga0466963_0030492 | 3300044694 | Bacteria | 3480 |
| 506 | Ga0466963_0033987 | 3300044694 | Bacteria | 3315 |
| 507 | Ga0466963_0041819 | 3300044694 | Bacteria | 3007 |
| 508 | Ga0466963_0363805 | 3300044694 | Bacteria | 1019 |
| 509 | Ga0466963_0638124 | 3300044694 | Bacteria | 752 |
| 510 | Ga0466964_0047123 | 3300044706 | Bacteria | 1759 |
| 511 | Ga0453684_0697669 | 3300044712 | Bacteria | 1103 |
| 512 | Ga0453684_0951799 | 3300044712 | Bacteria | 916 |
| 513 | Ga0466968_0366813 | 3300044735 | Bacteria | 701 |
| 514 | Ga0466970_0088520 | 3300044765 | Bacteria | 1679 |
| 515 | Ga0466957_0119852 | 3300044842 | Bacteria | 1676 |
| 516 | Ga0466957_0168897 | 3300044842 | Bacteria | 1424 |
| 517 | Ga0466957_0254692 | 3300044842 | Bacteria | 1168 |
| 518 | Ga0466957_0264178 | 3300044842 | Bacteria | 1148 |
| 519 | Ga0466959_0029285 | 3300045049 | Bacteria | 4080 |
| 520 | Ga0466959_0037295 | 3300045049 | Bacteria | 3591 |
| 521 | Ga0466959_0040655 | 3300045049 | Bacteria | 3435 |
| 522 | Ga0451576_0018042 | 3300045051 | Bacteria | 7744 |
| 523 | Ga0451576_0162691 | 3300045051 | Bacteria | 2329 |
| 524 | Ga0451576_1195131 | 3300045051 | Bacteria | 794 |
| 525 | Ga0451576_1833297 | 3300045051 | Bacteria | 627 |
| 526 | Ga0466958_0002818 | 3300045836 | Bacteria | 8847 |
| 527 | Ga0466958_0034097 | 3300045836 | Bacteria | 3035 |
| 528 | Ga0466958_0085776 | 3300045836 | Bacteria | 1942 |
| 529 | Ga0466958_0568969 | 3300045836 | Bacteria | 737 |
| 530 | Ga0466967_0002139 | 3300045976 | Bacteria | 12112 |
| 531 | Ga0466967_0015191 | 3300045976 | Bacteria | 6029 |
| 532 | Ga0466967_1152384 | 3300045976 | Bacteria | 772 |
| 533 | Ga0466967_1720630 | 3300045976 | Bacteria | 624 |
| 534 | Ga0466967_1728059 | 3300045976 | Bacteria | 623 |
| 535 | Ga0495641_0302564 | 3300046461 | Bacteria | 721 |
| 536 | Ga0495580_0121523 | 3300046472 | Bacteria | 1813 |
| 537 | Ga0495580_0171339 | 3300046472 | Bacteria | 1501 |
| 538 | Ga0495639_0133553 | 3300046475 | Bacteria | 1189 |
| 539 | Ga0495596_0342514 | 3300046500 | Bacteria | 582 |
| 540 | Ga0495618_0693026 | 3300046514 | Bacteria | 600 |
| 541 | Ga0495630_0075592 | 3300046517 | Unclassified | 2538 |
| 542 | Ga0495665_0124075 | 3300046531 | Bacteria | 1352 |
| 543 | Ga0495640_0140535 | 3300046533 | Bacteria | 1557 |
| 544 | Ga0495640_0375542 | 3300046533 | Bacteria | 875 |
| 545 | Ga0495667_0221726 | 3300046559 | Bacteria | 1207 |
| 546 | Ga0495634_0131253 | 3300046642 | Bacteria | 1597 |
| 547 | Ga0495635_0002432 | 3300046663 | Bacteria | 12700 |
| 548 | Ga0495658_0319339 | 3300046683 | Unclassified | 984 |
| 549 | Ga0495669_0098073 | 3300046684 | Bacteria | 1359 |
| 550 | Ga0495613_0292493 | 3300046689 | Bacteria | 1129 |
| 551 | Ga0495624_0035126 | 3300046690 | Bacteria | 3237 |
| 552 | Ga0495581_0172926 | 3300047315 | Bacteria | 1263 |
| 553 | Ga0495581_0219058 | 3300047315 | Bacteria | 1113 |
| 554 | Ga0495581_0354631 | 3300047315 | Bacteria | 856 |
| 555 | Ga0495676_0313385 | 3300047321 | Bacteria | 1055 |
| 556 | Ga0495593_0003560 | 3300047673 | Bacteria | 9317 |
| 557 | Ga0495593_0307390 | 3300047673 | Bacteria | 793 |
| 558 | Ga0496101_0157552 | 3300048904 | Bacteria | 1740 |
| 559 | Ga0496102_0007322 | 3300048905 | Bacteria | 9420 |
| 560 | Ga0496102_0035568 | 3300048905 | Bacteria | 4484 |
| 561 | Ga0496102_1153392 | 3300048905 | Unclassified | 694 |
| 562 | Ga0496103_0004205 | 3300048906 | Bacteria | 8736 |
| 563 | Ga0496105_1073333 | 3300048908 | Bacteria | 599 |
| 564 | Ga0496106_0049155 | 3300048909 | Bacteria | 3177 |
| 565 | Ga0496106_0116538 | 3300048909 | Bacteria | 2084 |
| 566 | Ga0496106_1070775 | 3300048909 | Bacteria | 632 |
| 567 | Ga0496108_0808234 | 3300048911 | Bacteria | 809 |
| 568 | Ga0496109_0823816 | 3300048912 | Bacteria | 866 |
| 569 | Ga0496110_0412974 | 3300048913 | Bacteria | 1230 |
| 570 | Ga0496110_1401410 | 3300048913 | Bacteria | 608 |
| 571 | Ga0496110_1466005 | 3300048913 | Bacteria | 592 |
| 572 | Ga0496110_1611574 | 3300048913 | Unclassified | 559 |
| 573 | Ga0496111_0283818 | 3300048914 | Bacteria | 1228 |
| 574 | Ga0496112_0131781 | 3300048915 | Bacteria | 2471 |
| 575 | Ga0496112_0768790 | 3300048915 | Bacteria | 889 |
| 576 | Ga0496112_1634014 | 3300048915 | Bacteria | 557 |
| 577 | Ga0496113_0397184 | 3300048916 | Bacteria | 1107 |
| 578 | Ga0496113_0779134 | 3300048916 | Unclassified | 760 |
| 579 | Ga0496114_0084221 | 3300048917 | Bacteria | 2692 |
| 580 | Ga0496115_0345949 | 3300048918 | Unclassified | 1213 |
| 581 | Ga0496121_0035052 | 3300048924 | Bacteria | 4503 |
| 582 | Ga0496125_0028838 | 3300048928 | Bacteria | 5001 |
| 583 | Ga0495678_105484 | 3300049459 | Unclassified | 970 |
| 584 | Ga0501036_0126453 | 3300049572 | Bacteria | 2159 |
| 585 | Ga0501038_0842555 | 3300049574 | Bacteria | 679 |
| 586 | Ga0501039_0128287 | 3300049575 | Bacteria | 1990 |
| 587 | Ga0501042_0595871 | 3300049578 | Bacteria | 803 |
| 588 | Ga0501043_0438381 | 3300049579 | Bacteria | 983 |
| 589 | Ga0501048_0286498 | 3300049582 | Bacteria | 1171 |
| 590 | Ga0501071_1512992 | 3300049587 | Bacteria | 518 |
| 591 | Ga0501072_0002208 | 3300049588 | Bacteria | 14544 |
| 592 | Ga0501072_0081005 | 3300049588 | Bacteria | 2573 |
| 593 | Ga0501072_0154361 | 3300049588 | Bacteria | 1831 |
| 594 | Ga0501072_0331475 | 3300049588 | Bacteria | 1209 |
| 595 | Ga0501073_0830154 | 3300049589 | Bacteria | 637 |
| 596 | Ga0501074_0235543 | 3300049590 | Bacteria | 1303 |
| 597 | Ga0501075_0155037 | 3300049591 | Bacteria | 1746 |
| 598 | Ga0501076_0315521 | 3300049592 | Bacteria | 1282 |
| 599 | Ga0501076_1030548 | 3300049592 | Bacteria | 678 |
| 600 | Ga0501077_0038252 | 3300049593 | Bacteria | 3055 |
| 601 | Ga0501077_0163701 | 3300049593 | Bacteria | 1412 |
| 602 | Ga0501079_0203525 | 3300049741 | Bacteria | 1546 |
| 603 | Ga0501080_0709352 | 3300049742 | Bacteria | 887 |
| 604 | Ga0501080_0949155 | 3300049742 | Bacteria | 748 |
| 605 | Ga0501081_0197123 | 3300049743 | Bacteria | 1460 |
| 606 | Ga0501083_0825962 | 3300049744 | Bacteria | 603 |
| 607 | Ga0501083_0938282 | 3300049744 | Bacteria | 563 |
| 608 | Ga0501045_0644691 | 3300049824 | Bacteria | 783 |
| 609 | nmdc:mga05p37_78264_c1 | 3300050507 | Bacteria | 4071 |
| 610 | nmdc:mga05p37_872240_c1 | 3300050507 | Bacteria | 974 |
| 611 | nmdc:mga0qj67_1383768_c1 | 3300050509 | Bacteria | 543 |
| 612 | nmdc:mga0qj67_232868_c1 | 3300050509 | Unclassified | 1494 |
| 613 | nmdc:mga06r32_190316_c1 | 3300050510 | Unclassified | 2040 |
| 614 | nmdc:mga08y16_1162549_c1 | 3300050511 | Bacteria | 744 |
| 615 | nmdc:mga0n895_1027951_c1 | 3300050512 | Bacteria | 804 |
| 616 | nmdc:mga0n895_440245_c1 | 3300050512 | Bacteria | 1317 |
| 617 | nmdc:mga0n895_5131_c1 | 3300050512 | Bacteria | 10885 |
| 618 | nmdc:mga0rr50_11675_c1 | 3300050513 | Bacteria | 5637 |
| 619 | nmdc:mga08x19_237366_c1 | 3300050514 | Bacteria | 1256 |
