F471182

General Info

Members Datasets Scaffolds Average Seq Length
634 316 634 91

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0078425|Ga0436363_0078425_167_499
Length 110
Sequence VQAHPVRIDRGRVLAISRLCFMCRNIRTLYNFDPPATEEEVRSAALQYVRKISGFNKPSRANEEAFARAVDAVALASTLLLDELRTTAPAKNRDVEAAKARARAAERFAA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
126 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
202 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
203 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
204 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
223 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
224 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
225 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
226 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
227 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
228 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
229 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
230 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
231 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
232 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
233 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
234 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
235 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
236 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
237 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
238 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
239 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
249 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
250 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
251 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
252 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
253 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
254 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
262 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
277 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
278 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
288 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
289 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
290 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
291 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
292 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
293 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
294 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
295 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
296 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
299 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
300 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
301 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
302 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
303 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
304 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
305 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
306 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
307 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
308 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
309 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
310 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
311 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
312 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
313 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
314 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
315 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
316 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.42
Nodule 0
Rhizoplane 3.63
Rhizosphere 90.06
Stem 0
Stem Tuber 0
Unclassified 4.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_104125 2162886012 Bacteria 1271
2 MBSR1b_contig_2996384 2162886012 Bacteria 1335
3 MBSR1b_contig_3421288 2162886012 Bacteria 1897
4 LJNas_1003048 3300000546 Bacteria 1959
5 JGI25406J46586_10051518 3300003203 Bacteria 1377
6 Ga0065704_10086353 3300005289 Bacteria 3122
7 Ga0065715_10143431 3300005293 Bacteria 1820
8 Ga0065715_10221217 3300005293 Bacteria 1271
9 Ga0065707_10095199 3300005295 Bacteria 3401
10 Ga0070658_10766877 3300005327 Bacteria 838
11 Ga0070676_10009857 3300005328 Bacteria 5169
12 Ga0070676_10041510 3300005328 Bacteria 2668
13 Ga0070683_100813630 3300005329 Bacteria 896
14 Ga0070683_101805545 3300005329 Bacteria 588
15 Ga0070683_101920826 3300005329 Unclassified 569
16 Ga0070690_100006698 3300005330 Bacteria 6544
17 Ga0070690_100473012 3300005330 Bacteria 933
18 Ga0070670_100002355 3300005331 Bacteria 15575
19 Ga0070670_100034764 3300005331 Bacteria 4338
20 Ga0068869_100002790 3300005334 Bacteria 10583
21 Ga0068869_100118708 3300005334 Bacteria 2020
22 Ga0070666_10170492 3300005335 Bacteria 1524
23 Ga0070666_10367533 3300005335 Unclassified 1031
24 Ga0070680_100029552 3300005336 Bacteria 4402
25 Ga0070682_100001736 3300005337 Bacteria 12126
26 Ga0068868_100021200 3300005338 Bacteria 4892
27 Ga0068868_100053819 3300005338 Bacteria 3171
28 Ga0070660_100024521 3300005339 Bacteria 4474
29 Ga0070689_100008100 3300005340 Bacteria 7383
30 Ga0070689_100038414 3300005340 Unclassified 3663
31 Ga0070691_11055848 3300005341 Bacteria 510
32 Ga0070687_101485726 3300005343 Bacteria 509
33 Ga0070661_100008091 3300005344 Bacteria 7254
34 Ga0070661_100008363 3300005344 Bacteria 7149
35 Ga0070692_10153850 3300005345 Bacteria 1312
36 Ga0070692_10217213 3300005345 Bacteria 1128
37 Ga0070692_10828770 3300005345 Bacteria 634
38 Ga0070668_100055509 3300005347 Bacteria 3057
39 Ga0070669_100003871 3300005353 Bacteria 10821
40 Ga0070669_100051843 3300005353 Bacteria 3000
41 Ga0070669_100102332 3300005353 Unclassified 2163
42 Ga0070675_101346700 3300005354 Unclassified 658
43 Ga0070671_100294056 3300005355 Bacteria 1382
44 Ga0070674_100779752 3300005356 Unclassified 824
45 Ga0070674_102069444 3300005356 Bacteria 519
46 Ga0070673_100013779 3300005364 Bacteria 5608
47 Ga0070673_100361818 3300005364 Unclassified 1290
48 Ga0070659_100004587 3300005366 Bacteria 9884
49 Ga0070659_100106780 3300005366 Bacteria 2257
50 Ga0070659_100263651 3300005366 Unclassified 1430
51 Ga0070667_100164838 3300005367 Bacteria 1954
52 Ga0070703_10004880 3300005406 Bacteria 3747
53 Ga0070709_10105418 3300005434 Bacteria 1885
54 Ga0070709_10813100 3300005434 Unclassified 734
55 Ga0070714_100018859 3300005435 Bacteria 5612
56 Ga0070714_100495330 3300005435 Bacteria 1165
57 Ga0070713_100110388 3300005436 Bacteria 2397
58 Ga0070713_100253800 3300005436 Bacteria 1605
59 Ga0070713_100946618 3300005436 Bacteria 829
60 Ga0070713_100962330 3300005436 Bacteria 823
61 Ga0070713_101424173 3300005436 Bacteria 672
62 Ga0070710_10028231 3300005437 Bacteria 2999
63 Ga0070710_10267863 3300005437 Bacteria 1104
64 Ga0070710_10268253 3300005437 Bacteria 1103
65 Ga0070710_10559373 3300005437 Bacteria 791
66 Ga0070701_10005017 3300005438 Bacteria 5427
67 Ga0070701_10052223 3300005438 Bacteria 2123
68 Ga0070701_10377923 3300005438 Unclassified 892
69 Ga0070711_100365898 3300005439 Unclassified 1162
70 Ga0070711_100463548 3300005439 Bacteria 1039
71 Ga0070711_100666069 3300005439 Bacteria 874
72 Ga0070705_100004665 3300005440 Bacteria 6674
73 Ga0070700_100285073 3300005441 Bacteria 1199
74 Ga0070700_100305595 3300005441 Bacteria 1163
75 Ga0070700_100391751 3300005441 Bacteria 1042
76 Ga0070700_101398380 3300005441 Unclassified 591
77 Ga0070694_100001325 3300005444 Bacteria 14426
78 Ga0070694_100087251 3300005444 Bacteria 2182
79 Ga0070708_100009402 3300005445 Bacteria 7881
80 Ga0070678_100527176 3300005456 Bacteria 1046
81 Ga0070678_100675651 3300005456 Unclassified 928
82 Ga0070662_100009319 3300005457 Bacteria 6416
83 Ga0070662_100075190 3300005457 Unclassified 2501
84 Ga0070662_100258263 3300005457 Unclassified 1403
85 Ga0070681_10013232 3300005458 Bacteria 8198
86 Ga0070681_11802011 3300005458 Unclassified 539
87 Ga0068867_100019066 3300005459 Bacteria 4884
88 Ga0068867_100670483 3300005459 Unclassified 912
89 Ga0068867_101842279 3300005459 Unclassified 569
90 Ga0070685_10311886 3300005466 Unclassified 1063
91 Ga0070706_100093860 3300005467 Bacteria 2784
92 Ga0070706_100153517 3300005467 Bacteria 2150
93 Ga0070707_100010243 3300005468 Bacteria 8730
94 Ga0070698_100001773 3300005471 Bacteria 24065
95 Ga0070698_100005766 3300005471 Bacteria 13541
96 Ga0070698_100013373 3300005471 Bacteria 8688
97 Ga0070698_100124822 3300005471 Bacteria 2531
98 Ga0070698_100403485 3300005471 Bacteria 1300
99 Ga0070698_100434165 3300005471 Bacteria 1248
100 Ga0070699_100008100 3300005518 Bacteria 9125
101 Ga0070699_100014890 3300005518 Bacteria 6686
102 Ga0070699_100650562 3300005518 Bacteria 962
103 Ga0070699_101109977 3300005518 Bacteria 725
104 Ga0070679_100095939 3300005530 Unclassified 2953
105 Ga0070679_100188270 3300005530 Bacteria 2033
106 Ga0070684_100178225 3300005535 Bacteria 1932
107 Ga0070697_100150157 3300005536 Bacteria 1963
108 Ga0070697_100267237 3300005536 Bacteria 1465
109 Ga0070697_101078919 3300005536 Bacteria 714
110 Ga0068853_100001254 3300005539 Bacteria 18128
111 Ga0068853_100035656 3300005539 Bacteria 4226
112 Ga0068853_100176501 3300005539 Bacteria 1935
113 Ga0070672_100058839 3300005543 Unclassified 3022
114 Ga0070672_101026309 3300005543 Unclassified 731
115 Ga0070672_101302223 3300005543 Bacteria 649
116 Ga0070686_100133801 3300005544 Bacteria 1718
117 Ga0070686_100574030 3300005544 Bacteria 885
118 Ga0070686_101118342 3300005544 Bacteria 651
119 Ga0070695_100059343 3300005545 Bacteria 2476
120 Ga0070695_100092549 3300005545 Bacteria 2021
121 Ga0070695_100648881 3300005545 Unclassified 833
122 Ga0070695_100849832 3300005545 Bacteria 734
123 Ga0070696_100008469 3300005546 Bacteria 6882
124 Ga0070696_100210842 3300005546 Bacteria 1454
125 Ga0070696_100440023 3300005546 Bacteria 1027
126 Ga0070696_101353376 3300005546 Unclassified 606
127 Ga0070693_100000335 3300005547 Bacteria 21488
128 Ga0070693_100006162 3300005547 Bacteria 5809
129 Ga0070693_101156594 3300005547 Unclassified 592
130 Ga0070665_100281208 3300005548 Bacteria 1666
131 Ga0070704_100002702 3300005549 Bacteria 10024
132 Ga0070704_100038598 3300005549 Bacteria 3273
133 Ga0070704_100170849 3300005549 Bacteria 1729
134 Ga0070704_100212046 3300005549 Bacteria 1570
135 Ga0070704_100417639 3300005549 Bacteria 1148
136 Ga0070704_100703663 3300005549 Unclassified 896
137 Ga0070704_101030125 3300005549 Bacteria 745
138 Ga0068855_100025398 3300005563 Bacteria 7089
139 Ga0068855_100028649 3300005563 Bacteria 6663
140 Ga0068855_100586151 3300005563 Bacteria 1204
141 Ga0068855_100649612 3300005563 Unclassified 1133
142 Ga0070664_100016128 3300005564 Bacteria 6124
143 Ga0070664_101994409 3300005564 Unclassified 551
144 Ga0068857_100008113 3300005577 Bacteria 9065
145 Ga0068857_100305365 3300005577 Bacteria 1467
146 Ga0068857_100485090 3300005577 Unclassified 1159
147 Ga0068857_100722783 3300005577 Bacteria 947
148 Ga0068854_100033226 3300005578 Bacteria 3596
149 Ga0068854_100354843 3300005578 Bacteria 1201
150 Ga0068854_100584774 3300005578 Unclassified 951
151 Ga0068854_102012297 3300005578 Unclassified 532
152 Ga0068856_100006379 3300005614 Bacteria 11569
153 Ga0068856_100196451 3300005614 Bacteria 2031
154 Ga0068856_100586400 3300005614 Unclassified 1136
155 Ga0070702_100084587 3300005615 Bacteria 1908
156 Ga0068852_102237791 3300005616 Unclassified 568
157 Ga0068859_100002405 3300005617 Bacteria 19058
158 Ga0068859_100968764 3300005617 Unclassified 933
159 Ga0068859_102211091 3300005617 Unclassified 607
160 Ga0068864_100040924 3300005618 Bacteria 3963
161 Ga0068864_100212170 3300005618 Bacteria 1783
162 Ga0068864_102490985 3300005618 Unclassified 524
163 Ga0068866_10034207 3300005718 Bacteria 2473
164 Ga0068861_100000163 3300005719 Bacteria 34909
165 Ga0068861_100057055 3300005719 Bacteria 2982
166 Ga0068861_100070432 3300005719 Bacteria 2708
167 Ga0068861_100100594 3300005719 Bacteria 2298
168 Ga0068851_10170100 3300005834 Bacteria 1202
169 Ga0068851_10414898 3300005834 Bacteria 794
170 Ga0068870_10001702 3300005840 Bacteria 8994
171 Ga0068870_10013234 3300005840 Unclassified 3874
172 Ga0068870_11462542 3300005840 Unclassified 502
173 Ga0068863_100004794 3300005841 Bacteria 13325
174 Ga0068863_100065655 3300005841 Bacteria 3433
175 Ga0068858_100132018 3300005842 Bacteria 2342
176 Ga0068858_101258941 3300005842 Bacteria 728
177 Ga0068860_100002551 3300005843 Bacteria 19035
178 Ga0068860_100168623 3300005843 Bacteria 2114
179 Ga0068860_101047112 3300005843 Bacteria 834
180 Ga0068862_100003160 3300005844 Bacteria 14318
181 Ga0068862_100053469 3300005844 Bacteria 3457
182 Ga0068862_100253313 3300005844 Bacteria 1605
183 Ga0068862_100553702 3300005844 Bacteria 1098
184 Ga0081538_10022655 3300005981 Bacteria 4545
185 Ga0081539_10000062 3300005985 Bacteria 249871
186 Ga0081539_10003923 3300005985 Bacteria 17274
187 Ga0070717_10003878 3300006028 Bacteria 10751
188 Ga0070717_10012210 3300006028 Bacteria 6550
189 Ga0070717_10662004 3300006028 Unclassified 948
190 Ga0070717_10759689 3300006028 Bacteria 881
191 Ga0070717_11209429 3300006028 Bacteria 687
192 Ga0070717_11268331 3300006028 Bacteria 670
193 Ga0075365_10396674 3300006038 Bacteria 974
194 Ga0070715_10076171 3300006163 Bacteria 1511
195 Ga0070712_100014619 3300006175 Bacteria 5038
196 Ga0070712_100086099 3300006175 Bacteria 2289
197 Ga0070712_100236816 3300006175 Bacteria 1452
198 Ga0070712_100279665 3300006175 Bacteria 1344
199 Ga0070712_101113261 3300006175 Bacteria 686
200 Ga0097621_100230914 3300006237 Bacteria 1615
201 Ga0068871_100152968 3300006358 Bacteria 1968
202 Ga0068871_100743294 3300006358 Bacteria 901
203 Ga0075428_102583565 3300006844 Bacteria 519
204 Ga0075431_100102179 3300006847 Unclassified 2958
205 Ga0075431_101242366 3300006847 Bacteria 707
206 Ga0075433_10172524 3300006852 Bacteria 1924
207 Ga0075433_10370015 3300006852 Bacteria 1266
208 Ga0075433_10426633 3300006852 Bacteria 1169
209 Ga0075434_100006197 3300006871 Bacteria 10954
210 Ga0075434_100902266 3300006871 Bacteria 899
211 Ga0075434_101326629 3300006871 Bacteria 730
212 Ga0075434_101975356 3300006871 Bacteria 589
213 Ga0068865_100101094 3300006881 Bacteria 2111
214 Ga0068865_100610102 3300006881 Bacteria 923
215 Ga0068865_100656989 3300006881 Bacteria 892
216 Ga0075436_100037583 3300006914 Bacteria 3342
217 Ga0075436_100581710 3300006914 Bacteria 824
218 Ga0075436_101486330 3300006914 Unclassified 514
219 Ga0097620_100002405 3300006931 Bacteria 19058
220 Ga0097620_100968740 3300006931 Unclassified 933
221 Ga0097620_102210937 3300006931 Unclassified 607
222 Ga0075435_100016421 3300007076 Bacteria 5582
223 Ga0075435_100019798 3300007076 Bacteria 5148
224 Ga0099794_10152978 3300007265 Bacteria 1171
225 Ga0099794_10565215 3300007265 Bacteria 601
226 Ga0105240_10723779 3300009093 Bacteria 1084
227 Ga0111539_10013648 3300009094 Bacteria 10147
228 Ga0111539_10413431 3300009094 Bacteria 1571
229 Ga0111539_11746667 3300009094 Bacteria 721
230 Ga0105245_10061912 3300009098 Unclassified 3375
231 Ga0105245_11556027 3300009098 Bacteria 713
232 Ga0105247_10005587 3300009101 Bacteria 7896
233 Ga0105247_10008746 3300009101 Bacteria 6179
234 Ga0105247_11402760 3300009101 Bacteria 565
235 Ga0105247_11678451 3300009101 Unclassified 524
236 Ga0114129_10136578 3300009147 Bacteria 3364
237 Ga0114129_10407162 3300009147 Bacteria 1792
238 Ga0114129_11113868 3300009147 Bacteria 988
239 Ga0105243_10312776 3300009148 Unclassified 1428
240 Ga0105243_10667833 3300009148 Bacteria 1009
241 Ga0105243_11181270 3300009148 Bacteria 777
242 Ga0105241_10017336 3300009174 Bacteria 5290
243 Ga0105242_10358714 3300009176 Unclassified 1349
244 Ga0105248_10012708 3300009177 Bacteria 9292
245 Ga0105248_10803476 3300009177 Bacteria 1062
246 Ga0105237_10159675 3300009545 Bacteria 2252
247 Ga0105238_10023340 3300009551 Bacteria 6306
248 Ga0105249_10029307 3300009553 Unclassified 4970
249 Ga0105249_10328769 3300009553 Bacteria 1542
250 Ga0105249_11505123 3300009553 Bacteria 745
251 Ga0105249_13524712 3300009553 Bacteria 504
252 Ga0105239_10076899 3300010375 Bacteria 3671
253 Ga0105239_10229682 3300010375 Unclassified 2082
254 Ga0105239_10805186 3300010375 Bacteria 1076
255 Ga0105246_10056067 3300011119 Bacteria 2722
256 Ga0105246_10179775 3300011119 Bacteria 1628
257 Ga0105246_10371983 3300011119 Bacteria 1178
258 Ga0105246_11436328 3300011119 Bacteria 645
259 Ga0157373_10013202 3300013100 Bacteria 6064
260 Ga0157373_10263879 3300013100 Bacteria 1219
261 Ga0157371_10143253 3300013102 Bacteria 1702
262 Ga0157370_10282402 3300013104 Bacteria 1534
263 Ga0157370_10789373 3300013104 Bacteria 864
264 Ga0157369_10026497 3300013105 Bacteria 6429
265 Ga0157369_10087473 3300013105 Unclassified 3327
266 Ga0157369_10380510 3300013105 Unclassified 1465
267 Ga0157374_10722328 3300013296 Bacteria 1010
268 Ga0157378_10079725 3300013297 Bacteria 2956
269 Ga0157378_11503720 3300013297 Bacteria 718
270 Ga0157372_10000063 3300013307 Bacteria 119595
271 Ga0157372_10164276 3300013307 Bacteria 2567
272 Ga0157372_10964378 3300013307 Unclassified 988
273 Ga0157375_10015979 3300013308 Bacteria 6733
274 Ga0163163_10001286 3300014325 Bacteria 21179
275 Ga0163163_10144405 3300014325 Bacteria 2423
276 Ga0163163_10757123 3300014325 Unclassified 1035
277 Ga0157380_10062931 3300014326 Bacteria 2974
278 Ga0157380_10633504 3300014326 Bacteria 1064
279 Ga0157380_10814239 3300014326 Bacteria 952
280 Ga0157380_10910698 3300014326 Bacteria 906
281 Ga0157380_11442168 3300014326 Unclassified 740
282 Ga0157377_10138810 3300014745 Bacteria 1492
283 Ga0157377_11733155 3300014745 Unclassified 505
284 Ga0157379_10142431 3300014968 Unclassified 2161
285 Ga0157379_10145235 3300014968 Bacteria 2139
286 Ga0157379_10653030 3300014968 Unclassified 985
287 Ga0157376_10186242 3300014969 Bacteria 1901
288 Ga0206352_11300773 3300020078 Bacteria 670
289 Ga0206353_10093591 3300020082 Bacteria 1315
290 Ga0213872_10038967 3300021361 Bacteria 2169
291 Ga0213872_10044512 3300021361 Bacteria 2020
292 Ga0213872_10233128 3300021361 Bacteria 780
293 Ga0213874_10022247 3300021377 Bacteria 1757
294 Ga0213874_10190889 3300021377 Bacteria 733
295 Ga0213874_10224840 3300021377 Bacteria 683
296 Ga0213876_10229679 3300021384 Bacteria 986
297 Ga0213875_10058786 3300021388 Unclassified 1800
298 Ga0207656_10049889 3300025321 Bacteria 1806
299 Ga0207653_10004981 3300025885 Bacteria 4149
300 Ga0207692_10103749 3300025898 Bacteria 1566
301 Ga0207692_10272457 3300025898 Bacteria 1021