| 620 | nmdc:mga0a205_424246_c1 | 3300050515 | Bacteria | 1192 |
| 621 | nmdc:mga0a205_619964_c1 | 3300050515 | Bacteria | 934 |
| 622 | Ga0495612_0173611 | 3300053078 | Bacteria | 945 |
| 623 | Ga0500610_0087300 | 3300053079 | Unclassified | 1622 |
| 624 | Ga0500583_0011899 | 3300053092 | Bacteria | 3299 |
| 625 | Ga0500651_0273001 | 3300053093 | Unclassified | 977 |
| 626 | Ga0500594_0081104 | 3300053118 | Unclassified | 970 |
| 627 | Ga0500621_107118 | 3300053126 | Bacteria | 1096 |
| 628 | Ga0500642_0001284 | 3300053130 | Bacteria | 7180 |
| 629 | Ga0500589_000018 | 3300053147 | Bacteria | 101866 |
| 630 | Ga0500611_003222 | 3300053727 | Unclassified | 2065 |
| 631 | Ga0501084_0159045 | 3300054114 | Bacteria | 1906 |
| 632 | Ga0501082_1123113 | 3300060353 | Bacteria | 687 |
| 633 | Ga0501082_1801292 | 3300060353 | Bacteria | 534 |
| 634 | Ga0530510_0605424 | 3300061734 | Bacteria | 833 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005844 | Ga0068862_100253313 | Ga0068862_1002533133 | 80 |
| 2 | 3300007265 | Ga0099794_10565215 | Ga0099794_105652152 | 81 |
| 3 | 3300005618 | Ga0068864_102490985 | Ga0068864_1024909851 | 84 |
| 4 | 3300049572 | Ga0501036_0126453 | Ga0501036_0126453_1727_2023 | 86 |
| 5 | 3300049574 | Ga0501038_0842555 | Ga0501038_0842555_272_568 | 86 |
| 6 | 3300049575 | Ga0501039_0128287 | Ga0501039_0128287_1048_1344 | 86 |
| 7 | 3300049578 | Ga0501042_0595871 | Ga0501042_0595871_349_645 | 86 |
| 8 | 3300049579 | Ga0501043_0438381 | Ga0501043_0438381_666_962 | 86 |
| 9 | 3300049582 | Ga0501048_0286498 | Ga0501048_0286498_616_912 | 86 |
| 10 | 3300049587 | Ga0501071_1512992 | Ga0501071_1512992_134_430 | 86 |
| 11 | 3300049588 | Ga0501072_0002208 | Ga0501072_0002208_12033_12329 | 86 |
| 12 | 3300049590 | Ga0501074_0235543 | Ga0501074_0235543_258_554 | 86 |
| 13 | 3300049591 | Ga0501075_0155037 | Ga0501075_0155037_259_555 | 86 |
| 14 | 3300049592 | Ga0501076_0315521 | Ga0501076_0315521_438_734 | 86 |
| 15 | 3300049593 | Ga0501077_0163701 | Ga0501077_0163701_446_742 | 86 |
| 16 | 3300049741 | Ga0501079_0203525 | Ga0501079_0203525_1070_1366 | 86 |
| 17 | 3300049742 | Ga0501080_0709352 | Ga0501080_0709352_134_430 | 86 |
| 18 | 3300049743 | Ga0501081_0197123 | Ga0501081_0197123_725_1021 | 86 |
| 19 | 3300049744 | Ga0501083_0938282 | Ga0501083_0938282_51_347 | 86 |
| 20 | 3300054114 | Ga0501084_0159045 | Ga0501084_0159045_482_778 | 86 |
| 21 | 3300060353 | Ga0501082_1801292 | Ga0501082_1801292_11_307 | 86 |
| 22 | 3300061734 | Ga0530510_0605424 | Ga0530510_0605424_234_530 | 86 |
| 23 | 3300005441 | Ga0070700_100391751 | Ga0070700_1003917512 | 87 |
| 24 | 3300005518 | Ga0070699_100650562 | Ga0070699_1006505622 | 87 |
| 25 | 3300005549 | Ga0070704_100212046 | Ga0070704_1002120463 | 87 |
| 26 | 3300006847 | Ga0075431_101242366 | Ga0075431_1012423661 | 87 |
| 27 | 3300009553 | Ga0105249_13524712 | Ga0105249_135247121 | 87 |
| 28 | 3300005436 | Ga0070713_100110388 | Ga0070713_1001103882 | 88 |
| 29 | 3300005439 | Ga0070711_100463548 | Ga0070711_1004635482 | 88 |
| 30 | 3300005471 | Ga0070698_100124822 | Ga0070698_1001248221 | 88 |
| 31 | 3300005577 | Ga0068857_100305365 | Ga0068857_1003053653 | 88 |
| 32 | 3300006028 | Ga0070717_11209429 | Ga0070717_112094291 | 88 |
| 33 | 3300006175 | Ga0070712_100014619 | Ga0070712_1000146193 | 88 |
| 34 | 3300009094 | Ga0111539_10013648 | Ga0111539_100136482 | 88 |
| 35 | 3300009553 | Ga0105249_11505123 | Ga0105249_115051232 | 88 |
| 36 | 3300011119 | Ga0105246_11436328 | Ga0105246_114363282 | 88 |
| 37 | 3300014968 | Ga0157379_10653030 | Ga0157379_106530302 | 88 |
| 38 | 3300014969 | Ga0157376_10186242 | Ga0157376_101862423 | 88 |
| 39 | 3300021361 | Ga0213872_10233128 | Ga0213872_102331282 | 88 |
| 40 | 3300021377 | Ga0213874_10224840 | Ga0213874_102248401 | 88 |
| 41 | 3300021384 | Ga0213876_10229679 | Ga0213876_102296791 | 88 |
| 42 | 3300025898 | Ga0207692_10734870 | Ga0207692_107348701 | 88 |
| 43 | 3300025915 | Ga0207693_10012195 | Ga0207693_100121955 | 88 |
| 44 | 3300025916 | Ga0207663_11280850 | Ga0207663_112808501 | 88 |
| 45 | 3300025928 | Ga0207700_10015511 | Ga0207700_100155112 | 88 |
| 46 | 3300026067 | Ga0207678_10918816 | Ga0207678_109188163 | 88 |
| 47 | 3300033541 | Ga0316596_1090541 | Ga0316596_10905412 | 88 |
| 48 | 3300035089 | Ga0373944_0218559 | Ga0373944_0218559_325_591 | 88 |
| 49 | 3300035111 | Ga0373923_0114181 | Ga0373923_0114181_731_997 | 88 |
| 50 | 3300035170 | Ga0373943_0024018 | Ga0373943_0024018_934_1200 | 88 |
| 51 | 3300035170 | Ga0373943_0997862 | Ga0373943_0997862_123_389 | 88 |
| 52 | 3300035692 | Ga0373935_0009982 | Ga0373935_0009982_3784_4050 | 88 |
| 53 | 3300035692 | Ga0373935_0901874 | Ga0373935_0901874_10_276 | 88 |
| 54 | 3300035695 | Ga0373927_0000413 | Ga0373927_0000413_22033_22299 | 88 |
| 55 | 3300035725 | Ga0373947_0000599 | Ga0373947_0000599_2058_2324 | 88 |
| 56 | 3300039437 | Ga0436365_0210124 | Ga0436365_0210124_254_520 | 88 |
| 57 | 3300039437 | Ga0436365_1528782 | Ga0436365_1528782_1579_1845 | 88 |
| 58 | 3300039447 | Ga0436361_0491533 | Ga0436361_0491533_827_1093 | 88 |
| 59 | 3300039450 | Ga0436363_0087581 | Ga0436363_0087581_730_996 | 88 |
| 60 | 3300039450 | Ga0436363_1223883 | Ga0436363_1223883_293_559 | 88 |
| 61 | 3300045051 | Ga0451576_1195131 | Ga0451576_1195131_28_297 | 88 |
| 62 | 3300046475 | Ga0495639_0133553 | Ga0495639_0133553_162_428 | 88 |
| 63 | 3300046517 | Ga0495630_0075592 | Ga0495630_0075592_1876_2142 | 88 |
| 64 | 3300046531 | Ga0495665_0124075 | Ga0495665_0124075_316_582 | 88 |
| 65 | 3300046533 | Ga0495640_0375542 | Ga0495640_0375542_383_649 | 88 |
| 66 | 3300046559 | Ga0495667_0221726 | Ga0495667_0221726_662_928 | 88 |
| 67 | 3300046663 | Ga0495635_0002432 | Ga0495635_0002432_10422_10688 | 88 |
| 68 | 3300046683 | Ga0495658_0319339 | Ga0495658_0319339_703_969 | 88 |
| 69 | 3300046689 | Ga0495613_0292493 | Ga0495613_0292493_494_760 | 88 |
| 70 | 3300046690 | Ga0495624_0035126 | Ga0495624_0035126_2791_3057 | 88 |
| 71 | 3300047315 | Ga0495581_0172926 | Ga0495581_0172926_892_1158 | 88 |
| 72 | 3300047315 | Ga0495581_0219058 | Ga0495581_0219058_191_457 | 88 |
| 73 | 3300047315 | Ga0495581_0354631 | Ga0495581_0354631_71_337 | 88 |
| 74 | 3300047321 | Ga0495676_0313385 | Ga0495676_0313385_468_734 | 88 |
| 75 | 3300047673 | Ga0495593_0003560 | Ga0495593_0003560_7445_7711 | 88 |
| 76 | 3300047673 | Ga0495593_0307390 | Ga0495593_0307390_39_305 | 88 |
| 77 | 3300048904 | Ga0496101_0157552 | Ga0496101_0157552_1007_1273 | 88 |
| 78 | 3300048905 | Ga0496102_1153392 | Ga0496102_1153392_137_403 | 88 |
| 79 | 3300048906 | Ga0496103_0004205 | Ga0496103_0004205_4644_4910 | 88 |
| 80 | 3300048909 | Ga0496106_1070775 | Ga0496106_1070775_299_565 | 88 |
| 81 | 3300048913 | Ga0496110_1401410 | Ga0496110_1401410_157_423 | 88 |
| 82 | 3300048916 | Ga0496113_0779134 | Ga0496113_0779134_428_694 | 88 |
| 83 | 3300048917 | Ga0496114_0084221 | Ga0496114_0084221_381_647 | 88 |
| 84 | 3300048918 | Ga0496115_0345949 | Ga0496115_0345949_322_588 | 88 |
| 85 | 2162886012 | MBSR1b_contig_104125 | MBSR1b_0509.00007360 | 89 |
| 86 | 2162886012 | MBSR1b_contig_2996384 | MBSR1b_0092.00003050 | 89 |
| 87 | 2162886012 | MBSR1b_contig_3421288 | MBSR1b_0811.00005970 | 89 |
| 88 | 3300000546 | LJNas_1003048 | LJNas_10030482 | 89 |
| 89 | 3300003203 | JGI25406J46586_10051518 | JGI25406J46586_100515182 | 89 |
| 90 | 3300005289 | Ga0065704_10086353 | Ga0065704_100863533 | 89 |
| 91 | 3300005293 | Ga0065715_10143431 | Ga0065715_101434314 | 89 |
| 92 | 3300005293 | Ga0065715_10221217 | Ga0065715_102212172 | 89 |
| 93 | 3300005295 | Ga0065707_10095199 | Ga0065707_100951991 | 89 |
| 94 | 3300005327 | Ga0070658_10766877 | Ga0070658_107668772 | 89 |
| 95 | 3300005328 | Ga0070676_10009857 | Ga0070676_1000985712 | 89 |
| 96 | 3300005328 | Ga0070676_10041510 | Ga0070676_100415103 | 89 |
| 97 | 3300005329 | Ga0070683_100813630 | Ga0070683_1008136302 | 89 |
| 98 | 3300005329 | Ga0070683_101805545 | Ga0070683_1018055452 | 89 |
| 99 | 3300005329 | Ga0070683_101920826 | Ga0070683_1019208262 | 89 |
| 100 | 3300005330 | Ga0070690_100006698 | Ga0070690_1000066986 | 89 |
| 101 | 3300005330 | Ga0070690_100473012 | Ga0070690_1004730122 | 89 |
| 102 | 3300005331 | Ga0070670_100002355 | Ga0070670_10000235511 | 89 |
| 103 | 3300005331 | Ga0070670_100034764 | Ga0070670_1000347641 | 89 |
| 104 | 3300005334 | Ga0068869_100002790 | Ga0068869_1000027902 | 89 |
| 105 | 3300005334 | Ga0068869_100118708 | Ga0068869_1001187084 | 89 |
| 106 | 3300005335 | Ga0070666_10170492 | Ga0070666_101704923 | 89 |
| 107 | 3300005335 | Ga0070666_10367533 | Ga0070666_103675331 | 89 |
| 108 | 3300005336 | Ga0070680_100029552 | Ga0070680_1000295523 | 89 |
| 109 | 3300005337 | Ga0070682_100001736 | Ga0070682_10000173616 | 89 |
| 110 | 3300005338 | Ga0068868_100021200 | Ga0068868_1000212002 | 89 |
| 111 | 3300005338 | Ga0068868_100053819 | Ga0068868_1000538197 | 89 |
| 112 | 3300005339 | Ga0070660_100024521 | Ga0070660_1000245214 | 89 |
| 113 | 3300005340 | Ga0070689_100008100 | Ga0070689_10000810012 | 89 |
| 114 | 3300005340 | Ga0070689_100038414 | Ga0070689_1000384146 | 89 |
| 115 | 3300005341 | Ga0070691_11055848 | Ga0070691_110558482 | 89 |
| 116 | 3300005343 | Ga0070687_101485726 | Ga0070687_1014857261 | 89 |
| 117 | 3300005344 | Ga0070661_100008091 | Ga0070661_1000080915 | 89 |
| 118 | 3300005344 | Ga0070661_100008363 | Ga0070661_1000083632 | 89 |
| 119 | 3300005345 | Ga0070692_10153850 | Ga0070692_101538503 | 89 |
| 120 | 3300005345 | Ga0070692_10217213 | Ga0070692_102172133 | 89 |
| 121 | 3300005345 | Ga0070692_10828770 | Ga0070692_108287702 | 89 |
| 122 | 3300005347 | Ga0070668_100055509 | Ga0070668_1000555091 | 89 |
| 123 | 3300005353 | Ga0070669_100003871 | Ga0070669_1000038711 | 89 |
| 124 | 3300005353 | Ga0070669_100051843 | Ga0070669_1000518433 | 89 |
| 125 | 3300005353 | Ga0070669_100102332 | Ga0070669_1001023322 | 89 |
| 126 | 3300005354 | Ga0070675_101346700 | Ga0070675_1013467002 | 89 |
| 127 | 3300005355 | Ga0070671_100294056 | Ga0070671_1002940562 | 89 |
| 128 | 3300005356 | Ga0070674_100779752 | Ga0070674_1007797521 | 89 |
| 129 | 3300005356 | Ga0070674_102069444 | Ga0070674_1020694441 | 89 |
| 130 | 3300005364 | Ga0070673_100013779 | Ga0070673_10001377910 | 89 |
| 131 | 3300005364 | Ga0070673_100361818 | Ga0070673_1003618182 | 89 |
| 132 | 3300005366 | Ga0070659_100004587 | Ga0070659_1000045874 | 89 |
| 133 | 3300005366 | Ga0070659_100106780 | Ga0070659_1001067801 | 89 |
| 134 | 3300005366 | Ga0070659_100263651 | Ga0070659_1002636512 | 89 |
| 135 | 3300005367 | Ga0070667_100164838 | Ga0070667_1001648383 | 89 |
| 136 | 3300005406 | Ga0070703_10004880 | Ga0070703_100048805 | 89 |
| 137 | 3300005434 | Ga0070709_10105418 | Ga0070709_101054182 | 89 |
| 138 | 3300005434 | Ga0070709_10813100 | Ga0070709_108131001 | 89 |
| 139 | 3300005435 | Ga0070714_100018859 | Ga0070714_1000188592 | 89 |
| 140 | 3300005435 | Ga0070714_100495330 | Ga0070714_1004953304 | 89 |
| 141 | 3300005436 | Ga0070713_100253800 | Ga0070713_1002538003 | 89 |
| 142 | 3300005436 | Ga0070713_100946618 | Ga0070713_1009466181 | 89 |
| 143 | 3300005436 | Ga0070713_100962330 | Ga0070713_1009623302 | 89 |
| 144 | 3300005436 | Ga0070713_101424173 | Ga0070713_1014241732 | 89 |
| 145 | 3300005437 | Ga0070710_10028231 | Ga0070710_100282312 | 89 |
| 146 | 3300005437 | Ga0070710_10267863 | Ga0070710_102678632 | 89 |
| 147 | 3300005437 | Ga0070710_10268253 | Ga0070710_102682532 | 89 |
| 148 | 3300005437 | Ga0070710_10559373 | Ga0070710_105593732 | 89 |
| 149 | 3300005438 | Ga0070701_10005017 | Ga0070701_100050176 | 89 |
| 150 | 3300005438 | Ga0070701_10052223 | Ga0070701_100522231 | 89 |
| 151 | 3300005438 | Ga0070701_10377923 | Ga0070701_103779232 | 89 |
| 152 | 3300005439 | Ga0070711_100365898 | Ga0070711_1003658982 | 89 |
| 153 | 3300005439 | Ga0070711_100666069 | Ga0070711_1006660692 | 89 |
| 154 | 3300005440 | Ga0070705_100004665 | Ga0070705_1000046658 | 89 |
| 155 | 3300005441 | Ga0070700_100285073 | Ga0070700_1002850732 | 89 |
| 156 | 3300005441 | Ga0070700_100305595 | Ga0070700_1003055952 | 89 |
| 157 | 3300005441 | Ga0070700_101398380 | Ga0070700_1013983801 | 89 |
| 158 | 3300005444 | Ga0070694_100001325 | Ga0070694_1000013259 | 89 |
| 159 | 3300005444 | Ga0070694_100087251 | Ga0070694_1000872513 | 89 |
| 160 | 3300005445 | Ga0070708_100009402 | Ga0070708_10000940210 | 89 |
| 161 | 3300005456 | Ga0070678_100527176 | Ga0070678_1005271761 | 89 |
| 162 | 3300005456 | Ga0070678_100675651 | Ga0070678_1006756511 | 89 |
| 163 | 3300005457 | Ga0070662_100009319 | Ga0070662_1000093198 | 89 |
| 164 | 3300005457 | Ga0070662_100075190 | Ga0070662_1000751904 | 89 |
| 165 | 3300005457 | Ga0070662_100258263 | Ga0070662_1002582632 | 89 |
| 166 | 3300005458 | Ga0070681_10013232 | Ga0070681_100132324 | 89 |
| 167 | 3300005458 | Ga0070681_11802011 | Ga0070681_118020111 | 89 |
| 168 | 3300005459 | Ga0068867_100019066 | Ga0068867_1000190666 | 89 |
| 169 | 3300005459 | Ga0068867_100670483 | Ga0068867_1006704831 | 89 |
| 170 | 3300005459 | Ga0068867_101842279 | Ga0068867_1018422791 | 89 |
| 171 | 3300005466 | Ga0070685_10311886 | Ga0070685_103118861 | 89 |
| 172 | 3300005467 | Ga0070706_100093860 | Ga0070706_1000938602 | 89 |
| 173 | 3300005467 | Ga0070706_100153517 | Ga0070706_1001535172 | 89 |
| 174 | 3300005468 | Ga0070707_100010243 | Ga0070707_1000102433 | 89 |
| 175 | 3300005471 | Ga0070698_100001773 | Ga0070698_10000177311 | 89 |
| 176 | 3300005471 | Ga0070698_100005766 | Ga0070698_1000057664 | 89 |
| 177 | 3300005471 | Ga0070698_100013373 | Ga0070698_1000133733 | 89 |
| 178 | 3300005471 | Ga0070698_100403485 | Ga0070698_1004034852 | 89 |
| 179 | 3300005471 | Ga0070698_100434165 | Ga0070698_1004341651 | 89 |
| 180 | 3300005518 | Ga0070699_100008100 | Ga0070699_10000810014 | 89 |