302 Ga0207692_10550315 3300025898 Unclassified 737
303 Ga0207692_10734870 3300025898 Bacteria 642
304 Ga0207642_11107656 3300025899 Unclassified 512
305 Ga0207710_10001953 3300025900 Bacteria 9853
306 Ga0207710_10681950 3300025900 Unclassified 539
307 Ga0207680_10312889 3300025903 Unclassified 1097
308 Ga0207680_10569875 3300025903 Bacteria 809
309 Ga0207647_10415468 3300025904 Bacteria 757
310 Ga0207647_10436298 3300025904 Unclassified 735
311 Ga0207685_10800853 3300025905 Unclassified 519
312 Ga0207699_10050922 3300025906 Unclassified 2445
313 Ga0207699_10166597 3300025906 Bacteria 1471
314 Ga0207699_10657546 3300025906 Bacteria 766
315 Ga0207645_10017421 3300025907 Unclassified 4742
316 Ga0207645_10035422 3300025907 Bacteria 3205
317 Ga0207643_10001827 3300025908 Bacteria 11804
318 Ga0207643_10001973 3300025908 Bacteria 11330
319 Ga0207643_10746381 3300025908 Unclassified 633
320 Ga0207684_10005173 3300025910 Bacteria 12147
321 Ga0207684_10112084 3300025910 Bacteria 2335
322 Ga0207684_10931306 3300025910 Unclassified 729
323 Ga0207654_10007965 3300025911 Bacteria 5342
324 Ga0207707_10000752 3300025912 Bacteria 31930
325 Ga0207695_10522208 3300025913 Bacteria 1069
326 Ga0207693_10012195 3300025915 Bacteria 6943
327 Ga0207693_10120635 3300025915 Bacteria 2059
328 Ga0207693_10276681 3300025915 Bacteria 1315
329 Ga0207693_10684301 3300025915 Bacteria 795
330 Ga0207693_11053696 3300025915 Bacteria 619
331 Ga0207663_10117030 3300025916 Bacteria 1818
332 Ga0207663_11202632 3300025916 Bacteria 610
333 Ga0207663_11280850 3300025916 Bacteria 590
334 Ga0207660_10001549 3300025917 Bacteria 15399
335 Ga0207660_11481036 3300025917 Unclassified 549
336 Ga0207662_11308526 3300025918 Bacteria 515
337 Ga0207657_10013830 3300025919 Bacteria 7898
338 Ga0207657_10293976 3300025919 Unclassified 1288
339 Ga0207657_11249874 3300025919 Bacteria 563
340 Ga0207649_10005791 3300025920 Bacteria 6691
341 Ga0207649_10067083 3300025920 Unclassified 2277
342 Ga0207652_10006951 3300025921 Bacteria 9116
343 Ga0207652_10112774 3300025921 Unclassified 2413
344 Ga0207646_10000263 3300025922 Bacteria 71413
345 Ga0207646_11494549 3300025922 Bacteria 585
346 Ga0207681_10030119 3300025923 Bacteria 3535
347 Ga0207681_10039611 3300025923 Bacteria 3130
348 Ga0207681_10352080 3300025923 Unclassified 1179
349 Ga0207694_10142565 3300025924 Bacteria 1927
350 Ga0207650_10028481 3300025925 Bacteria 4006
351 Ga0207650_10384600 3300025925 Unclassified 1159
352 Ga0207659_10890320 3300025926 Bacteria 765
353 Ga0207687_11023751 3300025927 Bacteria 708
354 Ga0207687_11255429 3300025927 Bacteria 637
355 Ga0207700_10015511 3300025928 Bacteria 5030
356 Ga0207700_10062636 3300025928 Bacteria 2825
357 Ga0207700_10682204 3300025928 Bacteria 917
358 Ga0207700_11095464 3300025928 Bacteria 712
359 Ga0207700_11503620 3300025928 Bacteria 597
360 Ga0207700_12019378 3300025928 Bacteria 503
361 Ga0207664_10148543 3300025929 Bacteria 1989
362 Ga0207664_10248028 3300025929 Bacteria 1553
363 Ga0207664_10325017 3300025929 Bacteria 1358
364 Ga0207664_10377801 3300025929 Bacteria 1258
365 Ga0207664_10897940 3300025929 Bacteria 796
366 Ga0207664_11123172 3300025929 Bacteria 702
367 Ga0207664_11826331 3300025929 Bacteria 530
368 Ga0207644_10310956 3300025931 Bacteria 1272
369 Ga0207644_10502120 3300025931 Bacteria 1001
370 Ga0207690_10007312 3300025932 Bacteria 6556
371 Ga0207706_10027435 3300025933 Bacteria 5091
372 Ga0207706_10041618 3300025933 Bacteria 4072
373 Ga0207706_10390766 3300025933 Bacteria 1207
374 Ga0207709_11331879 3300025935 Unclassified 594
375 Ga0207670_10004245 3300025936 Bacteria 7686
376 Ga0207670_10064667 3300025936 Bacteria 2508
377 Ga0207704_10503075 3300025938 Unclassified 977
378 Ga0207704_10527801 3300025938 Bacteria 956
379 Ga0207665_10082307 3300025939 Bacteria 2218
380 Ga0207665_10646635 3300025939 Bacteria 829
381 Ga0207691_10168009 3300025940 Bacteria 1922
382 Ga0207711_10033379 3300025941 Bacteria 4354
383 Ga0207711_10456428 3300025941 Bacteria 1190
384 Ga0207689_10000161 3300025942 Bacteria 57831
385 Ga0207689_10154485 3300025942 Bacteria 1892
386 Ga0207661_11090842 3300025944 Bacteria 735
387 Ga0207661_11548294 3300025944 Unclassified 607
388 Ga0207679_10002658 3300025945 Bacteria 11030
389 Ga0207667_10001995 3300025949 Bacteria 25601
390 Ga0207667_10245138 3300025949 Bacteria 1833
391 Ga0207667_10353734 3300025949 Unclassified 1498
392 Ga0207651_10101206 3300025960 Unclassified 2138
393 Ga0207712_11156179 3300025961 Unclassified 690
394 Ga0207712_11601701 3300025961 Unclassified 584
395 Ga0207712_12071885 3300025961 Bacteria 509
396 Ga0207668_10040530 3300025972 Bacteria 3143
397 Ga0207668_10746590 3300025972 Unclassified 863
398 Ga0207640_10006649 3300025981 Bacteria 6352
399 Ga0207658_10032287 3300025986 Unclassified 3725
400 Ga0207658_10126668 3300025986 Bacteria 2045
401 Ga0207677_10022615 3300026023 Unclassified 3867
402 Ga0207677_11676084 3300026023 Bacteria 589
403 Ga0207703_10016833 3300026035 Bacteria 5703
404 Ga0207639_10040715 3300026041 Bacteria 3470
405 Ga0207639_10050166 3300026041 Bacteria 3168
406 Ga0207639_10099434 3300026041 Unclassified 2347
407 Ga0207678_10918816 3300026067 Bacteria 774
408 Ga0207708_11314589 3300026075 Bacteria 633
409 Ga0207708_11848115 3300026075 Bacteria 530
410 Ga0207702_10002368 3300026078 Bacteria 17999
411 Ga0207702_11982187 3300026078 Unclassified 573
412 Ga0207641_10006063 3300026088 Bacteria 10236
413 Ga0207641_10017765 3300026088 Bacteria 5828
414 Ga0207648_10000348 3300026089 Bacteria 50841
415 Ga0207648_10001541 3300026089 Bacteria 25367
416 Ga0207648_11185121 3300026089 Bacteria 717
417 Ga0207676_10013379 3300026095 Bacteria 5893
418 Ga0207676_10367369 3300026095 Bacteria 1335
419 Ga0207676_10978764 3300026095 Bacteria 833
420 Ga0207674_10051680 3300026116 Bacteria 4194
421 Ga0207674_10091046 3300026116 Bacteria 3041
422 Ga0207675_100001024 3300026118 Bacteria 27687
423 Ga0207675_100008900 3300026118 Bacteria 9418
424 Ga0207675_100029048 3300026118 Bacteria 5152
425 Ga0207675_100080962 3300026118 Bacteria 3044
426 Ga0207683_11567157 3300026121 Bacteria 608
427 Ga0207698_10387213 3300026142 Bacteria 1332
428 Ga0207698_11856221 3300026142 Unclassified 618
429 Ga0209983_1054816 3300027665 Bacteria 875
430 Ga0268266_10522878 3300028379 Unclassified 1135
431 Ga0268265_10007886 3300028380 Bacteria 7185
432 Ga0268265_10021317 3300028380 Unclassified 4537
433 Ga0268265_10439913 3300028380 Bacteria 1215
434 Ga0268264_10008622 3300028381 Bacteria 8470
435 Ga0268264_10011647 3300028381 Bacteria 7254
436 Ga0307515_10000265 3300028794 Bacteria 129554
437 Ga0265338_10552721 3300028800 Bacteria 806
438 Ga0265770_1130481 3300030878 Unclassified 537
439 Ga0265760_10001130 3300031090 Bacteria 7763
440 Ga0265329_10029553 3300031242 Bacteria 1790
441 Ga0307408_100022495 3300031548 Bacteria 4284
442 Ga0307408_100473973 3300031548 Unclassified 1091
443 Ga0316596_1090541 3300033541 Unclassified 824
444 Ga0373948_0150307 3300034817 Bacteria 581
445 Ga0373944_0218559 3300035089 Bacteria 695
446 Ga0373949_0025399 3300035090 Bacteria 1382
447 Ga0373923_0114181 3300035111 Bacteria 1202
448 Ga0373954_0015937 3300035118 Unclassified 3362
449 Ga0373956_0004341 3300035119 Bacteria 5688
450 Ga0373943_0024018 3300035170 Bacteria 2839
451 Ga0373943_0997862 3300035170 Unclassified 502
452 Ga0373942_0342706 3300035207 Bacteria 527
453 Ga0373924_0124064 3300035410 Bacteria 1122
454 Ga0373931_0308689 3300035691 Bacteria 979
455 Ga0373935_0009982 3300035692 Bacteria 5687
456 Ga0373935_0901874 3300035692 Bacteria 655
457 Ga0373935_1218529 3300035692 Unclassified 561
458 Ga0373927_0000413 3300035695 Bacteria 32824
459 Ga0373933_1068725 3300035724 Unclassified 532
460 Ga0373947_0000599 3300035725 Bacteria 21255
461 Ga0373937_0452978 3300036401 Unclassified 1219
462 Ga0373937_0471306 3300036401 Bacteria 1193
463 Ga0395899_0783984 3300037312 Bacteria 590
464 Ga0395898_0165556 3300037466 Bacteria 2115
465 Ga0436364_0552552 3300037853 Bacteria 1394
466 Ga0436364_0906989 3300037853 Bacteria 2232
467 Ga0436364_1507136 3300037853 Bacteria 1034
468 Ga0436364_1542968 3300037853 Unclassified 2156
469 Ga0395901_0099736 3300038443 Bacteria 3046
470 Ga0242420_029350 3300038996 Bacteria 1015
471 Ga0436365_0058541 3300039437 Bacteria 651
472 Ga0436365_0110928 3300039437 Bacteria 569
473 Ga0436365_0210124 3300039437 Bacteria 557
474 Ga0436365_1032723 3300039437 Unclassified 663
475 Ga0436365_1108277 3300039437 Bacteria 3146
476 Ga0436365_1171371 3300039437 Unclassified 690
477 Ga0436365_1446847 3300039437 Bacteria 1376
478 Ga0436365_1528782 3300039437 Bacteria 1884
479 Ga0436365_1670062 3300039437 Bacteria 6911
480 Ga0436365_1930052 3300039437 Bacteria 12134
481 Ga0436361_0491533 3300039447 Bacteria 4407
482 Ga0436361_0599619 3300039447 Bacteria 25349
483 Ga0436361_1189806 3300039447 Bacteria 31675
484 Ga0436363_0078425 3300039450 Bacteria 1303
485 Ga0436363_0087581 3300039450 Bacteria 1274
486 Ga0436363_0377146 3300039450 Bacteria 1177
487 Ga0436363_0555427 3300039450 Bacteria 3490
488 Ga0436363_1035210 3300039450 Bacteria 1851
489 Ga0436363_1212799 3300039450 Bacteria 1226
490 Ga0436363_1223883 3300039450 Bacteria 684
491 Ga0436363_1234560 3300039450 Bacteria 506
492 Ga0436362_0072074 3300039453 Bacteria 1186