| 181 | 3300005518 | Ga0070699_100014890 | Ga0070699_10001489010 | 89 |
| 182 | 3300005518 | Ga0070699_101109977 | Ga0070699_1011099772 | 89 |
| 183 | 3300005530 | Ga0070679_100095939 | Ga0070679_1000959392 | 89 |
| 184 | 3300005530 | Ga0070679_100188270 | Ga0070679_1001882702 | 89 |
| 185 | 3300005535 | Ga0070684_100178225 | Ga0070684_1001782253 | 89 |
| 186 | 3300005536 | Ga0070697_100150157 | Ga0070697_1001501572 | 89 |
| 187 | 3300005536 | Ga0070697_100267237 | Ga0070697_1002672372 | 89 |
| 188 | 3300005536 | Ga0070697_101078919 | Ga0070697_1010789191 | 89 |
| 189 | 3300005539 | Ga0068853_100001254 | Ga0068853_1000012544 | 89 |
| 190 | 3300005539 | Ga0068853_100035656 | Ga0068853_1000356569 | 89 |
| 191 | 3300005539 | Ga0068853_100176501 | Ga0068853_1001765011 | 89 |
| 192 | 3300005543 | Ga0070672_100058839 | Ga0070672_1000588397 | 89 |
| 193 | 3300005543 | Ga0070672_101026309 | Ga0070672_1010263092 | 89 |
| 194 | 3300005543 | Ga0070672_101302223 | Ga0070672_1013022232 | 89 |
| 195 | 3300005544 | Ga0070686_100133801 | Ga0070686_1001338011 | 89 |
| 196 | 3300005544 | Ga0070686_100574030 | Ga0070686_1005740302 | 89 |
| 197 | 3300005544 | Ga0070686_101118342 | Ga0070686_1011183422 | 89 |
| 198 | 3300005545 | Ga0070695_100059343 | Ga0070695_1000593434 | 89 |
| 199 | 3300005545 | Ga0070695_100092549 | Ga0070695_1000925492 | 89 |
| 200 | 3300005545 | Ga0070695_100648881 | Ga0070695_1006488811 | 89 |
| 201 | 3300005545 | Ga0070695_100849832 | Ga0070695_1008498321 | 89 |
| 202 | 3300005546 | Ga0070696_100008469 | Ga0070696_1000084699 | 89 |
| 203 | 3300005546 | Ga0070696_100210842 | Ga0070696_1002108422 | 89 |
| 204 | 3300005546 | Ga0070696_100440023 | Ga0070696_1004400232 | 89 |
| 205 | 3300005546 | Ga0070696_101353376 | Ga0070696_1013533762 | 89 |
| 206 | 3300005547 | Ga0070693_100000335 | Ga0070693_1000003354 | 89 |
| 207 | 3300005547 | Ga0070693_100006162 | Ga0070693_1000061626 | 89 |
| 208 | 3300005547 | Ga0070693_101156594 | Ga0070693_1011565942 | 89 |
| 209 | 3300005548 | Ga0070665_100281208 | Ga0070665_1002812084 | 89 |
| 210 | 3300005549 | Ga0070704_100002702 | Ga0070704_1000027024 | 89 |
| 211 | 3300005549 | Ga0070704_100038598 | Ga0070704_1000385984 | 89 |
| 212 | 3300005549 | Ga0070704_100170849 | Ga0070704_1001708492 | 89 |
| 213 | 3300005549 | Ga0070704_100417639 | Ga0070704_1004176391 | 89 |
| 214 | 3300005549 | Ga0070704_100703663 | Ga0070704_1007036632 | 89 |
| 215 | 3300005549 | Ga0070704_101030125 | Ga0070704_1010301252 | 89 |
| 216 | 3300005563 | Ga0068855_100025398 | Ga0068855_1000253982 | 89 |
| 217 | 3300005563 | Ga0068855_100028649 | Ga0068855_1000286494 | 89 |
| 218 | 3300005563 | Ga0068855_100586151 | Ga0068855_1005861512 | 89 |
| 219 | 3300005563 | Ga0068855_100649612 | Ga0068855_1006496123 | 89 |
| 220 | 3300005564 | Ga0070664_100016128 | Ga0070664_1000161283 | 89 |
| 221 | 3300005564 | Ga0070664_101994409 | Ga0070664_1019944092 | 89 |
| 222 | 3300005577 | Ga0068857_100008113 | Ga0068857_1000081133 | 89 |
| 223 | 3300005577 | Ga0068857_100485090 | Ga0068857_1004850902 | 89 |
| 224 | 3300005577 | Ga0068857_100722783 | Ga0068857_1007227831 | 89 |
| 225 | 3300005578 | Ga0068854_100033226 | Ga0068854_1000332265 | 89 |
| 226 | 3300005578 | Ga0068854_100354843 | Ga0068854_1003548432 | 89 |
| 227 | 3300005578 | Ga0068854_100584774 | Ga0068854_1005847741 | 89 |
| 228 | 3300005578 | Ga0068854_102012297 | Ga0068854_1020122971 | 89 |
| 229 | 3300005614 | Ga0068856_100006379 | Ga0068856_10000637915 | 89 |
| 230 | 3300005614 | Ga0068856_100196451 | Ga0068856_1001964513 | 89 |
| 231 | 3300005614 | Ga0068856_100586400 | Ga0068856_1005864002 | 89 |
| 232 | 3300005615 | Ga0070702_100084587 | Ga0070702_1000845873 | 89 |
| 233 | 3300005616 | Ga0068852_102237791 | Ga0068852_1022377912 | 89 |
| 234 | 3300005617 | Ga0068859_100002405 | Ga0068859_1000024054 | 89 |
| 235 | 3300005617 | Ga0068859_100968764 | Ga0068859_1009687642 | 89 |
| 236 | 3300005617 | Ga0068859_102211091 | Ga0068859_1022110912 | 89 |
| 237 | 3300005618 | Ga0068864_100040924 | Ga0068864_1000409241 | 89 |
| 238 | 3300005618 | Ga0068864_100212170 | Ga0068864_1002121704 | 89 |
| 239 | 3300005718 | Ga0068866_10034207 | Ga0068866_100342076 | 89 |
| 240 | 3300005719 | Ga0068861_100000163 | Ga0068861_10000016332 | 89 |
| 241 | 3300005719 | Ga0068861_100057055 | Ga0068861_1000570554 | 89 |
| 242 | 3300005719 | Ga0068861_100070432 | Ga0068861_1000704322 | 89 |
| 243 | 3300005719 | Ga0068861_100100594 | Ga0068861_1001005942 | 89 |
| 244 | 3300005834 | Ga0068851_10170100 | Ga0068851_101701002 | 89 |
| 245 | 3300005834 | Ga0068851_10414898 | Ga0068851_104148981 | 89 |
| 246 | 3300005840 | Ga0068870_10001702 | Ga0068870_100017024 | 89 |
| 247 | 3300005840 | Ga0068870_10013234 | Ga0068870_100132345 | 89 |
| 248 | 3300005840 | Ga0068870_11462542 | Ga0068870_114625421 | 89 |
| 249 | 3300005841 | Ga0068863_100004794 | Ga0068863_10000479418 | 89 |
| 250 | 3300005841 | Ga0068863_100065655 | Ga0068863_1000656554 | 89 |
| 251 | 3300005842 | Ga0068858_100132018 | Ga0068858_1001320182 | 89 |
| 252 | 3300005842 | Ga0068858_101258941 | Ga0068858_1012589411 | 89 |
| 253 | 3300005843 | Ga0068860_100002551 | Ga0068860_10000255121 | 89 |
| 254 | 3300005843 | Ga0068860_100168623 | Ga0068860_1001686232 | 89 |
| 255 | 3300005843 | Ga0068860_101047112 | Ga0068860_1010471122 | 89 |
| 256 | 3300005844 | Ga0068862_100003160 | Ga0068862_1000031606 | 89 |
| 257 | 3300005844 | Ga0068862_100053469 | Ga0068862_1000534696 | 89 |
| 258 | 3300005844 | Ga0068862_100553702 | Ga0068862_1005537022 | 89 |
| 259 | 3300005981 | Ga0081538_10022655 | Ga0081538_100226555 | 89 |
| 260 | 3300005985 | Ga0081539_10000062 | Ga0081539_1000006292 | 89 |
| 261 | 3300005985 | Ga0081539_10003923 | Ga0081539_100039239 | 89 |
| 262 | 3300006028 | Ga0070717_10003878 | Ga0070717_1000387810 | 89 |
| 263 | 3300006028 | Ga0070717_10012210 | Ga0070717_100122102 | 89 |
| 264 | 3300006028 | Ga0070717_10662004 | Ga0070717_106620042 | 89 |
| 265 | 3300006028 | Ga0070717_10759689 | Ga0070717_107596892 | 89 |
| 266 | 3300006028 | Ga0070717_11268331 | Ga0070717_112683312 | 89 |
| 267 | 3300006038 | Ga0075365_10396674 | Ga0075365_103966742 | 89 |
| 268 | 3300006163 | Ga0070715_10076171 | Ga0070715_100761712 | 89 |
| 269 | 3300006175 | Ga0070712_100086099 | Ga0070712_1000860993 | 89 |
| 270 | 3300006175 | Ga0070712_100236816 | Ga0070712_1002368162 | 89 |
| 271 | 3300006175 | Ga0070712_100279665 | Ga0070712_1002796653 | 89 |
| 272 | 3300006175 | Ga0070712_101113261 | Ga0070712_1011132611 | 89 |
| 273 | 3300006237 | Ga0097621_100230914 | Ga0097621_1002309141 | 89 |
| 274 | 3300006358 | Ga0068871_100152968 | Ga0068871_1001529685 | 89 |
| 275 | 3300006358 | Ga0068871_100743294 | Ga0068871_1007432942 | 89 |
| 276 | 3300006844 | Ga0075428_102583565 | Ga0075428_1025835652 | 89 |
| 277 | 3300006847 | Ga0075431_100102179 | Ga0075431_1001021793 | 89 |
| 278 | 3300006852 | Ga0075433_10172524 | Ga0075433_101725242 | 89 |
| 279 | 3300006852 | Ga0075433_10370015 | Ga0075433_103700153 | 89 |
| 280 | 3300006852 | Ga0075433_10426633 | Ga0075433_104266332 | 89 |
| 281 | 3300006871 | Ga0075434_100006197 | Ga0075434_1000061972 | 89 |
| 282 | 3300006871 | Ga0075434_100902266 | Ga0075434_1009022662 | 89 |
| 283 | 3300006871 | Ga0075434_101326629 | Ga0075434_1013266292 | 89 |
| 284 | 3300006871 | Ga0075434_101975356 | Ga0075434_1019753561 | 89 |
| 285 | 3300006881 | Ga0068865_100101094 | Ga0068865_1001010942 | 89 |
| 286 | 3300006881 | Ga0068865_100610102 | Ga0068865_1006101022 | 89 |
| 287 | 3300006881 | Ga0068865_100656989 | Ga0068865_1006569892 | 89 |
| 288 | 3300006914 | Ga0075436_100037583 | Ga0075436_1000375836 | 89 |
| 289 | 3300006914 | Ga0075436_100581710 | Ga0075436_1005817102 | 89 |
| 290 | 3300006914 | Ga0075436_101486330 | Ga0075436_1014863301 | 89 |
| 291 | 3300006931 | Ga0097620_100002405 | Ga0097620_1000024054 | 89 |
| 292 | 3300006931 | Ga0097620_100968740 | Ga0097620_1009687402 | 89 |
| 293 | 3300006931 | Ga0097620_102210937 | Ga0097620_1022109372 | 89 |
| 294 | 3300007076 | Ga0075435_100016421 | Ga0075435_1000164212 | 89 |
| 295 | 3300007076 | Ga0075435_100019798 | Ga0075435_1000197982 | 89 |
| 296 | 3300007265 | Ga0099794_10152978 | Ga0099794_101529782 | 89 |
| 297 | 3300009093 | Ga0105240_10723779 | Ga0105240_107237792 | 89 |
| 298 | 3300009094 | Ga0111539_10413431 | Ga0111539_104134312 | 89 |
| 299 | 3300009094 | Ga0111539_11746667 | Ga0111539_117466672 | 89 |
| 300 | 3300009098 | Ga0105245_10061912 | Ga0105245_100619123 | 89 |
| 301 | 3300009098 | Ga0105245_11556027 | Ga0105245_115560272 | 89 |
| 302 | 3300009101 | Ga0105247_10005587 | Ga0105247_100055871 | 89 |
| 303 | 3300009101 | Ga0105247_10008746 | Ga0105247_100087465 | 89 |
| 304 | 3300009101 | Ga0105247_11402760 | Ga0105247_114027602 | 89 |
| 305 | 3300009101 | Ga0105247_11678451 | Ga0105247_116784512 | 89 |
| 306 | 3300009147 | Ga0114129_10136578 | Ga0114129_101365782 | 89 |
| 307 | 3300009147 | Ga0114129_10407162 | Ga0114129_104071622 | 89 |
| 308 | 3300009147 | Ga0114129_11113868 | Ga0114129_111138682 | 89 |
| 309 | 3300009148 | Ga0105243_10312776 | Ga0105243_103127761 | 89 |
| 310 | 3300009148 | Ga0105243_10667833 | Ga0105243_106678332 | 89 |
| 311 | 3300009148 | Ga0105243_11181270 | Ga0105243_111812702 | 89 |
| 312 | 3300009174 | Ga0105241_10017336 | Ga0105241_100173365 | 89 |
| 313 | 3300009176 | Ga0105242_10358714 | Ga0105242_103587143 | 89 |
| 314 | 3300009177 | Ga0105248_10012708 | Ga0105248_100127082 | 89 |
| 315 | 3300009177 | Ga0105248_10803476 | Ga0105248_108034762 | 89 |
| 316 | 3300009545 | Ga0105237_10159675 | Ga0105237_101596752 | 89 |
| 317 | 3300009551 | Ga0105238_10023340 | Ga0105238_100233403 | 89 |
| 318 | 3300009553 | Ga0105249_10029307 | Ga0105249_100293076 | 89 |
| 319 | 3300009553 | Ga0105249_10328769 | Ga0105249_103287691 | 89 |
| 320 | 3300010375 | Ga0105239_10076899 | Ga0105239_100768995 | 89 |
| 321 | 3300010375 | Ga0105239_10229682 | Ga0105239_102296822 | 89 |
| 322 | 3300010375 | Ga0105239_10805186 | Ga0105239_108051862 | 89 |
| 323 | 3300011119 | Ga0105246_10056067 | Ga0105246_100560672 | 89 |
| 324 | 3300011119 | Ga0105246_10179775 | Ga0105246_101797754 | 89 |
| 325 | 3300011119 | Ga0105246_10371983 | Ga0105246_103719832 | 89 |
| 326 | 3300013100 | Ga0157373_10013202 | Ga0157373_100132028 | 89 |
| 327 | 3300013100 | Ga0157373_10263879 | Ga0157373_102638792 | 89 |
| 328 | 3300013102 | Ga0157371_10143253 | Ga0157371_101432533 | 89 |
| 329 | 3300013104 | Ga0157370_10282402 | Ga0157370_102824022 | 89 |
| 330 | 3300013104 | Ga0157370_10789373 | Ga0157370_107893732 | 89 |
| 331 | 3300013105 | Ga0157369_10026497 | Ga0157369_100264978 | 89 |
| 332 | 3300013105 | Ga0157369_10087473 | Ga0157369_100874732 | 89 |
| 333 | 3300013105 | Ga0157369_10380510 | Ga0157369_103805102 | 89 |
| 334 | 3300013296 | Ga0157374_10722328 | Ga0157374_107223282 | 89 |
| 335 | 3300013297 | Ga0157378_10079725 | Ga0157378_100797256 | 89 |
| 336 | 3300013297 | Ga0157378_11503720 | Ga0157378_115037202 | 89 |
| 337 | 3300013307 | Ga0157372_10000063 | Ga0157372_10000063124 | 89 |
| 338 | 3300013307 | Ga0157372_10164276 | Ga0157372_101642764 | 89 |
| 339 | 3300013307 | Ga0157372_10964378 | Ga0157372_109643782 | 89 |
| 340 | 3300013308 | Ga0157375_10015979 | Ga0157375_1001597910 | 89 |
| 341 | 3300014325 | Ga0163163_10001286 | Ga0163163_1000128622 | 89 |
| 342 | 3300014325 | Ga0163163_10144405 | Ga0163163_101444052 | 89 |
| 343 | 3300014325 | Ga0163163_10757123 | Ga0163163_107571232 | 89 |
| 344 | 3300014326 | Ga0157380_10062931 | Ga0157380_100629314 | 89 |
| 345 | 3300014326 | Ga0157380_10633504 | Ga0157380_106335042 | 89 |
| 346 | 3300014326 | Ga0157380_10814239 | Ga0157380_108142392 | 89 |
| 347 | 3300014326 | Ga0157380_10910698 | Ga0157380_109106982 | 89 |
| 348 | 3300014326 | Ga0157380_11442168 | Ga0157380_114421682 | 89 |
| 349 | 3300014745 | Ga0157377_10138810 | Ga0157377_101388103 | 89 |
| 350 | 3300014745 | Ga0157377_11733155 | Ga0157377_117331552 | 89 |
| 351 | 3300014968 | Ga0157379_10142431 | Ga0157379_101424314 | 89 |
| 352 | 3300014968 | Ga0157379_10145235 | Ga0157379_101452353 | 89 |
| 353 | 3300020078 | Ga0206352_11300773 | Ga0206352_113007732 | 89 |
| 354 | 3300020082 | Ga0206353_10093591 | Ga0206353_100935912 | 89 |
| 355 | 3300021361 | Ga0213872_10038967 | Ga0213872_100389672 | 89 |
| 356 | 3300021361 | Ga0213872_10044512 | Ga0213872_100445122 | 89 |
| 357 | 3300021377 | Ga0213874_10022247 | Ga0213874_100222473 | 89 |
| 358 | 3300021377 | Ga0213874_10190889 | Ga0213874_101908892 | 89 |
| 359 | 3300021388 | Ga0213875_10058786 | Ga0213875_100587863 | 89 |
| 360 | 3300025321 | Ga0207656_10049889 | Ga0207656_100498892 | 89 |
| 361 | 3300025885 | Ga0207653_10004981 | Ga0207653_100049814 | 89 |
| 362 | 3300025898 | Ga0207692_10103749 | Ga0207692_101037491 | 89 |
| 363 | 3300025898 | Ga0207692_10272457 | Ga0207692_102724573 | 89 |
| 364 | 3300025898 | Ga0207692_10550315 | Ga0207692_105503151 | 89 |
| 365 | 3300025899 | Ga0207642_11107656 | Ga0207642_111076561 | 89 |
| 366 | 3300025900 | Ga0207710_10001953 | Ga0207710_100019539 | 89 |
| 367 | 3300025900 | Ga0207710_10681950 | Ga0207710_106819501 | 89 |
| 368 | 3300025903 | Ga0207680_10312889 | Ga0207680_103128892 | 89 |
| 369 | 3300025903 | Ga0207680_10569875 | Ga0207680_105698752 | 89 |
| 370 | 3300025904 | Ga0207647_10415468 | Ga0207647_104154681 | 89 |
| 371 | 3300025904 | Ga0207647_10436298 | Ga0207647_104362981 | 89 |
| 372 | 3300025905 | Ga0207685_10800853 | Ga0207685_108008531 | 89 |
| 373 | 3300025906 | Ga0207699_10050922 | Ga0207699_100509223 | 89 |
| 374 | 3300025906 | Ga0207699_10166597 | Ga0207699_101665972 | 89 |
| 375 | 3300025906 | Ga0207699_10657546 | Ga0207699_106575461 | 89 |