493 Ga0451839_1545871 3300041496 Unclassified 687
494 Ga0439437_014709 3300042000 Bacteria 915
495 Ga0439448_0002372 3300042005 Bacteria 5108
496 Ga0439446_0367004 3300042156 Bacteria 515
497 Ga0439459_0007901 3300042438 Bacteria 1806
498 Ga0439464_0203237 3300042439 Bacteria 632
499 Ga0451577_0094721 3300042876 Bacteria 2666
500 Ga0466965_0057823 3300044683 Bacteria 1933
501 Ga0466965_0350679 3300044683 Bacteria 808
502 Ga0466966_0233498 3300044684 Bacteria 1109
503 Ga0466961_0271795 3300044693 Bacteria 1038
504 Ga0466961_0980174 3300044693 Bacteria 502
505 Ga0466963_0030492 3300044694 Bacteria 3480
506 Ga0466963_0033987 3300044694 Bacteria 3315
507 Ga0466963_0041819 3300044694 Bacteria 3007
508 Ga0466963_0363805 3300044694 Bacteria 1019
509 Ga0466963_0638124 3300044694 Bacteria 752
510 Ga0466964_0047123 3300044706 Bacteria 1759
511 Ga0453684_0697669 3300044712 Bacteria 1103
512 Ga0453684_0951799 3300044712 Bacteria 916
513 Ga0466968_0366813 3300044735 Bacteria 701
514 Ga0466970_0088520 3300044765 Bacteria 1679
515 Ga0466957_0119852 3300044842 Bacteria 1676
516 Ga0466957_0168897 3300044842 Bacteria 1424
517 Ga0466957_0254692 3300044842 Bacteria 1168
518 Ga0466957_0264178 3300044842 Bacteria 1148
519 Ga0466959_0029285 3300045049 Bacteria 4080
520 Ga0466959_0037295 3300045049 Bacteria 3591
521 Ga0466959_0040655 3300045049 Bacteria 3435
522 Ga0451576_0018042 3300045051 Bacteria 7744
523 Ga0451576_0162691 3300045051 Bacteria 2329
524 Ga0451576_1195131 3300045051 Bacteria 794
525 Ga0451576_1833297 3300045051 Bacteria 627
526 Ga0466958_0002818 3300045836 Bacteria 8847
527 Ga0466958_0034097 3300045836 Bacteria 3035
528 Ga0466958_0085776 3300045836 Bacteria 1942
529 Ga0466958_0568969 3300045836 Bacteria 737
530 Ga0466967_0002139 3300045976 Bacteria 12112
531 Ga0466967_0015191 3300045976 Bacteria 6029
532 Ga0466967_1152384 3300045976 Bacteria 772
533 Ga0466967_1720630 3300045976 Bacteria 624
534 Ga0466967_1728059 3300045976 Bacteria 623
535 Ga0495641_0302564 3300046461 Bacteria 721
536 Ga0495580_0121523 3300046472 Bacteria 1813
537 Ga0495580_0171339 3300046472 Bacteria 1501
538 Ga0495639_0133553 3300046475 Bacteria 1189
539 Ga0495596_0342514 3300046500 Bacteria 582
540 Ga0495618_0693026 3300046514 Bacteria 600
541 Ga0495630_0075592 3300046517 Unclassified 2538
542 Ga0495665_0124075 3300046531 Bacteria 1352
543 Ga0495640_0140535 3300046533 Bacteria 1557
544 Ga0495640_0375542 3300046533 Bacteria 875
545 Ga0495667_0221726 3300046559 Bacteria 1207
546 Ga0495634_0131253 3300046642 Bacteria 1597
547 Ga0495635_0002432 3300046663 Bacteria 12700
548 Ga0495658_0319339 3300046683 Unclassified 984
549 Ga0495669_0098073 3300046684 Bacteria 1359
550 Ga0495613_0292493 3300046689 Bacteria 1129
551 Ga0495624_0035126 3300046690 Bacteria 3237
552 Ga0495581_0172926 3300047315 Bacteria 1263
553 Ga0495581_0219058 3300047315 Bacteria 1113
554 Ga0495581_0354631 3300047315 Bacteria 856
555 Ga0495676_0313385 3300047321 Bacteria 1055
556 Ga0495593_0003560 3300047673 Bacteria 9317
557 Ga0495593_0307390 3300047673 Bacteria 793
558 Ga0496101_0157552 3300048904 Bacteria 1740
559 Ga0496102_0007322 3300048905 Bacteria 9420
560 Ga0496102_0035568 3300048905 Bacteria 4484
561 Ga0496102_1153392 3300048905 Unclassified 694
562 Ga0496103_0004205 3300048906 Bacteria 8736
563 Ga0496105_1073333 3300048908 Bacteria 599
564 Ga0496106_0049155 3300048909 Bacteria 3177
565 Ga0496106_0116538 3300048909 Bacteria 2084
566 Ga0496106_1070775 3300048909 Bacteria 632
567 Ga0496108_0808234 3300048911 Bacteria 809
568 Ga0496109_0823816 3300048912 Bacteria 866
569 Ga0496110_0412974 3300048913 Bacteria 1230
570 Ga0496110_1401410 3300048913 Bacteria 608
571 Ga0496110_1466005 3300048913 Bacteria 592
572 Ga0496110_1611574 3300048913 Unclassified 559
573 Ga0496111_0283818 3300048914 Bacteria 1228
574 Ga0496112_0131781 3300048915 Bacteria 2471
575 Ga0496112_0768790 3300048915 Bacteria 889
576 Ga0496112_1634014 3300048915 Bacteria 557
577 Ga0496113_0397184 3300048916 Bacteria 1107
578 Ga0496113_0779134 3300048916 Unclassified 760
579 Ga0496114_0084221 3300048917 Bacteria 2692
580 Ga0496115_0345949 3300048918 Unclassified 1213
581 Ga0496121_0035052 3300048924 Bacteria 4503
582 Ga0496125_0028838 3300048928 Bacteria 5001
583 Ga0495678_105484 3300049459 Unclassified 970
584 Ga0501036_0126453 3300049572 Bacteria 2159
585 Ga0501038_0842555 3300049574 Bacteria 679
586 Ga0501039_0128287 3300049575 Bacteria 1990
587 Ga0501042_0595871 3300049578 Bacteria 803
588 Ga0501043_0438381 3300049579 Bacteria 983
589 Ga0501048_0286498 3300049582 Bacteria 1171
590 Ga0501071_1512992 3300049587 Bacteria 518
591 Ga0501072_0002208 3300049588 Bacteria 14544
592 Ga0501072_0081005 3300049588 Bacteria 2573
593 Ga0501072_0154361 3300049588 Bacteria 1831
594 Ga0501072_0331475 3300049588 Bacteria 1209
595 Ga0501073_0830154 3300049589 Bacteria 637
596 Ga0501074_0235543 3300049590 Bacteria 1303
597 Ga0501075_0155037 3300049591 Bacteria 1746
598 Ga0501076_0315521 3300049592 Bacteria 1282
599 Ga0501076_1030548 3300049592 Bacteria 678
600 Ga0501077_0038252 3300049593 Bacteria 3055
601 Ga0501077_0163701 3300049593 Bacteria 1412
602 Ga0501079_0203525 3300049741 Bacteria 1546
603 Ga0501080_0709352 3300049742 Bacteria 887
604 Ga0501080_0949155 3300049742 Bacteria 748
605 Ga0501081_0197123 3300049743 Bacteria 1460
606 Ga0501083_0825962 3300049744 Bacteria 603
607 Ga0501083_0938282 3300049744 Bacteria 563
608 Ga0501045_0644691 3300049824 Bacteria 783
609 nmdc:mga05p37_78264_c1 3300050507 Bacteria 4071
610 nmdc:mga05p37_872240_c1 3300050507 Bacteria 974
611 nmdc:mga0qj67_1383768_c1 3300050509 Bacteria 543
612 nmdc:mga0qj67_232868_c1 3300050509 Unclassified 1494
613 nmdc:mga06r32_190316_c1 3300050510 Unclassified 2040
614 nmdc:mga08y16_1162549_c1 3300050511 Bacteria 744
615 nmdc:mga0n895_1027951_c1 3300050512 Bacteria 804
616 nmdc:mga0n895_440245_c1 3300050512 Bacteria 1317
617 nmdc:mga0n895_5131_c1 3300050512 Bacteria 10885
618 nmdc:mga0rr50_11675_c1 3300050513 Bacteria 5637
619 nmdc:mga08x19_237366_c1 3300050514 Bacteria 1256
620 nmdc:mga0a205_424246_c1 3300050515 Bacteria 1192
621 nmdc:mga0a205_619964_c1 3300050515 Bacteria 934
622 Ga0495612_0173611 3300053078 Bacteria 945
623 Ga0500610_0087300 3300053079 Unclassified 1622
624 Ga0500583_0011899 3300053092 Bacteria 3299
625 Ga0500651_0273001 3300053093 Unclassified 977
626 Ga0500594_0081104 3300053118 Unclassified 970
627 Ga0500621_107118 3300053126 Bacteria 1096
628 Ga0500642_0001284 3300053130 Bacteria 7180
629 Ga0500589_000018 3300053147 Bacteria 101866
630 Ga0500611_003222 3300053727 Unclassified 2065
631 Ga0501084_0159045 3300054114 Bacteria 1906
632 Ga0501082_1123113 3300060353 Bacteria 687
633 Ga0501082_1801292 3300060353 Bacteria 534
634 Ga0530510_0605424 3300061734 Bacteria 833

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005844 Ga0068862_100253313 Ga0068862_1002533133 80
2 3300007265 Ga0099794_10565215 Ga0099794_105652152 81
3 3300005618 Ga0068864_102490985 Ga0068864_1024909851 84
4 3300049572 Ga0501036_0126453 Ga0501036_0126453_1727_2023 86
5 3300049574 Ga0501038_0842555 Ga0501038_0842555_272_568 86
6 3300049575 Ga0501039_0128287 Ga0501039_0128287_1048_1344 86
7 3300049578 Ga0501042_0595871 Ga0501042_0595871_349_645 86
8 3300049579 Ga0501043_0438381 Ga0501043_0438381_666_962 86
9 3300049582 Ga0501048_0286498 Ga0501048_0286498_616_912 86
10 3300049587 Ga0501071_1512992 Ga0501071_1512992_134_430 86
11 3300049588 Ga0501072_0002208 Ga0501072_0002208_12033_12329 86
12 3300049590 Ga0501074_0235543 Ga0501074_0235543_258_554 86
13 3300049591 Ga0501075_0155037 Ga0501075_0155037_259_555 86
14 3300049592 Ga0501076_0315521 Ga0501076_0315521_438_734 86
15 3300049593 Ga0501077_0163701 Ga0501077_0163701_446_742 86
16 3300049741 Ga0501079_0203525 Ga0501079_0203525_1070_1366 86
17 3300049742 Ga0501080_0709352 Ga0501080_0709352_134_430 86
18 3300049743 Ga0501081_0197123 Ga0501081_0197123_725_1021 86
19 3300049744 Ga0501083_0938282 Ga0501083_0938282_51_347 86
20 3300054114 Ga0501084_0159045 Ga0501084_0159045_482_778 86
21 3300060353 Ga0501082_1801292 Ga0501082_1801292_11_307 86
22 3300061734 Ga0530510_0605424 Ga0530510_0605424_234_530 86
23 3300005441 Ga0070700_100391751 Ga0070700_1003917512 87
24 3300005518 Ga0070699_100650562 Ga0070699_1006505622 87
25 3300005549 Ga0070704_100212046 Ga0070704_1002120463 87
26 3300006847 Ga0075431_101242366 Ga0075431_1012423661 87
27 3300009553 Ga0105249_13524712 Ga0105249_135247121 87
28 3300005436 Ga0070713_100110388 Ga0070713_1001103882 88
29 3300005439 Ga0070711_100463548 Ga0070711_1004635482 88
30 3300005471 Ga0070698_100124822 Ga0070698_1001248221 88
31 3300005577 Ga0068857_100305365 Ga0068857_1003053653 88
32 3300006028 Ga0070717_11209429 Ga0070717_112094291 88
33 3300006175 Ga0070712_100014619 Ga0070712_1000146193 88
34 3300009094 Ga0111539_10013648 Ga0111539_100136482 88
35 3300009553 Ga0105249_11505123 Ga0105249_115051232 88
36 3300011119 Ga0105246_11436328 Ga0105246_114363282 88
37 3300014968 Ga0157379_10653030 Ga0157379_106530302 88
38 3300014969 Ga0157376_10186242 Ga0157376_101862423 88
39 3300021361 Ga0213872_10233128 Ga0213872_102331282 88
40 3300021377 Ga0213874_10224840 Ga0213874_102248401 88
41 3300021384 Ga0213876_10229679 Ga0213876_102296791 88