| 376 | 3300025907 | Ga0207645_10017421 | Ga0207645_1001742111 | 89 |
| 377 | 3300025907 | Ga0207645_10035422 | Ga0207645_100354225 | 89 |
| 378 | 3300025908 | Ga0207643_10001827 | Ga0207643_100018277 | 89 |
| 379 | 3300025908 | Ga0207643_10001973 | Ga0207643_100019735 | 89 |
| 380 | 3300025908 | Ga0207643_10746381 | Ga0207643_107463811 | 89 |
| 381 | 3300025910 | Ga0207684_10005173 | Ga0207684_100051732 | 89 |
| 382 | 3300025910 | Ga0207684_10112084 | Ga0207684_101120844 | 89 |
| 383 | 3300025910 | Ga0207684_10931306 | Ga0207684_109313061 | 89 |
| 384 | 3300025911 | Ga0207654_10007965 | Ga0207654_100079655 | 89 |
| 385 | 3300025912 | Ga0207707_10000752 | Ga0207707_100007525 | 89 |
| 386 | 3300025913 | Ga0207695_10522208 | Ga0207695_105222082 | 89 |
| 387 | 3300025915 | Ga0207693_10120635 | Ga0207693_101206352 | 89 |
| 388 | 3300025915 | Ga0207693_10276681 | Ga0207693_102766812 | 89 |
| 389 | 3300025915 | Ga0207693_10684301 | Ga0207693_106843012 | 89 |
| 390 | 3300025915 | Ga0207693_11053696 | Ga0207693_110536961 | 89 |
| 391 | 3300025916 | Ga0207663_10117030 | Ga0207663_101170301 | 89 |
| 392 | 3300025916 | Ga0207663_11202632 | Ga0207663_112026321 | 89 |
| 393 | 3300025917 | Ga0207660_10001549 | Ga0207660_1000154914 | 89 |
| 394 | 3300025917 | Ga0207660_11481036 | Ga0207660_114810362 | 89 |
| 395 | 3300025918 | Ga0207662_11308526 | Ga0207662_113085261 | 89 |
| 396 | 3300025919 | Ga0207657_10013830 | Ga0207657_100138304 | 89 |
| 397 | 3300025919 | Ga0207657_10293976 | Ga0207657_102939762 | 89 |
| 398 | 3300025919 | Ga0207657_11249874 | Ga0207657_112498742 | 89 |
| 399 | 3300025920 | Ga0207649_10005791 | Ga0207649_100057915 | 89 |
| 400 | 3300025920 | Ga0207649_10067083 | Ga0207649_100670832 | 89 |
| 401 | 3300025921 | Ga0207652_10006951 | Ga0207652_1000695113 | 89 |
| 402 | 3300025921 | Ga0207652_10112774 | Ga0207652_101127743 | 89 |
| 403 | 3300025922 | Ga0207646_10000263 | Ga0207646_1000026359 | 89 |
| 404 | 3300025922 | Ga0207646_11494549 | Ga0207646_114945491 | 89 |
| 405 | 3300025923 | Ga0207681_10030119 | Ga0207681_100301193 | 89 |
| 406 | 3300025923 | Ga0207681_10039611 | Ga0207681_100396118 | 89 |
| 407 | 3300025923 | Ga0207681_10352080 | Ga0207681_103520802 | 89 |
| 408 | 3300025924 | Ga0207694_10142565 | Ga0207694_101425651 | 89 |
| 409 | 3300025925 | Ga0207650_10028481 | Ga0207650_100284817 | 89 |
| 410 | 3300025925 | Ga0207650_10384600 | Ga0207650_103846002 | 89 |
| 411 | 3300025926 | Ga0207659_10890320 | Ga0207659_108903202 | 89 |
| 412 | 3300025927 | Ga0207687_11023751 | Ga0207687_110237512 | 89 |
| 413 | 3300025927 | Ga0207687_11255429 | Ga0207687_112554291 | 89 |
| 414 | 3300025928 | Ga0207700_10062636 | Ga0207700_100626362 | 89 |
| 415 | 3300025928 | Ga0207700_10682204 | Ga0207700_106822042 | 89 |
| 416 | 3300025928 | Ga0207700_11095464 | Ga0207700_110954641 | 89 |
| 417 | 3300025928 | Ga0207700_11503620 | Ga0207700_115036202 | 89 |
| 418 | 3300025928 | Ga0207700_12019378 | Ga0207700_120193782 | 89 |
| 419 | 3300025929 | Ga0207664_10148543 | Ga0207664_101485432 | 89 |
| 420 | 3300025929 | Ga0207664_10248028 | Ga0207664_102480283 | 89 |
| 421 | 3300025929 | Ga0207664_10325017 | Ga0207664_103250172 | 89 |
| 422 | 3300025929 | Ga0207664_10377801 | Ga0207664_103778012 | 89 |
| 423 | 3300025929 | Ga0207664_10897940 | Ga0207664_108979402 | 89 |
| 424 | 3300025929 | Ga0207664_11123172 | Ga0207664_111231722 | 89 |
| 425 | 3300025929 | Ga0207664_11826331 | Ga0207664_118263311 | 89 |
| 426 | 3300025931 | Ga0207644_10310956 | Ga0207644_103109563 | 89 |
| 427 | 3300025931 | Ga0207644_10502120 | Ga0207644_105021202 | 89 |
| 428 | 3300025932 | Ga0207690_10007312 | Ga0207690_100073124 | 89 |
| 429 | 3300025933 | Ga0207706_10027435 | Ga0207706_100274354 | 89 |
| 430 | 3300025933 | Ga0207706_10041618 | Ga0207706_100416185 | 89 |
| 431 | 3300025933 | Ga0207706_10390766 | Ga0207706_103907662 | 89 |
| 432 | 3300025935 | Ga0207709_11331879 | Ga0207709_113318791 | 89 |
| 433 | 3300025936 | Ga0207670_10004245 | Ga0207670_100042455 | 89 |
| 434 | 3300025936 | Ga0207670_10064667 | Ga0207670_100646672 | 89 |
| 435 | 3300025938 | Ga0207704_10503075 | Ga0207704_105030752 | 89 |
| 436 | 3300025938 | Ga0207704_10527801 | Ga0207704_105278012 | 89 |
| 437 | 3300025939 | Ga0207665_10082307 | Ga0207665_100823073 | 89 |
| 438 | 3300025939 | Ga0207665_10646635 | Ga0207665_106466352 | 89 |
| 439 | 3300025940 | Ga0207691_10168009 | Ga0207691_101680094 | 89 |
| 440 | 3300025941 | Ga0207711_10033379 | Ga0207711_100333799 | 89 |
| 441 | 3300025941 | Ga0207711_10456428 | Ga0207711_104564283 | 89 |
| 442 | 3300025942 | Ga0207689_10000161 | Ga0207689_1000016168 | 89 |
| 443 | 3300025942 | Ga0207689_10154485 | Ga0207689_101544854 | 89 |
| 444 | 3300025944 | Ga0207661_11090842 | Ga0207661_110908421 | 89 |
| 445 | 3300025944 | Ga0207661_11548294 | Ga0207661_115482941 | 89 |
| 446 | 3300025945 | Ga0207679_10002658 | Ga0207679_1000265815 | 89 |
| 447 | 3300025949 | Ga0207667_10001995 | Ga0207667_1000199532 | 89 |
| 448 | 3300025949 | Ga0207667_10245138 | Ga0207667_102451382 | 89 |
| 449 | 3300025949 | Ga0207667_10353734 | Ga0207667_103537343 | 89 |
| 450 | 3300025960 | Ga0207651_10101206 | Ga0207651_101012063 | 89 |
| 451 | 3300025961 | Ga0207712_11156179 | Ga0207712_111561792 | 89 |
| 452 | 3300025961 | Ga0207712_11601701 | Ga0207712_116017011 | 89 |
| 453 | 3300025961 | Ga0207712_12071885 | Ga0207712_120718851 | 89 |
| 454 | 3300025972 | Ga0207668_10040530 | Ga0207668_100405301 | 89 |
| 455 | 3300025972 | Ga0207668_10746590 | Ga0207668_107465901 | 89 |
| 456 | 3300025981 | Ga0207640_10006649 | Ga0207640_100066497 | 89 |
| 457 | 3300025986 | Ga0207658_10032287 | Ga0207658_100322874 | 89 |
| 458 | 3300025986 | Ga0207658_10126668 | Ga0207658_101266683 | 89 |
| 459 | 3300026023 | Ga0207677_10022615 | Ga0207677_100226156 | 89 |
| 460 | 3300026023 | Ga0207677_11676084 | Ga0207677_116760842 | 89 |
| 461 | 3300026035 | Ga0207703_10016833 | Ga0207703_100168332 | 89 |
| 462 | 3300026041 | Ga0207639_10040715 | Ga0207639_100407152 | 89 |
| 463 | 3300026041 | Ga0207639_10050166 | Ga0207639_100501664 | 89 |
| 464 | 3300026041 | Ga0207639_10099434 | Ga0207639_100994345 | 89 |
| 465 | 3300026075 | Ga0207708_11314589 | Ga0207708_113145892 | 89 |
| 466 | 3300026075 | Ga0207708_11848115 | Ga0207708_118481152 | 89 |
| 467 | 3300026078 | Ga0207702_10002368 | Ga0207702_100023686 | 89 |
| 468 | 3300026078 | Ga0207702_11982187 | Ga0207702_119821871 | 89 |
| 469 | 3300026088 | Ga0207641_10006063 | Ga0207641_1000606311 | 89 |
| 470 | 3300026088 | Ga0207641_10017765 | Ga0207641_100177654 | 89 |
| 471 | 3300026089 | Ga0207648_10000348 | Ga0207648_1000034830 | 89 |
| 472 | 3300026089 | Ga0207648_10001541 | Ga0207648_100015416 | 89 |
| 473 | 3300026089 | Ga0207648_11185121 | Ga0207648_111851212 | 89 |
| 474 | 3300026095 | Ga0207676_10013379 | Ga0207676_1001337913 | 89 |