42 3300025898 Ga0207692_10734870 Ga0207692_107348701 88
43 3300025915 Ga0207693_10012195 Ga0207693_100121955 88
44 3300025916 Ga0207663_11280850 Ga0207663_112808501 88
45 3300025928 Ga0207700_10015511 Ga0207700_100155112 88
46 3300026067 Ga0207678_10918816 Ga0207678_109188163 88
47 3300033541 Ga0316596_1090541 Ga0316596_10905412 88
48 3300035089 Ga0373944_0218559 Ga0373944_0218559_325_591 88
49 3300035111 Ga0373923_0114181 Ga0373923_0114181_731_997 88
50 3300035170 Ga0373943_0024018 Ga0373943_0024018_934_1200 88
51 3300035170 Ga0373943_0997862 Ga0373943_0997862_123_389 88
52 3300035692 Ga0373935_0009982 Ga0373935_0009982_3784_4050 88
53 3300035692 Ga0373935_0901874 Ga0373935_0901874_10_276 88
54 3300035695 Ga0373927_0000413 Ga0373927_0000413_22033_22299 88
55 3300035725 Ga0373947_0000599 Ga0373947_0000599_2058_2324 88
56 3300039437 Ga0436365_0210124 Ga0436365_0210124_254_520 88
57 3300039437 Ga0436365_1528782 Ga0436365_1528782_1579_1845 88
58 3300039447 Ga0436361_0491533 Ga0436361_0491533_827_1093 88
59 3300039450 Ga0436363_0087581 Ga0436363_0087581_730_996 88
60 3300039450 Ga0436363_1223883 Ga0436363_1223883_293_559 88
61 3300045051 Ga0451576_1195131 Ga0451576_1195131_28_297 88
62 3300046475 Ga0495639_0133553 Ga0495639_0133553_162_428 88
63 3300046517 Ga0495630_0075592 Ga0495630_0075592_1876_2142 88
64 3300046531 Ga0495665_0124075 Ga0495665_0124075_316_582 88
65 3300046533 Ga0495640_0375542 Ga0495640_0375542_383_649 88
66 3300046559 Ga0495667_0221726 Ga0495667_0221726_662_928 88
67 3300046663 Ga0495635_0002432 Ga0495635_0002432_10422_10688 88
68 3300046683 Ga0495658_0319339 Ga0495658_0319339_703_969 88
69 3300046689 Ga0495613_0292493 Ga0495613_0292493_494_760 88
70 3300046690 Ga0495624_0035126 Ga0495624_0035126_2791_3057 88
71 3300047315 Ga0495581_0172926 Ga0495581_0172926_892_1158 88
72 3300047315 Ga0495581_0219058 Ga0495581_0219058_191_457 88
73 3300047315 Ga0495581_0354631 Ga0495581_0354631_71_337 88
74 3300047321 Ga0495676_0313385 Ga0495676_0313385_468_734 88
75 3300047673 Ga0495593_0003560 Ga0495593_0003560_7445_7711 88
76 3300047673 Ga0495593_0307390 Ga0495593_0307390_39_305 88
77 3300048904 Ga0496101_0157552 Ga0496101_0157552_1007_1273 88
78 3300048905 Ga0496102_1153392 Ga0496102_1153392_137_403 88
79 3300048906 Ga0496103_0004205 Ga0496103_0004205_4644_4910 88
80 3300048909 Ga0496106_1070775 Ga0496106_1070775_299_565 88
81 3300048913 Ga0496110_1401410 Ga0496110_1401410_157_423 88
82 3300048916 Ga0496113_0779134 Ga0496113_0779134_428_694 88
83 3300048917 Ga0496114_0084221 Ga0496114_0084221_381_647 88
84 3300048918 Ga0496115_0345949 Ga0496115_0345949_322_588 88
85 2162886012 MBSR1b_contig_104125 MBSR1b_0509.00007360 89
86 2162886012 MBSR1b_contig_2996384 MBSR1b_0092.00003050 89
87 2162886012 MBSR1b_contig_3421288 MBSR1b_0811.00005970 89
88 3300000546 LJNas_1003048 LJNas_10030482 89
89 3300003203 JGI25406J46586_10051518 JGI25406J46586_100515182 89
90 3300005289 Ga0065704_10086353 Ga0065704_100863533 89
91 3300005293 Ga0065715_10143431 Ga0065715_101434314 89
92 3300005293 Ga0065715_10221217 Ga0065715_102212172 89
93 3300005295 Ga0065707_10095199 Ga0065707_100951991 89
94 3300005327 Ga0070658_10766877 Ga0070658_107668772 89
95 3300005328 Ga0070676_10009857 Ga0070676_1000985712 89
96 3300005328 Ga0070676_10041510 Ga0070676_100415103 89
97 3300005329 Ga0070683_100813630 Ga0070683_1008136302 89
98 3300005329 Ga0070683_101805545 Ga0070683_1018055452 89
99 3300005329 Ga0070683_101920826 Ga0070683_1019208262 89
100 3300005330 Ga0070690_100006698 Ga0070690_1000066986 89
101 3300005330 Ga0070690_100473012 Ga0070690_1004730122 89
102 3300005331 Ga0070670_100002355 Ga0070670_10000235511 89
103 3300005331 Ga0070670_100034764 Ga0070670_1000347641 89
104 3300005334 Ga0068869_100002790 Ga0068869_1000027902 89
105 3300005334 Ga0068869_100118708 Ga0068869_1001187084 89
106 3300005335 Ga0070666_10170492 Ga0070666_101704923 89
107 3300005335 Ga0070666_10367533 Ga0070666_103675331 89
108 3300005336 Ga0070680_100029552 Ga0070680_1000295523 89
109 3300005337 Ga0070682_100001736 Ga0070682_10000173616 89
110 3300005338 Ga0068868_100021200 Ga0068868_1000212002 89
111 3300005338 Ga0068868_100053819 Ga0068868_1000538197 89
112 3300005339 Ga0070660_100024521 Ga0070660_1000245214 89
113 3300005340 Ga0070689_100008100 Ga0070689_10000810012 89
114 3300005340 Ga0070689_100038414 Ga0070689_1000384146 89
115 3300005341 Ga0070691_11055848 Ga0070691_110558482 89
116 3300005343 Ga0070687_101485726 Ga0070687_1014857261 89
117 3300005344 Ga0070661_100008091 Ga0070661_1000080915 89
118 3300005344 Ga0070661_100008363 Ga0070661_1000083632 89
119 3300005345 Ga0070692_10153850 Ga0070692_101538503 89
120 3300005345 Ga0070692_10217213 Ga0070692_102172133 89
121 3300005345 Ga0070692_10828770 Ga0070692_108287702 89
122 3300005347 Ga0070668_100055509 Ga0070668_1000555091 89
123 3300005353 Ga0070669_100003871 Ga0070669_1000038711 89
124 3300005353 Ga0070669_100051843 Ga0070669_1000518433 89
125 3300005353 Ga0070669_100102332 Ga0070669_1001023322 89
126 3300005354 Ga0070675_101346700 Ga0070675_1013467002 89
127 3300005355 Ga0070671_100294056 Ga0070671_1002940562 89
128 3300005356 Ga0070674_100779752 Ga0070674_1007797521 89
129 3300005356 Ga0070674_102069444 Ga0070674_1020694441 89
130 3300005364 Ga0070673_100013779 Ga0070673_10001377910 89
131 3300005364 Ga0070673_100361818 Ga0070673_1003618182 89
132 3300005366 Ga0070659_100004587 Ga0070659_1000045874 89
133 3300005366 Ga0070659_100106780 Ga0070659_1001067801 89
134 3300005366 Ga0070659_100263651 Ga0070659_1002636512 89
135 3300005367 Ga0070667_100164838 Ga0070667_1001648383 89
136 3300005406 Ga0070703_10004880 Ga0070703_100048805 89
137 3300005434 Ga0070709_10105418 Ga0070709_101054182 89
138 3300005434 Ga0070709_10813100 Ga0070709_108131001 89
139 3300005435 Ga0070714_100018859 Ga0070714_1000188592 89
140 3300005435 Ga0070714_100495330 Ga0070714_1004953304 89
141 3300005436 Ga0070713_100253800 Ga0070713_1002538003 89
142 3300005436 Ga0070713_100946618 Ga0070713_1009466181 89
143 3300005436 Ga0070713_100962330 Ga0070713_1009623302 89
144 3300005436 Ga0070713_101424173 Ga0070713_1014241732 89
145 3300005437 Ga0070710_10028231 Ga0070710_100282312 89
146 3300005437 Ga0070710_10267863 Ga0070710_102678632 89
147 3300005437 Ga0070710_10268253 Ga0070710_102682532 89
148 3300005437 Ga0070710_10559373 Ga0070710_105593732 89
149 3300005438 Ga0070701_10005017 Ga0070701_100050176 89
150 3300005438 Ga0070701_10052223 Ga0070701_100522231 89
151 3300005438 Ga0070701_10377923 Ga0070701_103779232 89
152 3300005439 Ga0070711_100365898 Ga0070711_1003658982 89
153 3300005439 Ga0070711_100666069 Ga0070711_1006660692 89
154 3300005440 Ga0070705_100004665 Ga0070705_1000046658 89
155 3300005441 Ga0070700_100285073 Ga0070700_1002850732 89
156 3300005441 Ga0070700_100305595 Ga0070700_1003055952 89
157 3300005441 Ga0070700_101398380 Ga0070700_1013983801 89
158 3300005444 Ga0070694_100001325 Ga0070694_1000013259 89
159 3300005444 Ga0070694_100087251 Ga0070694_1000872513 89
160 3300005445 Ga0070708_100009402 Ga0070708_10000940210 89
161 3300005456 Ga0070678_100527176 Ga0070678_1005271761 89
162 3300005456 Ga0070678_100675651 Ga0070678_1006756511 89
163 3300005457 Ga0070662_100009319 Ga0070662_1000093198 89
164 3300005457 Ga0070662_100075190 Ga0070662_1000751904 89
165 3300005457 Ga0070662_100258263 Ga0070662_1002582632 89
166 3300005458 Ga0070681_10013232 Ga0070681_100132324 89
167 3300005458 Ga0070681_11802011 Ga0070681_118020111 89
168 3300005459 Ga0068867_100019066 Ga0068867_1000190666 89
169 3300005459 Ga0068867_100670483 Ga0068867_1006704831 89
170 3300005459 Ga0068867_101842279 Ga0068867_1018422791 89
171 3300005466 Ga0070685_10311886 Ga0070685_103118861 89
172 3300005467 Ga0070706_100093860 Ga0070706_1000938602 89
173 3300005467 Ga0070706_100153517 Ga0070706_1001535172 89
174 3300005468 Ga0070707_100010243 Ga0070707_1000102433 89
175 3300005471 Ga0070698_100001773 Ga0070698_10000177311 89
176 3300005471 Ga0070698_100005766 Ga0070698_1000057664 89
177 3300005471 Ga0070698_100013373 Ga0070698_1000133733 89
178 3300005471 Ga0070698_100403485 Ga0070698_1004034852 89
179 3300005471 Ga0070698_100434165 Ga0070698_1004341651 89
180 3300005518 Ga0070699_100008100 Ga0070699_10000810014 89
181 3300005518 Ga0070699_100014890 Ga0070699_10001489010 89
182 3300005518 Ga0070699_101109977 Ga0070699_1011099772 89
183 3300005530 Ga0070679_100095939 Ga0070679_1000959392 89
184 3300005530 Ga0070679_100188270 Ga0070679_1001882702 89
185 3300005535 Ga0070684_100178225 Ga0070684_1001782253 89
186 3300005536 Ga0070697_100150157 Ga0070697_1001501572 89
187 3300005536 Ga0070697_100267237 Ga0070697_1002672372 89
188 3300005536 Ga0070697_101078919 Ga0070697_1010789191 89
189 3300005539 Ga0068853_100001254 Ga0068853_1000012544 89
190 3300005539 Ga0068853_100035656 Ga0068853_1000356569 89
191 3300005539 Ga0068853_100176501 Ga0068853_1001765011 89
192 3300005543 Ga0070672_100058839 Ga0070672_1000588397 89
193 3300005543 Ga0070672_101026309 Ga0070672_1010263092 89
194 3300005543 Ga0070672_101302223 Ga0070672_1013022232 89
195 3300005544 Ga0070686_100133801 Ga0070686_1001338011 89
196 3300005544 Ga0070686_100574030 Ga0070686_1005740302 89
197 3300005544 Ga0070686_101118342 Ga0070686_1011183422 89
198 3300005545 Ga0070695_100059343 Ga0070695_1000593434 89
199 3300005545 Ga0070695_100092549 Ga0070695_1000925492 89
200 3300005545 Ga0070695_100648881 Ga0070695_1006488811 89
201 3300005545 Ga0070695_100849832 Ga0070695_1008498321 89
202 3300005546 Ga0070696_100008469 Ga0070696_1000084699 89
203 3300005546 Ga0070696_100210842 Ga0070696_1002108422 89
204 3300005546 Ga0070696_100440023 Ga0070696_1004400232 89
205 3300005546 Ga0070696_101353376 Ga0070696_1013533762 89
206 3300005547 Ga0070693_100000335 Ga0070693_1000003354 89
207 3300005547 Ga0070693_100006162 Ga0070693_1000061626 89
208 3300005547 Ga0070693_101156594 Ga0070693_1011565942 89
209 3300005548 Ga0070665_100281208 Ga0070665_1002812084 89
210 3300005549 Ga0070704_100002702 Ga0070704_1000027024 89
211 3300005549 Ga0070704_100038598 Ga0070704_1000385984 89
212 3300005549 Ga0070704_100170849 Ga0070704_1001708492 89
213 3300005549 Ga0070704_100417639 Ga0070704_1004176391 89
214 3300005549 Ga0070704_100703663 Ga0070704_1007036632 89
215 3300005549 Ga0070704_101030125 Ga0070704_1010301252 89
216 3300005563 Ga0068855_100025398 Ga0068855_1000253982 89
217 3300005563 Ga0068855_100028649 Ga0068855_1000286494 89
218 3300005563 Ga0068855_100586151 Ga0068855_1005861512 89
219 3300005563 Ga0068855_100649612 Ga0068855_1006496123 89
220 3300005564 Ga0070664_100016128 Ga0070664_1000161283 89
221 3300005564 Ga0070664_101994409 Ga0070664_1019944092 89
222 3300005577 Ga0068857_100008113 Ga0068857_1000081133 89
223 3300005577 Ga0068857_100485090 Ga0068857_1004850902 89
224 3300005577 Ga0068857_100722783 Ga0068857_1007227831 89
225 3300005578 Ga0068854_100033226 Ga0068854_1000332265 89
226 3300005578 Ga0068854_100354843 Ga0068854_1003548432 89
227 3300005578 Ga0068854_100584774 Ga0068854_1005847741 89
228 3300005578 Ga0068854_102012297 Ga0068854_1020122971 89
229 3300005614 Ga0068856_100006379 Ga0068856_10000637915 89
230 3300005614 Ga0068856_100196451 Ga0068856_1001964513 89
231 3300005614 Ga0068856_100586400 Ga0068856_1005864002 89
232 3300005615 Ga0070702_100084587 Ga0070702_1000845873 89
233 3300005616 Ga0068852_102237791 Ga0068852_1022377912 89
234 3300005617 Ga0068859_100002405 Ga0068859_1000024054 89
235 3300005617 Ga0068859_100968764 Ga0068859_1009687642 89
236 3300005617 Ga0068859_102211091 Ga0068859_1022110912 89
237 3300005618 Ga0068864_100040924 Ga0068864_1000409241 89
238 3300005618 Ga0068864_100212170 Ga0068864_1002121704 89
239 3300005718 Ga0068866_10034207 Ga0068866_100342076 89
240 3300005719 Ga0068861_100000163 Ga0068861_10000016332 89
241 3300005719 Ga0068861_100057055 Ga0068861_1000570554 89
242 3300005719 Ga0068861_100070432 Ga0068861_1000704322 89
243 3300005719 Ga0068861_100100594 Ga0068861_1001005942 89
244 3300005834 Ga0068851_10170100 Ga0068851_101701002 89
245 3300005834 Ga0068851_10414898 Ga0068851_104148981 89
246 3300005840 Ga0068870_10001702 Ga0068870_100017024 89
247 3300005840 Ga0068870_10013234 Ga0068870_100132345 89
248 3300005840 Ga0068870_11462542 Ga0068870_114625421 89
249 3300005841 Ga0068863_100004794 Ga0068863_10000479418 89
250 3300005841 Ga0068863_100065655 Ga0068863_1000656554 89
251 3300005842 Ga0068858_100132018 Ga0068858_1001320182 89
252 3300005842 Ga0068858_101258941 Ga0068858_1012589411 89
253 3300005843 Ga0068860_100002551 Ga0068860_10000255121 89
254 3300005843 Ga0068860_100168623 Ga0068860_1001686232 89
255 3300005843 Ga0068860_101047112 Ga0068860_1010471122 89
256 3300005844 Ga0068862_100003160 Ga0068862_1000031606 89
257 3300005844 Ga0068862_100053469 Ga0068862_1000534696 89
258 3300005844 Ga0068862_100553702 Ga0068862_1005537022 89
259 3300005981 Ga0081538_10022655 Ga0081538_100226555 89
260 3300005985 Ga0081539_10000062 Ga0081539_1000006292 89
261 3300005985 Ga0081539_10003923 Ga0081539_100039239 89
262 3300006028 Ga0070717_10003878 Ga0070717_1000387810 89
263 3300006028 Ga0070717_10012210 Ga0070717_100122102 89
264 3300006028 Ga0070717_10662004 Ga0070717_106620042 89
265 3300006028 Ga0070717_10759689 Ga0070717_107596892 89
266 3300006028 Ga0070717_11268331 Ga0070717_112683312 89
267 3300006038 Ga0075365_10396674 Ga0075365_103966742 89
268 3300006163 Ga0070715_10076171 Ga0070715_100761712 89
269 3300006175 Ga0070712_100086099 Ga0070712_1000860993 89
270 3300006175 Ga0070712_100236816 Ga0070712_1002368162 89
271 3300006175 Ga0070712_100279665 Ga0070712_1002796653 89
272 3300006175 Ga0070712_101113261 Ga0070712_1011132611 89
273 3300006237 Ga0097621_100230914 Ga0097621_1002309141 89
274 3300006358 Ga0068871_100152968 Ga0068871_1001529685 89
275 3300006358 Ga0068871_100743294 Ga0068871_1007432942 89
276 3300006844 Ga0075428_102583565 Ga0075428_1025835652 89
277 3300006847 Ga0075431_100102179 Ga0075431_1001021793 89
278 3300006852 Ga0075433_10172524 Ga0075433_101725242 89
279 3300006852 Ga0075433_10370015 Ga0075433_103700153 89
280 3300006852 Ga0075433_10426633 Ga0075433_104266332 89
281 3300006871 Ga0075434_100006197 Ga0075434_1000061972 89
282 3300006871 Ga0075434_100902266 Ga0075434_1009022662 89
283 3300006871 Ga0075434_101326629 Ga0075434_1013266292 89
284 3300006871 Ga0075434_101975356 Ga0075434_1019753561 89
285 3300006881 Ga0068865_100101094 Ga0068865_1001010942 89
286 3300006881 Ga0068865_100610102 Ga0068865_1006101022 89
287 3300006881 Ga0068865_100656989 Ga0068865_1006569892 89
288 3300006914 Ga0075436_100037583 Ga0075436_1000375836 89
289 3300006914 Ga0075436_100581710 Ga0075436_1005817102 89
290 3300006914 Ga0075436_101486330 Ga0075436_1014863301 89
291 3300006931 Ga0097620_100002405 Ga0097620_1000024054 89
292 3300006931 Ga0097620_100968740 Ga0097620_1009687402 89
293 3300006931 Ga0097620_102210937 Ga0097620_1022109372 89
294 3300007076 Ga0075435_100016421 Ga0075435_1000164212 89
295 3300007076 Ga0075435_100019798 Ga0075435_1000197982 89
296 3300007265 Ga0099794_10152978 Ga0099794_101529782 89
297 3300009093 Ga0105240_10723779 Ga0105240_107237792 89
298 3300009094 Ga0111539_10413431 Ga0111539_104134312 89
299 3300009094 Ga0111539_11746667 Ga0111539_117466672 89
300 3300009098 Ga0105245_10061912 Ga0105245_100619123 89
301 3300009098 Ga0105245_11556027 Ga0105245_115560272 89
302 3300009101 Ga0105247_10005587 Ga0105247_100055871 89
303 3300009101 Ga0105247_10008746 Ga0105247_100087465 89
304 3300009101 Ga0105247_11402760 Ga0105247_114027602 89
305 3300009101 Ga0105247_11678451 Ga0105247_116784512 89
306 3300009147 Ga0114129_10136578 Ga0114129_101365782 89
307 3300009147 Ga0114129_10407162 Ga0114129_104071622 89
308 3300009147 Ga0114129_11113868 Ga0114129_111138682 89
309 3300009148 Ga0105243_10312776 Ga0105243_103127761 89
310 3300009148 Ga0105243_10667833 Ga0105243_106678332 89
311 3300009148 Ga0105243_11181270 Ga0105243_111812702 89
312 3300009174 Ga0105241_10017336 Ga0105241_100173365 89
313 3300009176 Ga0105242_10358714 Ga0105242_103587143 89
314 3300009177 Ga0105248_10012708 Ga0105248_100127082 89
315 3300009177 Ga0105248_10803476 Ga0105248_108034762 89
316 3300009545 Ga0105237_10159675 Ga0105237_101596752 89
317 3300009551 Ga0105238_10023340 Ga0105238_100233403 89
318 3300009553 Ga0105249_10029307 Ga0105249_100293076 89
319 3300009553 Ga0105249_10328769 Ga0105249_103287691 89
320 3300010375 Ga0105239_10076899 Ga0105239_100768995 89
321 3300010375 Ga0105239_10229682 Ga0105239_102296822 89
322 3300010375 Ga0105239_10805186 Ga0105239_108051862 89
323 3300011119 Ga0105246_10056067 Ga0105246_100560672 89
324 3300011119 Ga0105246_10179775 Ga0105246_101797754 89
325 3300011119 Ga0105246_10371983 Ga0105246_103719832 89
326 3300013100 Ga0157373_10013202 Ga0157373_100132028 89
327 3300013100 Ga0157373_10263879 Ga0157373_102638792 89
328 3300013102 Ga0157371_10143253 Ga0157371_101432533 89
329 3300013104 Ga0157370_10282402 Ga0157370_102824022 89
330 3300013104 Ga0157370_10789373 Ga0157370_107893732 89
331 3300013105 Ga0157369_10026497 Ga0157369_100264978 89
332 3300013105 Ga0157369_10087473 Ga0157369_100874732 89
333 3300013105 Ga0157369_10380510 Ga0157369_103805102 89
334 3300013296 Ga0157374_10722328 Ga0157374_107223282 89
335 3300013297 Ga0157378_10079725 Ga0157378_100797256 89
336 3300013297 Ga0157378_11503720 Ga0157378_115037202 89
337 3300013307 Ga0157372_10000063 Ga0157372_10000063124 89
338 3300013307 Ga0157372_10164276 Ga0157372_101642764 89
339 3300013307 Ga0157372_10964378 Ga0157372_109643782 89
340 3300013308 Ga0157375_10015979 Ga0157375_1001597910 89
341 3300014325 Ga0163163_10001286 Ga0163163_1000128622 89
342 3300014325 Ga0163163_10144405 Ga0163163_101444052 89
343 3300014325 Ga0163163_10757123 Ga0163163_107571232 89
344 3300014326 Ga0157380_10062931 Ga0157380_100629314 89
345 3300014326 Ga0157380_10633504 Ga0157380_106335042 89
346 3300014326 Ga0157380_10814239 Ga0157380_108142392 89
347 3300014326 Ga0157380_10910698 Ga0157380_109106982 89
348 3300014326 Ga0157380_11442168 Ga0157380_114421682 89
349 3300014745 Ga0157377_10138810 Ga0157377_101388103 89
350 3300014745 Ga0157377_11733155 Ga0157377_117331552 89
351 3300014968 Ga0157379_10142431 Ga0157379_101424314 89
352 3300014968 Ga0157379_10145235 Ga0157379_101452353 89
353 3300020078 Ga0206352_11300773 Ga0206352_113007732 89
354 3300020082 Ga0206353_10093591 Ga0206353_100935912 89
355 3300021361 Ga0213872_10038967 Ga0213872_100389672 89
356 3300021361 Ga0213872_10044512 Ga0213872_100445122 89