| 475 | 3300026095 | Ga0207676_10367369 | Ga0207676_103673692 | 89 |
| 476 | 3300026095 | Ga0207676_10978764 | Ga0207676_109787642 | 89 |
| 477 | 3300026116 | Ga0207674_10051680 | Ga0207674_100516808 | 89 |
| 478 | 3300026116 | Ga0207674_10091046 | Ga0207674_100910465 | 89 |
| 479 | 3300026118 | Ga0207675_100001024 | Ga0207675_10000102420 | 89 |
| 480 | 3300026118 | Ga0207675_100008900 | Ga0207675_1000089004 | 89 |
| 481 | 3300026118 | Ga0207675_100029048 | Ga0207675_1000290482 | 89 |
| 482 | 3300026118 | Ga0207675_100080962 | Ga0207675_1000809622 | 89 |
| 483 | 3300026121 | Ga0207683_11567157 | Ga0207683_115671571 | 89 |
| 484 | 3300026142 | Ga0207698_10387213 | Ga0207698_103872132 | 89 |
| 485 | 3300026142 | Ga0207698_11856221 | Ga0207698_118562212 | 89 |
| 486 | 3300027665 | Ga0209983_1054816 | Ga0209983_10548162 | 89 |
| 487 | 3300028379 | Ga0268266_10522878 | Ga0268266_105228783 | 89 |
| 488 | 3300028380 | Ga0268265_10007886 | Ga0268265_100078865 | 89 |
| 489 | 3300028380 | Ga0268265_10021317 | Ga0268265_100213173 | 89 |
| 490 | 3300028380 | Ga0268265_10439913 | Ga0268265_104399133 | 89 |
| 491 | 3300028381 | Ga0268264_10008622 | Ga0268264_100086228 | 89 |
| 492 | 3300028381 | Ga0268264_10011647 | Ga0268264_100116474 | 89 |
| 493 | 3300028794 | Ga0307515_10000265 | Ga0307515_1000026513 | 89 |
| 494 | 3300028800 | Ga0265338_10552721 | Ga0265338_105527212 | 89 |
| 495 | 3300030878 | Ga0265770_1130481 | Ga0265770_11304811 | 89 |
| 496 | 3300031090 | Ga0265760_10001130 | Ga0265760_100011303 | 89 |
| 497 | 3300031242 | Ga0265329_10029553 | Ga0265329_100295532 | 89 |
| 498 | 3300031548 | Ga0307408_100022495 | Ga0307408_1000224955 | 89 |
| 499 | 3300031548 | Ga0307408_100473973 | Ga0307408_1004739732 | 89 |
| 500 | 3300034817 | Ga0373948_0150307 | Ga0373948_0150307_21_296 | 89 |
| 501 | 3300035090 | Ga0373949_0025399 | Ga0373949_0025399_216_491 | 89 |
| 502 | 3300035118 | Ga0373954_0015937 | Ga0373954_0015937_1099_1368 | 89 |
| 503 | 3300035119 | Ga0373956_0004341 | Ga0373956_0004341_3733_4002 | 89 |
| 504 | 3300035207 | Ga0373942_0342706 | Ga0373942_0342706_61_336 | 89 |
| 505 | 3300035410 | Ga0373924_0124064 | Ga0373924_0124064_45_317 | 89 |
| 506 | 3300035691 | Ga0373931_0308689 | Ga0373931_0308689_11_283 | 89 |
| 507 | 3300035692 | Ga0373935_1218529 | Ga0373935_1218529_129_398 | 89 |
| 508 | 3300035724 | Ga0373933_1068725 | Ga0373933_1068725_66_335 | 89 |
| 509 | 3300036401 | Ga0373937_0452978 | Ga0373937_0452978_649_918 | 89 |
| 510 | 3300036401 | Ga0373937_0471306 | Ga0373937_0471306_850_1122 | 89 |
| 511 | 3300037312 | Ga0395899_0783984 | Ga0395899_0783984_250_531 | 89 |
| 512 | 3300037466 | Ga0395898_0165556 | Ga0395898_0165556_1431_1712 | 89 |
| 513 | 3300037853 | Ga0436364_0552552 | Ga0436364_0552552_784_1053 | 89 |
| 514 | 3300037853 | Ga0436364_0906989 | Ga0436364_0906989_849_1118 | 89 |
| 515 | 3300037853 | Ga0436364_1507136 | Ga0436364_1507136_304_573 | 89 |
| 516 | 3300037853 | Ga0436364_1542968 | Ga0436364_1542968_1767_2036 | 89 |
| 517 | 3300038443 | Ga0395901_0099736 | Ga0395901_0099736_930_1211 | 89 |
| 518 | 3300038996 | Ga0242420_029350 | Ga0242420_029350_515_790 | 89 |
| 519 | 3300039437 | Ga0436365_0058541 | Ga0436365_0058541_344_637 | 89 |
| 520 | 3300039437 | Ga0436365_0110928 | Ga0436365_0110928_13_282 | 89 |
| 521 | 3300039437 | Ga0436365_1032723 | Ga0436365_1032723_368_649 | 89 |
| 522 | 3300039437 | Ga0436365_1108277 | Ga0436365_1108277_2689_2958 | 89 |
| 523 | 3300039437 | Ga0436365_1171371 | Ga0436365_1171371_170_439 | 89 |
| 524 | 3300039437 | Ga0436365_1446847 | Ga0436365_1446847_697_966 | 89 |
| 525 | 3300039437 | Ga0436365_1670062 | Ga0436365_1670062_3301_3570 | 89 |
| 526 | 3300039437 | Ga0436365_1930052 | Ga0436365_1930052_4470_4739 | 89 |
| 527 | 3300039447 | Ga0436361_0599619 | Ga0436361_0599619_9357_9626 | 89 |
| 528 | 3300039447 | Ga0436361_1189806 | Ga0436361_1189806_594_884 | 89 |
| 529 | 3300039450 | Ga0436363_0078425 | Ga0436363_0078425_167_499 | 89 |
| 530 | 3300039450 | Ga0436363_0377146 | Ga0436363_0377146_424_693 | 89 |
| 531 | 3300039450 | Ga0436363_0555427 | Ga0436363_0555427_743_1012 | 89 |
| 532 | 3300039450 | Ga0436363_1035210 | Ga0436363_1035210_1293_1562 | 89 |
| 533 | 3300039450 | Ga0436363_1212799 | Ga0436363_1212799_269_538 | 89 |
| 534 | 3300039450 | Ga0436363_1234560 | Ga0436363_1234560_177_446 | 89 |
| 535 | 3300039453 | Ga0436362_0072074 | Ga0436362_0072074_278_547 | 89 |
| 536 | 3300041496 | Ga0451839_1545871 | Ga0451839_1545871_288_563 | 89 |
| 537 | 3300042000 | Ga0439437_014709 | Ga0439437_014709_462_737 | 89 |
| 538 | 3300042005 | Ga0439448_0002372 | Ga0439448_0002372_2990_3265 | 89 |
| 539 | 3300042156 | Ga0439446_0367004 | Ga0439446_0367004_56_325 | 89 |
| 540 | 3300042438 | Ga0439459_0007901 | Ga0439459_0007901_174_449 | 89 |
| 541 | 3300042439 | Ga0439464_0203237 | Ga0439464_0203237_322_597 | 89 |
| 542 | 3300042876 | Ga0451577_0094721 | Ga0451577_0094721_1318_1593 | 89 |
| 543 | 3300044683 | Ga0466965_0057823 | Ga0466965_0057823_1069_1338 | 89 |
| 544 | 3300044683 | Ga0466965_0350679 | Ga0466965_0350679_480_749 | 89 |
| 545 | 3300044684 | Ga0466966_0233498 | Ga0466966_0233498_78_347 | 89 |
| 546 | 3300044693 | Ga0466961_0271795 | Ga0466961_0271795_739_1008 | 89 |
| 547 | 3300044693 | Ga0466961_0980174 | Ga0466961_0980174_37_342 | 89 |
| 548 | 3300044694 | Ga0466963_0030492 | Ga0466963_0030492_703_972 | 89 |
| 549 | 3300044694 | Ga0466963_0033987 | Ga0466963_0033987_2186_2455 | 89 |
| 550 | 3300044694 | Ga0466963_0041819 | Ga0466963_0041819_1732_2001 | 89 |
| 551 | 3300044694 | Ga0466963_0363805 | Ga0466963_0363805_168_440 | 89 |
| 552 | 3300044694 | Ga0466963_0638124 | Ga0466963_0638124_306_575 | 89 |
| 553 | 3300044706 | Ga0466964_0047123 | Ga0466964_0047123_555_824 | 89 |
| 554 | 3300044712 | Ga0453684_0697669 | Ga0453684_0697669_695_967 | 89 |
| 555 | 3300044712 | Ga0453684_0951799 | Ga0453684_0951799_332_607 | 89 |
| 556 | 3300044735 | Ga0466968_0366813 | Ga0466968_0366813_325_594 | 89 |
| 557 | 3300044765 | Ga0466970_0088520 | Ga0466970_0088520_1062_1331 | 89 |
| 558 | 3300044842 | Ga0466957_0119852 | Ga0466957_0119852_561_830 | 89 |
| 559 | 3300044842 | Ga0466957_0168897 | Ga0466957_0168897_143_412 | 89 |
| 560 | 3300044842 | Ga0466957_0254692 | Ga0466957_0254692_357_626 | 89 |
| 561 | 3300044842 | Ga0466957_0264178 | Ga0466957_0264178_211_486 | 89 |
| 562 | 3300045049 | Ga0466959_0029285 | Ga0466959_0029285_277_546 | 89 |
| 563 | 3300045049 | Ga0466959_0037295 | Ga0466959_0037295_922_1191 | 89 |
| 564 | 3300045049 | Ga0466959_0040655 | Ga0466959_0040655_1509_1778 | 89 |
| 565 | 3300045051 | Ga0451576_0018042 | Ga0451576_0018042_1800_2093 | 89 |
| 566 | 3300045051 | Ga0451576_0162691 | Ga0451576_0162691_1948_2223 | 89 |
| 567 | 3300045051 | Ga0451576_1833297 | Ga0451576_1833297_198_476 | 89 |
| 568 | 3300045836 | Ga0466958_0002818 | Ga0466958_0002818_8486_8755 | 89 |