357 3300021377 Ga0213874_10022247 Ga0213874_100222473 89
358 3300021377 Ga0213874_10190889 Ga0213874_101908892 89
359 3300021388 Ga0213875_10058786 Ga0213875_100587863 89
360 3300025321 Ga0207656_10049889 Ga0207656_100498892 89
361 3300025885 Ga0207653_10004981 Ga0207653_100049814 89
362 3300025898 Ga0207692_10103749 Ga0207692_101037491 89
363 3300025898 Ga0207692_10272457 Ga0207692_102724573 89
364 3300025898 Ga0207692_10550315 Ga0207692_105503151 89
365 3300025899 Ga0207642_11107656 Ga0207642_111076561 89
366 3300025900 Ga0207710_10001953 Ga0207710_100019539 89
367 3300025900 Ga0207710_10681950 Ga0207710_106819501 89
368 3300025903 Ga0207680_10312889 Ga0207680_103128892 89
369 3300025903 Ga0207680_10569875 Ga0207680_105698752 89
370 3300025904 Ga0207647_10415468 Ga0207647_104154681 89
371 3300025904 Ga0207647_10436298 Ga0207647_104362981 89
372 3300025905 Ga0207685_10800853 Ga0207685_108008531 89
373 3300025906 Ga0207699_10050922 Ga0207699_100509223 89
374 3300025906 Ga0207699_10166597 Ga0207699_101665972 89
375 3300025906 Ga0207699_10657546 Ga0207699_106575461 89
376 3300025907 Ga0207645_10017421 Ga0207645_1001742111 89
377 3300025907 Ga0207645_10035422 Ga0207645_100354225 89
378 3300025908 Ga0207643_10001827 Ga0207643_100018277 89
379 3300025908 Ga0207643_10001973 Ga0207643_100019735 89
380 3300025908 Ga0207643_10746381 Ga0207643_107463811 89
381 3300025910 Ga0207684_10005173 Ga0207684_100051732 89
382 3300025910 Ga0207684_10112084 Ga0207684_101120844 89
383 3300025910 Ga0207684_10931306 Ga0207684_109313061 89
384 3300025911 Ga0207654_10007965 Ga0207654_100079655 89
385 3300025912 Ga0207707_10000752 Ga0207707_100007525 89
386 3300025913 Ga0207695_10522208 Ga0207695_105222082 89
387 3300025915 Ga0207693_10120635 Ga0207693_101206352 89
388 3300025915 Ga0207693_10276681 Ga0207693_102766812 89
389 3300025915 Ga0207693_10684301 Ga0207693_106843012 89
390 3300025915 Ga0207693_11053696 Ga0207693_110536961 89
391 3300025916 Ga0207663_10117030 Ga0207663_101170301 89
392 3300025916 Ga0207663_11202632 Ga0207663_112026321 89
393 3300025917 Ga0207660_10001549 Ga0207660_1000154914 89
394 3300025917 Ga0207660_11481036 Ga0207660_114810362 89
395 3300025918 Ga0207662_11308526 Ga0207662_113085261 89
396 3300025919 Ga0207657_10013830 Ga0207657_100138304 89
397 3300025919 Ga0207657_10293976 Ga0207657_102939762 89
398 3300025919 Ga0207657_11249874 Ga0207657_112498742 89
399 3300025920 Ga0207649_10005791 Ga0207649_100057915 89
400 3300025920 Ga0207649_10067083 Ga0207649_100670832 89
401 3300025921 Ga0207652_10006951 Ga0207652_1000695113 89
402 3300025921 Ga0207652_10112774 Ga0207652_101127743 89
403 3300025922 Ga0207646_10000263 Ga0207646_1000026359 89
404 3300025922 Ga0207646_11494549 Ga0207646_114945491 89
405 3300025923 Ga0207681_10030119 Ga0207681_100301193 89
406 3300025923 Ga0207681_10039611 Ga0207681_100396118 89
407 3300025923 Ga0207681_10352080 Ga0207681_103520802 89
408 3300025924 Ga0207694_10142565 Ga0207694_101425651 89
409 3300025925 Ga0207650_10028481 Ga0207650_100284817 89
410 3300025925 Ga0207650_10384600 Ga0207650_103846002 89
411 3300025926 Ga0207659_10890320 Ga0207659_108903202 89
412 3300025927 Ga0207687_11023751 Ga0207687_110237512 89
413 3300025927 Ga0207687_11255429 Ga0207687_112554291 89
414 3300025928 Ga0207700_10062636 Ga0207700_100626362 89
415 3300025928 Ga0207700_10682204 Ga0207700_106822042 89
416 3300025928 Ga0207700_11095464 Ga0207700_110954641 89
417 3300025928 Ga0207700_11503620 Ga0207700_115036202 89
418 3300025928 Ga0207700_12019378 Ga0207700_120193782 89
419 3300025929 Ga0207664_10148543 Ga0207664_101485432 89
420 3300025929 Ga0207664_10248028 Ga0207664_102480283 89
421 3300025929 Ga0207664_10325017 Ga0207664_103250172 89
422 3300025929 Ga0207664_10377801 Ga0207664_103778012 89
423 3300025929 Ga0207664_10897940 Ga0207664_108979402 89
424 3300025929 Ga0207664_11123172 Ga0207664_111231722 89
425 3300025929 Ga0207664_11826331 Ga0207664_118263311 89
426 3300025931 Ga0207644_10310956 Ga0207644_103109563 89
427 3300025931 Ga0207644_10502120 Ga0207644_105021202 89
428 3300025932 Ga0207690_10007312 Ga0207690_100073124 89
429 3300025933 Ga0207706_10027435 Ga0207706_100274354 89
430 3300025933 Ga0207706_10041618 Ga0207706_100416185 89
431 3300025933 Ga0207706_10390766 Ga0207706_103907662 89
432 3300025935 Ga0207709_11331879 Ga0207709_113318791 89
433 3300025936 Ga0207670_10004245 Ga0207670_100042455 89
434 3300025936 Ga0207670_10064667 Ga0207670_100646672 89
435 3300025938 Ga0207704_10503075 Ga0207704_105030752 89
436 3300025938 Ga0207704_10527801 Ga0207704_105278012 89
437 3300025939 Ga0207665_10082307 Ga0207665_100823073 89
438 3300025939 Ga0207665_10646635 Ga0207665_106466352 89
439 3300025940 Ga0207691_10168009 Ga0207691_101680094 89
440 3300025941 Ga0207711_10033379 Ga0207711_100333799 89
441 3300025941 Ga0207711_10456428 Ga0207711_104564283 89
442 3300025942 Ga0207689_10000161 Ga0207689_1000016168 89
443 3300025942 Ga0207689_10154485 Ga0207689_101544854 89
444 3300025944 Ga0207661_11090842 Ga0207661_110908421 89
445 3300025944 Ga0207661_11548294 Ga0207661_115482941 89
446 3300025945 Ga0207679_10002658 Ga0207679_1000265815 89
447 3300025949 Ga0207667_10001995 Ga0207667_1000199532 89
448 3300025949 Ga0207667_10245138 Ga0207667_102451382 89
449 3300025949 Ga0207667_10353734 Ga0207667_103537343 89
450 3300025960 Ga0207651_10101206 Ga0207651_101012063 89
451 3300025961 Ga0207712_11156179 Ga0207712_111561792 89
452 3300025961 Ga0207712_11601701 Ga0207712_116017011 89
453 3300025961 Ga0207712_12071885 Ga0207712_120718851 89
454 3300025972 Ga0207668_10040530 Ga0207668_100405301 89
455 3300025972 Ga0207668_10746590 Ga0207668_107465901 89
456 3300025981 Ga0207640_10006649 Ga0207640_100066497 89
457 3300025986 Ga0207658_10032287 Ga0207658_100322874 89
458 3300025986 Ga0207658_10126668 Ga0207658_101266683 89
459 3300026023 Ga0207677_10022615 Ga0207677_100226156 89
460 3300026023 Ga0207677_11676084 Ga0207677_116760842 89
461 3300026035 Ga0207703_10016833 Ga0207703_100168332 89
462 3300026041 Ga0207639_10040715 Ga0207639_100407152 89
463 3300026041 Ga0207639_10050166 Ga0207639_100501664 89
464 3300026041 Ga0207639_10099434 Ga0207639_100994345 89
465 3300026075 Ga0207708_11314589 Ga0207708_113145892 89
466 3300026075 Ga0207708_11848115 Ga0207708_118481152 89
467 3300026078 Ga0207702_10002368 Ga0207702_100023686 89
468 3300026078 Ga0207702_11982187 Ga0207702_119821871 89
469 3300026088 Ga0207641_10006063 Ga0207641_1000606311 89
470 3300026088 Ga0207641_10017765 Ga0207641_100177654 89
471 3300026089 Ga0207648_10000348 Ga0207648_1000034830 89
472 3300026089 Ga0207648_10001541 Ga0207648_100015416 89
473 3300026089 Ga0207648_11185121 Ga0207648_111851212 89
474 3300026095 Ga0207676_10013379 Ga0207676_1001337913 89
475 3300026095 Ga0207676_10367369 Ga0207676_103673692 89
476 3300026095 Ga0207676_10978764 Ga0207676_109787642 89
477 3300026116 Ga0207674_10051680 Ga0207674_100516808 89
478 3300026116 Ga0207674_10091046 Ga0207674_100910465 89
479 3300026118 Ga0207675_100001024 Ga0207675_10000102420 89
480 3300026118 Ga0207675_100008900 Ga0207675_1000089004 89
481 3300026118 Ga0207675_100029048 Ga0207675_1000290482 89
482 3300026118 Ga0207675_100080962 Ga0207675_1000809622 89
483 3300026121 Ga0207683_11567157 Ga0207683_115671571 89
484 3300026142 Ga0207698_10387213 Ga0207698_103872132 89
485 3300026142 Ga0207698_11856221 Ga0207698_118562212 89
486 3300027665 Ga0209983_1054816 Ga0209983_10548162 89
487 3300028379 Ga0268266_10522878 Ga0268266_105228783 89
488 3300028380 Ga0268265_10007886 Ga0268265_100078865 89
489 3300028380 Ga0268265_10021317 Ga0268265_100213173 89
490 3300028380 Ga0268265_10439913 Ga0268265_104399133 89
491 3300028381 Ga0268264_10008622 Ga0268264_100086228 89
492 3300028381 Ga0268264_10011647 Ga0268264_100116474 89
493 3300028794 Ga0307515_10000265 Ga0307515_1000026513 89
494 3300028800 Ga0265338_10552721 Ga0265338_105527212 89
495 3300030878 Ga0265770_1130481 Ga0265770_11304811 89
496 3300031090 Ga0265760_10001130 Ga0265760_100011303 89
497 3300031242 Ga0265329_10029553 Ga0265329_100295532 89
498 3300031548 Ga0307408_100022495 Ga0307408_1000224955 89
499 3300031548 Ga0307408_100473973 Ga0307408_1004739732 89
500 3300034817 Ga0373948_0150307 Ga0373948_0150307_21_296 89
501 3300035090 Ga0373949_0025399 Ga0373949_0025399_216_491 89
502 3300035118 Ga0373954_0015937 Ga0373954_0015937_1099_1368 89
503 3300035119 Ga0373956_0004341 Ga0373956_0004341_3733_4002 89
504 3300035207 Ga0373942_0342706 Ga0373942_0342706_61_336 89
505 3300035410 Ga0373924_0124064 Ga0373924_0124064_45_317 89
506 3300035691 Ga0373931_0308689 Ga0373931_0308689_11_283 89
507 3300035692 Ga0373935_1218529 Ga0373935_1218529_129_398 89
508 3300035724 Ga0373933_1068725 Ga0373933_1068725_66_335 89
509 3300036401 Ga0373937_0452978 Ga0373937_0452978_649_918 89
510 3300036401 Ga0373937_0471306 Ga0373937_0471306_850_1122 89
511 3300037312 Ga0395899_0783984 Ga0395899_0783984_250_531 89
512 3300037466 Ga0395898_0165556 Ga0395898_0165556_1431_1712 89
513 3300037853 Ga0436364_0552552 Ga0436364_0552552_784_1053 89
514 3300037853 Ga0436364_0906989 Ga0436364_0906989_849_1118 89
515 3300037853 Ga0436364_1507136 Ga0436364_1507136_304_573 89
516 3300037853 Ga0436364_1542968 Ga0436364_1542968_1767_2036 89
517 3300038443 Ga0395901_0099736 Ga0395901_0099736_930_1211 89
518 3300038996 Ga0242420_029350 Ga0242420_029350_515_790 89
519 3300039437 Ga0436365_0058541 Ga0436365_0058541_344_637 89
520 3300039437 Ga0436365_0110928 Ga0436365_0110928_13_282 89
521 3300039437 Ga0436365_1032723 Ga0436365_1032723_368_649 89
522 3300039437 Ga0436365_1108277 Ga0436365_1108277_2689_2958 89
523 3300039437 Ga0436365_1171371 Ga0436365_1171371_170_439 89
524 3300039437 Ga0436365_1446847 Ga0436365_1446847_697_966 89
525 3300039437 Ga0436365_1670062 Ga0436365_1670062_3301_3570 89
526 3300039437 Ga0436365_1930052 Ga0436365_1930052_4470_4739 89
527 3300039447 Ga0436361_0599619 Ga0436361_0599619_9357_9626 89
528 3300039447 Ga0436361_1189806 Ga0436361_1189806_594_884 89
529 3300039450 Ga0436363_0078425 Ga0436363_0078425_167_499 89
530 3300039450 Ga0436363_0377146 Ga0436363_0377146_424_693 89
531 3300039450 Ga0436363_0555427 Ga0436363_0555427_743_1012 89
532 3300039450 Ga0436363_1035210 Ga0436363_1035210_1293_1562 89
533 3300039450 Ga0436363_1212799 Ga0436363_1212799_269_538 89
534 3300039450 Ga0436363_1234560 Ga0436363_1234560_177_446 89
535 3300039453 Ga0436362_0072074 Ga0436362_0072074_278_547 89
536 3300041496 Ga0451839_1545871 Ga0451839_1545871_288_563 89
537 3300042000 Ga0439437_014709 Ga0439437_014709_462_737 89
538 3300042005 Ga0439448_0002372 Ga0439448_0002372_2990_3265 89
539 3300042156 Ga0439446_0367004 Ga0439446_0367004_56_325 89
540 3300042438 Ga0439459_0007901 Ga0439459_0007901_174_449 89
541 3300042439 Ga0439464_0203237 Ga0439464_0203237_322_597 89
542 3300042876 Ga0451577_0094721 Ga0451577_0094721_1318_1593 89
543 3300044683 Ga0466965_0057823 Ga0466965_0057823_1069_1338 89
544 3300044683 Ga0466965_0350679 Ga0466965_0350679_480_749 89
545 3300044684 Ga0466966_0233498 Ga0466966_0233498_78_347 89
546 3300044693 Ga0466961_0271795 Ga0466961_0271795_739_1008 89
547 3300044693 Ga0466961_0980174 Ga0466961_0980174_37_342 89
548 3300044694 Ga0466963_0030492 Ga0466963_0030492_703_972 89
549 3300044694 Ga0466963_0033987 Ga0466963_0033987_2186_2455 89
550 3300044694 Ga0466963_0041819 Ga0466963_0041819_1732_2001 89
551 3300044694 Ga0466963_0363805 Ga0466963_0363805_168_440 89
552 3300044694 Ga0466963_0638124 Ga0466963_0638124_306_575 89
553 3300044706 Ga0466964_0047123 Ga0466964_0047123_555_824 89
554 3300044712 Ga0453684_0697669 Ga0453684_0697669_695_967 89
555 3300044712 Ga0453684_0951799 Ga0453684_0951799_332_607 89
556 3300044735 Ga0466968_0366813 Ga0466968_0366813_325_594 89
557 3300044765 Ga0466970_0088520 Ga0466970_0088520_1062_1331 89
558 3300044842 Ga0466957_0119852 Ga0466957_0119852_561_830 89
559 3300044842 Ga0466957_0168897 Ga0466957_0168897_143_412 89
560 3300044842 Ga0466957_0254692 Ga0466957_0254692_357_626 89
561 3300044842 Ga0466957_0264178 Ga0466957_0264178_211_486 89
562 3300045049 Ga0466959_0029285 Ga0466959_0029285_277_546 89
563 3300045049 Ga0466959_0037295 Ga0466959_0037295_922_1191 89
564 3300045049 Ga0466959_0040655 Ga0466959_0040655_1509_1778 89
565 3300045051 Ga0451576_0018042 Ga0451576_0018042_1800_2093 89
566 3300045051 Ga0451576_0162691 Ga0451576_0162691_1948_2223 89
567 3300045051 Ga0451576_1833297 Ga0451576_1833297_198_476 89
568 3300045836 Ga0466958_0002818 Ga0466958_0002818_8486_8755 89
569 3300045836 Ga0466958_0034097 Ga0466958_0034097_1388_1657 89
570 3300045836 Ga0466958_0085776 Ga0466958_0085776_28_297 89
571 3300045836 Ga0466958_0568969 Ga0466958_0568969_449_718 89
572 3300045976 Ga0466967_0002139 Ga0466967_0002139_2782_3051 89
573 3300045976 Ga0466967_0015191 Ga0466967_0015191_3092_3361 89
574 3300045976 Ga0466967_1152384 Ga0466967_1152384_292_564 89
575 3300045976 Ga0466967_1720630 Ga0466967_1720630_261_530 89
576 3300045976 Ga0466967_1728059 Ga0466967_1728059_98_373 89
577 3300046461 Ga0495641_0302564 Ga0495641_0302564_244_513 89
578 3300046472 Ga0495580_0121523 Ga0495580_0121523_1494_1772 89
579 3300046472 Ga0495580_0171339 Ga0495580_0171339_1142_1432 89
580 3300046500 Ga0495596_0342514 Ga0495596_0342514_62_334 89
581 3300046514 Ga0495618_0693026 Ga0495618_0693026_197_466 89
582 3300046533 Ga0495640_0140535 Ga0495640_0140535_865_1134 89
583 3300046642 Ga0495634_0131253 Ga0495634_0131253_1017_1289 89
584 3300046684 Ga0495669_0098073 Ga0495669_0098073_496_768 89
585 3300048905 Ga0496102_0007322 Ga0496102_0007322_4850_5122 89
586 3300048905 Ga0496102_0035568 Ga0496102_0035568_1036_1311 89
587 3300048908 Ga0496105_1073333 Ga0496105_1073333_246_515 89
588 3300048909 Ga0496106_0049155 Ga0496106_0049155_353_625 89
589 3300048909 Ga0496106_0116538 Ga0496106_0116538_495_770 89
590 3300048911 Ga0496108_0808234 Ga0496108_0808234_89_358 89
591 3300048912 Ga0496109_0823816 Ga0496109_0823816_278_553 89
592 3300048913 Ga0496110_0412974 Ga0496110_0412974_216_506 89
593 3300048913 Ga0496110_1466005 Ga0496110_1466005_58_327 89
594 3300048913 Ga0496110_1611574 Ga0496110_1611574_173_445 89
595 3300048914 Ga0496111_0283818 Ga0496111_0283818_796_1086 89
596 3300048915 Ga0496112_0131781 Ga0496112_0131781_964_1233 89
597 3300048915 Ga0496112_0768790 Ga0496112_0768790_401_691 89
598 3300048915 Ga0496112_1634014 Ga0496112_1634014_150_425 89
599 3300048916 Ga0496113_0397184 Ga0496113_0397184_523_813 89
600 3300048924 Ga0496121_0035052 Ga0496121_0035052_1779_2048 89
601 3300048928 Ga0496125_0028838 Ga0496125_0028838_1796_2065 89
602 3300049459 Ga0495678_105484 Ga0495678_105484_459_731 89
603 3300049588 Ga0501072_0081005 Ga0501072_0081005_1128_1418 89
604 3300049588 Ga0501072_0154361 Ga0501072_0154361_83_358 89
605 3300049588 Ga0501072_0331475 Ga0501072_0331475_659_928 89
606 3300049589 Ga0501073_0830154 Ga0501073_0830154_14_289 89
607 3300049592 Ga0501076_1030548 Ga0501076_1030548_127_396 89
608 3300049593 Ga0501077_0038252 Ga0501077_0038252_295_585 89
609 3300049742 Ga0501080_0949155 Ga0501080_0949155_115_384 89
610 3300049744 Ga0501083_0825962 Ga0501083_0825962_131_421 89
611 3300049824 Ga0501045_0644691 Ga0501045_0644691_12_284 89
612 3300050507 nmdc:mga05p37_78264_c1 nmdc:mga05p37_78264_c1_214_486 89
613 3300050507 nmdc:mga05p37_872240_c1 nmdc:mga05p37_872240_c1_335_625 89
614 3300050509 nmdc:mga0qj67_1383768_c1 nmdc:mga0qj67_1383768_c1_132_413 89
615 3300050509 nmdc:mga0qj67_232868_c1 nmdc:mga0qj67_232868_c1_1051_1320 89
616 3300050510 nmdc:mga06r32_190316_c1 nmdc:mga06r32_190316_c1_1618_1887 89
617 3300050511 nmdc:mga08y16_1162549_c1 nmdc:mga08y16_1162549_c1_404_676 89
618 3300050512 nmdc:mga0n895_1027951_c1 nmdc:mga0n895_1027951_c1_420_698 89
619 3300050512 nmdc:mga0n895_440245_c1 nmdc:mga0n895_440245_c1_662_937 89
620 3300050512 nmdc:mga0n895_5131_c1 nmdc:mga0n895_5131_c1_10385_10654 89
621 3300050513 nmdc:mga0rr50_11675_c1 nmdc:mga0rr50_11675_c1_2012_2281 89
622 3300050514 nmdc:mga08x19_237366_c1 nmdc:mga08x19_237366_c1_628_903 89
623 3300050515 nmdc:mga0a205_424246_c1 nmdc:mga0a205_424246_c1_402_686 89
624 3300050515 nmdc:mga0a205_619964_c1 nmdc:mga0a205_619964_c1_110_379 89
625 3300053078 Ga0495612_0173611 Ga0495612_0173611_58_327 89
626 3300053079 Ga0500610_0087300 Ga0500610_0087300_370_642 89
627 3300053092 Ga0500583_0011899 Ga0500583_0011899_2044_2316 89
628 3300053093 Ga0500651_0273001 Ga0500651_0273001_458_730 89
629 3300053118 Ga0500594_0081104 Ga0500594_0081104_671_943 89
630 3300053126 Ga0500621_107118 Ga0500621_107118_121_393 89
631 3300053130 Ga0500642_0001284 Ga0500642_0001284_986_1258 89
632 3300053147 Ga0500589_000018 Ga0500589_000018_99651_99923 89
633 3300053727 Ga0500611_003222 Ga0500611_003222_1351_1623 89
634 3300060353 Ga0501082_1123113 Ga0501082_1123113_60_350 89

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10041

DUF2277

Uncharacterized conserved protein (DUF2277)

22

99

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6o82-assembly1.cif.gz_A s. pombe ubiquitin e1 complex with a ubiquitin-amp mimic 0.7285 17 64
8j07-assembly1.cif.gz_n8 96nm repeat of human respiratory doublet microtubule and associated axonemal complexes 0.6202 16 61
5wi4-assembly1.cif.gz_A crystal structure of dynlt1/tctex-1 in complex with arhgef2 0.5875 5 61
5wi4-assembly1.cif.gz_C crystal structure of dynlt1/tctex-1 in complex with arhgef2 0.5864 5 61
5wi4-assembly1.cif.gz_B crystal structure of dynlt1/tctex-1 in complex with arhgef2 0.5835 5 61
ID Description Score Start End Superfamily
af_Q76P23_14_308_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.6047 17 56 1.50.40.10
af_Q9Y7S5_183_457_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5953 19 56 1.20.1070.10
af_Q55GE2_75_295_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.5607 17 60 1.50.40.10
af_Q59VY8_255_427_1.20.1440.340 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.5546 17 63 1.20.1440.340
af_F1R8V0_259_346_3.90.640.10 Alpha Beta;Alpha-Beta Complex;Actin; Chain A, domain 4;ATPase, substrate binding domain, subdomain 4 0.5499 16 59 3.90.640.10
ID Description Score Start End GO Terms
AF-A0A2V9NU50-F1-model_v4 DUF2277 domain-containing protein 0.9938 8 88
AF-A0A445N7E6-F1-model_v4 deleted 0.9765 16 67
AF-A0A2V6LD18-F1-model_v4 DUF2277 domain-containing protein 0.9744 5 88
AF-A0A212T3K0-F1-model_v4 deleted 0.9604 16 68
AF-A0A1D7W0J5-F1-model_v4 DUF2277 domain-containing protein 0.9563 21 86

Feature Viewer

pLDDT pTM Quality
90.41 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map