| 569 | 3300045836 | Ga0466958_0034097 | Ga0466958_0034097_1388_1657 | 89 |
| 570 | 3300045836 | Ga0466958_0085776 | Ga0466958_0085776_28_297 | 89 |
| 571 | 3300045836 | Ga0466958_0568969 | Ga0466958_0568969_449_718 | 89 |
| 572 | 3300045976 | Ga0466967_0002139 | Ga0466967_0002139_2782_3051 | 89 |
| 573 | 3300045976 | Ga0466967_0015191 | Ga0466967_0015191_3092_3361 | 89 |
| 574 | 3300045976 | Ga0466967_1152384 | Ga0466967_1152384_292_564 | 89 |
| 575 | 3300045976 | Ga0466967_1720630 | Ga0466967_1720630_261_530 | 89 |
| 576 | 3300045976 | Ga0466967_1728059 | Ga0466967_1728059_98_373 | 89 |
| 577 | 3300046461 | Ga0495641_0302564 | Ga0495641_0302564_244_513 | 89 |
| 578 | 3300046472 | Ga0495580_0121523 | Ga0495580_0121523_1494_1772 | 89 |
| 579 | 3300046472 | Ga0495580_0171339 | Ga0495580_0171339_1142_1432 | 89 |
| 580 | 3300046500 | Ga0495596_0342514 | Ga0495596_0342514_62_334 | 89 |
| 581 | 3300046514 | Ga0495618_0693026 | Ga0495618_0693026_197_466 | 89 |
| 582 | 3300046533 | Ga0495640_0140535 | Ga0495640_0140535_865_1134 | 89 |
| 583 | 3300046642 | Ga0495634_0131253 | Ga0495634_0131253_1017_1289 | 89 |
| 584 | 3300046684 | Ga0495669_0098073 | Ga0495669_0098073_496_768 | 89 |
| 585 | 3300048905 | Ga0496102_0007322 | Ga0496102_0007322_4850_5122 | 89 |
| 586 | 3300048905 | Ga0496102_0035568 | Ga0496102_0035568_1036_1311 | 89 |
| 587 | 3300048908 | Ga0496105_1073333 | Ga0496105_1073333_246_515 | 89 |
| 588 | 3300048909 | Ga0496106_0049155 | Ga0496106_0049155_353_625 | 89 |
| 589 | 3300048909 | Ga0496106_0116538 | Ga0496106_0116538_495_770 | 89 |
| 590 | 3300048911 | Ga0496108_0808234 | Ga0496108_0808234_89_358 | 89 |
| 591 | 3300048912 | Ga0496109_0823816 | Ga0496109_0823816_278_553 | 89 |
| 592 | 3300048913 | Ga0496110_0412974 | Ga0496110_0412974_216_506 | 89 |
| 593 | 3300048913 | Ga0496110_1466005 | Ga0496110_1466005_58_327 | 89 |
| 594 | 3300048913 | Ga0496110_1611574 | Ga0496110_1611574_173_445 | 89 |
| 595 | 3300048914 | Ga0496111_0283818 | Ga0496111_0283818_796_1086 | 89 |
| 596 | 3300048915 | Ga0496112_0131781 | Ga0496112_0131781_964_1233 | 89 |
| 597 | 3300048915 | Ga0496112_0768790 | Ga0496112_0768790_401_691 | 89 |
| 598 | 3300048915 | Ga0496112_1634014 | Ga0496112_1634014_150_425 | 89 |
| 599 | 3300048916 | Ga0496113_0397184 | Ga0496113_0397184_523_813 | 89 |
| 600 | 3300048924 | Ga0496121_0035052 | Ga0496121_0035052_1779_2048 | 89 |
| 601 | 3300048928 | Ga0496125_0028838 | Ga0496125_0028838_1796_2065 | 89 |
| 602 | 3300049459 | Ga0495678_105484 | Ga0495678_105484_459_731 | 89 |
| 603 | 3300049588 | Ga0501072_0081005 | Ga0501072_0081005_1128_1418 | 89 |
| 604 | 3300049588 | Ga0501072_0154361 | Ga0501072_0154361_83_358 | 89 |
| 605 | 3300049588 | Ga0501072_0331475 | Ga0501072_0331475_659_928 | 89 |
| 606 | 3300049589 | Ga0501073_0830154 | Ga0501073_0830154_14_289 | 89 |
| 607 | 3300049592 | Ga0501076_1030548 | Ga0501076_1030548_127_396 | 89 |
| 608 | 3300049593 | Ga0501077_0038252 | Ga0501077_0038252_295_585 | 89 |
| 609 | 3300049742 | Ga0501080_0949155 | Ga0501080_0949155_115_384 | 89 |
| 610 | 3300049744 | Ga0501083_0825962 | Ga0501083_0825962_131_421 | 89 |
| 611 | 3300049824 | Ga0501045_0644691 | Ga0501045_0644691_12_284 | 89 |
| 612 | 3300050507 | nmdc:mga05p37_78264_c1 | nmdc:mga05p37_78264_c1_214_486 | 89 |
| 613 | 3300050507 | nmdc:mga05p37_872240_c1 | nmdc:mga05p37_872240_c1_335_625 | 89 |
| 614 | 3300050509 | nmdc:mga0qj67_1383768_c1 | nmdc:mga0qj67_1383768_c1_132_413 | 89 |
| 615 | 3300050509 | nmdc:mga0qj67_232868_c1 | nmdc:mga0qj67_232868_c1_1051_1320 | 89 |
| 616 | 3300050510 | nmdc:mga06r32_190316_c1 | nmdc:mga06r32_190316_c1_1618_1887 | 89 |
| 617 | 3300050511 | nmdc:mga08y16_1162549_c1 | nmdc:mga08y16_1162549_c1_404_676 | 89 |
| 618 | 3300050512 | nmdc:mga0n895_1027951_c1 | nmdc:mga0n895_1027951_c1_420_698 | 89 |
| 619 | 3300050512 | nmdc:mga0n895_440245_c1 | nmdc:mga0n895_440245_c1_662_937 | 89 |
| 620 | 3300050512 | nmdc:mga0n895_5131_c1 | nmdc:mga0n895_5131_c1_10385_10654 | 89 |
| 621 | 3300050513 | nmdc:mga0rr50_11675_c1 | nmdc:mga0rr50_11675_c1_2012_2281 | 89 |
| 622 | 3300050514 | nmdc:mga08x19_237366_c1 | nmdc:mga08x19_237366_c1_628_903 | 89 |
| 623 | 3300050515 | nmdc:mga0a205_424246_c1 | nmdc:mga0a205_424246_c1_402_686 | 89 |
| 624 | 3300050515 | nmdc:mga0a205_619964_c1 | nmdc:mga0a205_619964_c1_110_379 | 89 |
| 625 | 3300053078 | Ga0495612_0173611 | Ga0495612_0173611_58_327 | 89 |
| 626 | 3300053079 | Ga0500610_0087300 | Ga0500610_0087300_370_642 | 89 |
| 627 | 3300053092 | Ga0500583_0011899 | Ga0500583_0011899_2044_2316 | 89 |
| 628 | 3300053093 | Ga0500651_0273001 | Ga0500651_0273001_458_730 | 89 |
| 629 | 3300053118 | Ga0500594_0081104 | Ga0500594_0081104_671_943 | 89 |
| 630 | 3300053126 | Ga0500621_107118 | Ga0500621_107118_121_393 | 89 |
| 631 | 3300053130 | Ga0500642_0001284 | Ga0500642_0001284_986_1258 | 89 |
| 632 | 3300053147 | Ga0500589_000018 | Ga0500589_000018_99651_99923 | 89 |
| 633 | 3300053727 | Ga0500611_003222 | Ga0500611_003222_1351_1623 | 89 |
| 634 | 3300060353 | Ga0501082_1123113 | Ga0501082_1123113_60_350 | 89 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6o82-assembly1.cif.gz_A | s. pombe ubiquitin e1 complex with a ubiquitin-amp mimic | 0.7285 | 17 | 64 |
| 8j07-assembly1.cif.gz_n8 | 96nm repeat of human respiratory doublet microtubule and associated axonemal complexes | 0.6202 | 16 | 61 |
| 5wi4-assembly1.cif.gz_A | crystal structure of dynlt1/tctex-1 in complex with arhgef2 | 0.5875 | 5 | 61 |
| 5wi4-assembly1.cif.gz_C | crystal structure of dynlt1/tctex-1 in complex with arhgef2 | 0.5864 | 5 | 61 |
| 5wi4-assembly1.cif.gz_B | crystal structure of dynlt1/tctex-1 in complex with arhgef2 | 0.5835 | 5 | 61 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q76P23_14_308_1.50.40.10 | Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain | 0.6047 | 17 | 56 | 1.50.40.10 |
| af_Q9Y7S5_183_457_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.5953 | 19 | 56 | 1.20.1070.10 |
| af_Q55GE2_75_295_1.50.40.10 | Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain | 0.5607 | 17 | 60 | 1.50.40.10 |
| af_Q59VY8_255_427_1.20.1440.340 | Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); | 0.5546 | 17 | 63 | 1.20.1440.340 |
| af_F1R8V0_259_346_3.90.640.10 | Alpha Beta;Alpha-Beta Complex;Actin; Chain A, domain 4;ATPase, substrate binding domain, subdomain 4 | 0.5499 | 16 | 59 | 3.90.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9NU50-F1-model_v4 | DUF2277 domain-containing protein | 0.9938 | 8 | 88 |
|
| AF-A0A445N7E6-F1-model_v4 | deleted | 0.9765 | 16 | 67 |
|
| AF-A0A2V6LD18-F1-model_v4 | DUF2277 domain-containing protein | 0.9744 | 5 | 88 |
|
| AF-A0A212T3K0-F1-model_v4 | deleted | 0.9604 | 16 | 68 |
|
| AF-A0A1D7W0J5-F1-model_v4 | DUF2277 domain-containing protein | 0.9563 | 21 | 86 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar