F471166

General Info

Members Datasets Scaffolds Average Seq Length
634 290 1268 111

Family's Representative Sequence

Representative Sequence 3300014745|Ga0157377_10014549|Ga0157377_100145493
Length 102
Sequence VHRTRQQDLPFQGSSYQFVGADHGDVNVSVYLLSASPYDEIQFVREGRGLWNVNGNEFEAGAGDILVIKAGEIHSFKCVGDAPLVQVDVHLSPRFIQENLPE

Samples

Sample ID Description Type Environment
1 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
201 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
210 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
211 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
212 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
213 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
214 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
215 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
216 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
217 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
218 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
219 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
220 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
221 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
222 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
223 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
224 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
227 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
240 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
241 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
248 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
249 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
254 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
257 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
258 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
259 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
260 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
261 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
262 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
263 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
264 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
265 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
266 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
271 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
272 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
285 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
288 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
289 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.74
Rhizosphere 98.11
Stem 0
Stem Tuber 0
Unclassified 30.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157377_10014549 3300014745 Bacteria 4005
2 Ga0065704_10222115 3300005289 Unclassified 1070
3 Ga0065712_10384546 3300005290 Unclassified 744
4 Ga0065715_10473653 3300005293 Unclassified 804
5 Ga0065707_10115772 3300005295 Bacteria 2257
6 Ga0065707_10917806 3300005295 Unclassified 561
7 Ga0070658_10330703 3300005327 Bacteria 1302
8 Ga0070676_10009219 3300005328 Bacteria 5334
9 Ga0070676_10667020 3300005328 Bacteria 756
10 Ga0070683_100024574 3300005329 Bacteria 5398
11 Ga0070683_101175988 3300005329 Bacteria 737
12 Ga0070690_100242544 3300005330 Bacteria 1271
13 Ga0070690_101154442 3300005330 Unclassified 616
14 Ga0070670_100065198 3300005331 Bacteria 3125
15 Ga0070670_100139678 3300005331 Bacteria 2095
16 Ga0070670_100157991 3300005331 Bacteria 1964
17 Ga0070670_101247227 3300005331 Bacteria 680
18 Ga0070677_10073701 3300005333 Bacteria 1443
19 Ga0068869_100002300 3300005334 Bacteria 11497
20 Ga0068869_100633274 3300005334 Bacteria 906
21 Ga0070666_10047670 3300005335 Bacteria 2877
22 Ga0070680_100067435 3300005336 Unclassified 2935
23 Ga0070682_100325712 3300005337 Bacteria 1137
24 Ga0068868_100004787 3300005338 Bacteria 9503
25 Ga0068868_100069932 3300005338 Bacteria 2798
26 Ga0068868_100323982 3300005338 Unclassified 1313
27 Ga0070660_100003800 3300005339 Bacteria 10430
28 Ga0070689_100006406 3300005340 Bacteria 8142
29 Ga0070687_100001841 3300005343 Bacteria 7678
30 Ga0070661_100074706 3300005344 Unclassified 2496
31 Ga0070661_100293303 3300005344 Bacteria 1264
32 Ga0070661_100913360 3300005344 Unclassified 725
33 Ga0070661_101548942 3300005344 Bacteria 560
34 Ga0070692_10259501 3300005345 Bacteria 1044
35 Ga0070668_100001609 3300005347 Bacteria 16347
36 Ga0070668_100007927 3300005347 Bacteria 7885
37 Ga0070668_100067394 3300005347 Unclassified 2780
38 Ga0070669_100003869 3300005353 Bacteria 10821
39 Ga0070669_100006973 3300005353 Bacteria 8119
40 Ga0070669_100203446 3300005353 Bacteria 1559
41 Ga0070669_100911026 3300005353 Unclassified 751
42 Ga0070675_100060485 3300005354 Bacteria 3128
43 Ga0070675_100079269 3300005354 Bacteria 2736
44 Ga0070675_100103587 3300005354 Bacteria 2400
45 Ga0070671_100388684 3300005355 Bacteria 1193
46 Ga0070674_100083589 3300005356 Bacteria 2287
47 Ga0070674_100093754 3300005356 Bacteria 2173
48 Ga0070674_100314836 3300005356 Bacteria 1253
49 Ga0070674_101058691 3300005356 Bacteria 714
50 Ga0070673_100028343 3300005364 Bacteria 4163
51 Ga0070673_100738006 3300005364 Bacteria 906
52 Ga0070688_100260239 3300005365 Bacteria 1239
53 Ga0070659_100008138 3300005366 Bacteria 7647
54 Ga0070659_100012596 3300005366 Bacteria 6271
55 Ga0070667_100136760 3300005367 Bacteria 2143
56 Ga0070667_100453870 3300005367 Bacteria 1171
57 Ga0070709_10002192 3300005434 Bacteria 10586
58 Ga0070709_10277264 3300005434 Unclassified 1217
59 Ga0070709_10411056 3300005434 Unclassified 1012
60 Ga0070709_10628032 3300005434 Bacteria 830
61 Ga0070709_10802792 3300005434 Unclassified 739
62 Ga0070714_100464839 3300005435 Bacteria 1203
63 Ga0070714_100709618 3300005435 Unclassified 971
64 Ga0070713_100005287 3300005436 Bacteria 8805
65 Ga0070710_10009906 3300005437 Bacteria 4672
66 Ga0070710_10968118 3300005437 Unclassified 618
67 Ga0070710_11543522 3300005437 Unclassified 500
68 Ga0070711_100006406 3300005439 Bacteria 7096
69 Ga0070711_101356575 3300005439 Unclassified 618
70 Ga0070711_101801056 3300005439 Unclassified 537
71 Ga0070700_100038154 3300005441 Unclassified 2927
72 Ga0070700_100043751 3300005441 Bacteria 2756
73 Ga0070694_100003556 3300005444 Bacteria 9316
74 Ga0070694_100292192 3300005444 Bacteria 1246
75 Ga0070694_101778433 3300005444 Bacteria 525
76 Ga0070708_100139326 3300005445 Unclassified 2249
77 Ga0070708_100187257 3300005445 Bacteria 1936
78 Ga0070708_100299124 3300005445 Bacteria 1515
79 Ga0070708_100573032 3300005445 Bacteria 1064
80 Ga0070663_100015206 3300005455 Bacteria 4961
81 Ga0070678_101015405 3300005456 Bacteria 763
82 Ga0070662_100023823 3300005457 Bacteria 4210
83 Ga0070681_10093349 3300005458 Bacteria 2958
84 Ga0068867_100091584 3300005459 Unclassified 2308
85 Ga0068867_100122396 3300005459 Unclassified 2012
86 Ga0068867_100135862 3300005459 Bacteria 1916
87 Ga0068867_100454600 3300005459 Bacteria 1092
88 Ga0068867_100696359 3300005459 Bacteria 896
89 Ga0070685_10029782 3300005466 Bacteria 3035
90 Ga0070706_100419250 3300005467 Unclassified 1246
91 Ga0070706_100766023 3300005467 Bacteria 894
92 Ga0070707_100814106 3300005468 Unclassified 898
93 Ga0070707_102331088 3300005468 Bacteria 503
94 Ga0070698_100043341 3300005471 Unclassified 4613
95 Ga0070699_100193745 3300005518 Unclassified 1806
96 Ga0070699_100277744 3300005518 Bacteria 1500
97 Ga0070699_101567642 3300005518 Archaea 604
98 Ga0070679_100020989 3300005530 Bacteria 6373
99 Ga0070684_100019666 3300005535 Bacteria 5588
100 Ga0070684_100148836 3300005535 Bacteria 2120
101 Ga0070684_100358884 3300005535 Bacteria 1341
102 Ga0070684_100621937 3300005535 Bacteria 1005
103 Ga0070697_100120726 3300005536 Bacteria 2192
104 Ga0070697_100146076 3300005536 Unclassified 1991
105 Ga0070697_100929028 3300005536 Unclassified 772
106 Ga0068853_100303279 3300005539 Bacteria 1477
107 Ga0070672_100010482 3300005543 Bacteria 6428
108 Ga0070672_100030978 3300005543 Bacteria 4023
109 Ga0070672_100092254 3300005543 Bacteria 2445
110 Ga0070672_100099865 3300005543 Bacteria 2353
111 Ga0070686_100121019 3300005544 Unclassified 1797
112 Ga0070695_100010916 3300005545 Bacteria 5428
113 Ga0070696_100264612 3300005546 Bacteria 1305
114 Ga0070696_100421246 3300005546 Bacteria 1048
115 Ga0070693_100568584 3300005547 Unclassified 814
116 Ga0070665_100010959 3300005548 Bacteria 9168
117 Ga0070665_100040145 3300005548 Bacteria 4704
118 Ga0070665_100090545 3300005548 Bacteria 3065
119 Ga0070665_100376510 3300005548 Bacteria 1427
120 Ga0070665_101437613 3300005548 Unclassified 698
121 Ga0070704_100282072 3300005549 Bacteria 1377
122 Ga0070704_100355400 3300005549 Bacteria 1238
123 Ga0070704_100545587 3300005549 Bacteria 1012
124 Ga0068855_100458380 3300005563 Bacteria 1390
125 Ga0068855_101812412 3300005563 Unclassified 620
126 Ga0068855_102506263 3300005563 Unclassified 513
127 Ga0070664_100046376 3300005564 Bacteria 3670
128 Ga0070664_100048841 3300005564 Bacteria 3577
129 Ga0070664_100236856 3300005564 Bacteria 1637
130 Ga0068857_100001626 3300005577 Bacteria 18044
131 Ga0068857_100039807 3300005577 Bacteria 4165
132 Ga0068857_100398504 3300005577 Bacteria 1280
133 Ga0068854_100054816 3300005578 Bacteria 2869
134 Ga0068854_100288693 3300005578 Bacteria 1323
135 Ga0068854_101894738 3300005578 Bacteria 548
136 Ga0068856_100244885 3300005614 Bacteria 1808
137 Ga0068852_100005183 3300005616 Bacteria 9295
138 Ga0068859_100059940 3300005617 Bacteria 3835
139 Ga0068859_100212230 3300005617 Bacteria 2022
140 Ga0068859_100378054 3300005617 Bacteria 1512
141 Ga0068859_102332141 3300005617 Bacteria 590
142 Ga0068864_100268554 3300005618 Bacteria 1589
143 Ga0068864_100325709 3300005618 Bacteria 1444
144 Ga0068864_100345730 3300005618 Bacteria 1402
145 Ga0068864_101057210 3300005618 Unclassified 807
146 Ga0068866_11056260 3300005718 Unclassified 580
147 Ga0068861_100001250 3300005719 Bacteria 15847
148 Ga0068861_100060638 3300005719 Unclassified 2900
149 Ga0068861_100704678 3300005719 Bacteria 938
150 Ga0068851_10028199 3300005834 Bacteria 2773
151 Ga0068851_10144993 3300005834 Bacteria 1294
152 Ga0068870_10008485 3300005840 Bacteria 4625
153 Ga0068863_100006527 3300005841 Bacteria 11447
154 Ga0068863_100100043 3300005841 Bacteria 2755
155 Ga0068863_100431155 3300005841 Bacteria 1292
156 Ga0068863_100833749 3300005841 Bacteria 920
157 Ga0068858_100007580 3300005842 Bacteria 10485
158 Ga0068858_100343230 3300005842 Bacteria 1429
159 Ga0068858_100364222 3300005842 Bacteria 1386
160 Ga0068858_100744411 3300005842 Bacteria 955
161 Ga0068858_100814989 3300005842 Bacteria 911
162 Ga0068860_100043775 3300005843 Bacteria 4269
163 Ga0068860_100177472 3300005843 Bacteria 2059
164 Ga0068860_100399951 3300005843 Bacteria 1359
165 Ga0068862_100020253 3300005844 Bacteria 5556
166 Ga0068862_100317929 3300005844 Bacteria 1436
167 Ga0068862_101033932 3300005844 Unclassified 814
168 Ga0081455_10343461 3300005937 Unclassified 1055
169 Ga0081538_10010385 3300005981 Bacteria 7634
170 Ga0070717_10203984 3300006028 Bacteria 1733
171 Ga0070715_11068368 3300006163 Unclassified 507
172 Ga0070716_100002029 3300006173 Bacteria 9252
173 Ga0070716_100011053 3300006173 Bacteria 4541
174 Ga0070712_100000397 3300006175 Bacteria 24792
175 Ga0070712_100091510 3300006175 Bacteria 2229
176 Ga0070712_100150632 3300006175 Bacteria 1786
177 Ga0070712_101679096 3300006175 Unclassified 556
178 Ga0097621_100014992 3300006237 Bacteria 5818
179 Ga0097621_100139860 3300006237 Bacteria 2068
180 Ga0097621_100331550 3300006237 Unclassified 1350
181 Ga0068871_100009482 3300006358 Bacteria 7057
182 Ga0068871_100020709 3300006358 Bacteria 5043
183 Ga0075428_100094655 3300006844 Bacteria 3257
184 Ga0075428_100505006 3300006844 Bacteria 1294
185 Ga0075430_100197914 3300006846 Bacteria 1669
186 Ga0075430_100656751 3300006846 Bacteria 865
187 Ga0075431_100009772 3300006847 Bacteria 9633
188 Ga0075431_100011776 3300006847 Bacteria 8825
189 Ga0075431_100068200 3300006847 Unclassified 3670
190 Ga0075431_100120507 3300006847 Bacteria 2707
191 Ga0075431_100476220 3300006847 Bacteria 1242
192 Ga0075431_100691056 3300006847 Bacteria 998
193 Ga0075431_100720934 3300006847 Bacteria 974
194 Ga0075431_102186857 3300006847 Unclassified 508
195 Ga0075433_10005549 3300006852 Bacteria 9908
196 Ga0075433_10015035 3300006852 Bacteria 6336
197 Ga0075433_10129789 3300006852 Unclassified 2239
198 Ga0075433_10143950 3300006852 Bacteria 2119
199 Ga0075433_10245678 3300006852 Bacteria 1589
200 Ga0075433_10454359 3300006852 Unclassified 1129
201 Ga0075434_100002635 3300006871 Bacteria 15824
202 Ga0075434_100002849 3300006871 Bacteria 15333
203 Ga0075434_100034731 3300006871 Bacteria 4982
204 Ga0075434_100096574 3300006871 Bacteria 2960
205 Ga0075434_100671778 3300006871 Unclassified 1054
206 Ga0075429_100005412 3300006880 Bacteria 10989
207 Ga0075429_100044359 3300006880 Unclassified 3869
208 Ga0075429_100127649 3300006880 Bacteria 2224
209 Ga0075429_100179781 3300006880 Bacteria 1854
210 Ga0075429_100343257 3300006880 Bacteria 1307
211 Ga0068865_100011263 3300006881 Bacteria 5592
212 Ga0068865_100016404 3300006881 Bacteria 4739
213 Ga0068865_102172305 3300006881 Bacteria 505
214 Ga0075436_100255397 3300006914 Bacteria 1249
215 Ga0075436_100592258 3300006914 Unclassified 816
216 Ga0097620_100059943 3300006931 Bacteria 3835
217 Ga0097620_100212226 3300006931 Bacteria 2022
218 Ga0097620_100378068 3300006931 Bacteria 1512
219 Ga0097620_102331612 3300006931 Bacteria 590
220 Ga0075435_100036588 3300007076 Unclassified 3903
221 Ga0075435_100187792 3300007076 Bacteria 1748
222 Ga0075435_100419832 3300007076 Bacteria 1152
223 Ga0075435_100606553 3300007076 Bacteria 949
224 Ga0099794_10043130 3300007265 Bacteria 2152
225 Ga0105250_10280358 3300009092 Unclassified 717
226 Ga0111539_10159017 3300009094 Bacteria 2643
227 Ga0111539_12050946 3300009094 Unclassified 663
228 Ga0105245_10007325 3300009098 Bacteria 9662
229 Ga0105245_10205910 3300009098 Bacteria 1891
230 Ga0105245_11168886 3300009098 Unclassified 817
231 Ga0105247_10503272 3300009101 Bacteria 883
232 Ga0114129_10005584 3300009147 Bacteria 17793
233 Ga0114129_10026566 3300009147 Bacteria 8199
234 Ga0114129_10034555 3300009147 Bacteria 7142
235 Ga0114129_10089001 3300009147 Bacteria 4280
236 Ga0114129_10101321 3300009147 Bacteria 3985
237 Ga0114129_10129989 3300009147 Bacteria 3460
238 Ga0114129_10171378 3300009147 Unclassified 2959
239 Ga0114129_10385087 3300009147 Bacteria 1851
240 Ga0114129_10940145 3300009147 Bacteria 1093
241 Ga0114129_11118056 3300009147 Bacteria 985
242 Ga0114129_11181968 3300009147 Bacteria 954
243 Ga0114129_13320978 3300009147 Unclassified 520
244 Ga0105243_11150090 3300009148 Unclassified 787
245 Ga0105241_10271315 3300009174 Bacteria 1445
246 Ga0105241_10709653 3300009174 Bacteria 919
247 Ga0105242_10006285 3300009176 Bacteria 9153
248 Ga0105242_10006561 3300009176 Bacteria 8961
249 Ga0105242_10015193 3300009176 Bacteria 5978
250 Ga0105242_10373983 3300009176 Bacteria 1322
251 Ga0105248_10020428 3300009177 Bacteria 7338
252 Ga0105248_10045687 3300009177 Bacteria 4910
253 Ga0105248_10376702 3300009177 Bacteria 1598
254 Ga0105248_11065805 3300009177 Bacteria 913
255 Ga0105248_12939766 3300009177 Unclassified 543
256 Ga0105237_10055382 3300009545 Bacteria 3972
257 Ga0105237_10410040 3300009545 Bacteria 1360
258 Ga0105237_11101307 3300009545 Unclassified 801
259 Ga0105238_10361194 3300009551 Bacteria 1442
260 Ga0105238_11366390 3300009551 Unclassified 735
261 Ga0105249_10001997 3300009553 Bacteria 17723
262 Ga0105239_10151218 3300010375 Bacteria 2590
263 Ga0105239_10361896 3300010375 Bacteria 1638
264 Ga0105239_10435209 3300010375 Unclassified 1487
265 Ga0105246_11713307 3300011119 Unclassified 598
266 Ga0157373_10222307 3300013100 Bacteria 1332
267 Ga0157373_11072980 3300013100 Bacteria 603
268 Ga0157371_10127256 3300013102 Bacteria 1812
269 Ga0157369_10292731 3300013105 Bacteria 1695
270 Ga0157374_10036586 3300013296 Unclassified 4497
271 Ga0157374_10036723 3300013296 Bacteria 4491
272 Ga0157374_10056985 3300013296 Bacteria 3649
273 Ga0157374_11979746 3300013296 Unclassified 609
274 Ga0157378_10014491 3300013297 Bacteria 6903
275 Ga0157378_10045300 3300013297 Bacteria 3908
276 Ga0157378_10050088 3300013297 Unclassified 3716
277 Ga0157378_10420469 3300013297 Unclassified 1321
278 Ga0163162_10002300 3300013306 Bacteria 17935
279 Ga0163162_10282982 3300013306 Unclassified 1790
280 Ga0163162_12350683 3300013306 Unclassified 612
281 Ga0163162_12963097 3300013306 Unclassified 546
282 Ga0157372_10895933 3300013307 Unclassified 1029
283 Ga0157375_10049536 3300013308 Bacteria 4117
284 Ga0157375_10292383 3300013308 Bacteria 1792
285 Ga0157375_10382001 3300013308 Bacteria 1575
286 Ga0157375_10982028 3300013308 Bacteria 985
287 Ga0157375_11225572 3300013308 Unclassified 881
288 Ga0157375_13609319 3300013308 Bacteria 515
289 Ga0163163_10129833 3300014325 Bacteria 2560
290 Ga0163163_10493996 3300014325 Unclassified 1285
291 Ga0163163_10600450 3300014325 Unclassified 1164
292 Ga0157380_10006591 3300014326 Bacteria 8191
293 Ga0157377_10471013 3300014745 Bacteria 872
294 Ga0157379_10031370 3300014968 Bacteria 4733
295 Ga0157379_10050728 3300014968 Bacteria 3705
296 Ga0157376_10007113 3300014969 Bacteria 7947
297 Ga0157376_10020881 3300014969 Bacteria 5076
298 Ga0207697_10005536 3300025315 Bacteria 5855
299 Ga0207697_10149033 3300025315 Unclassified 1017
300 Ga0207697_10246214 3300025315 Unclassified 790
301 Ga0207692_10004197 3300025898 Bacteria 5690
302 Ga0207692_10407728 3300025898 Bacteria 849
303 Ga0207642_10084606 3300025899 Bacteria 1550
304 Ga0207688_10031328 3300025901 Bacteria 2935
305 Ga0207680_10038211 3300025903 Bacteria 2778
306 Ga0207647_10103196 3300025904 Bacteria 1691
307 Ga0207685_10127913 3300025905 Unclassified 1124
308 Ga0207685_10385634 3300025905 Bacteria 715
309 Ga0207699_10000395 3300025906 Bacteria 22618
310 Ga0207699_10241976 3300025906 Unclassified 1240
311 Ga0207699_10332008 3300025906 Unclassified 1069
312 Ga0207645_10003441 3300025907 Bacteria 12023
313 Ga0207645_10255862 3300025907 Bacteria 1159
314 Ga0207645_10289077 3300025907 Bacteria 1090
315 Ga0207705_10163234 3300025909 Bacteria 1674
316 Ga0207654_10517800 3300025911 Unclassified 844
317 Ga0207707_10125626 3300025912 Bacteria 2243
318 Ga0207693_10000033 3300025915 Bacteria 114840
319 Ga0207693_10124648 3300025915 Bacteria 2024
320 Ga0207663_10083452 3300025916 Bacteria 2099
321 Ga0207660_10009757 3300025917 Bacteria 6214
322 Ga0207662_10004311 3300025918 Bacteria 7468
323 Ga0207657_10007318 3300025919 Bacteria 11322
324 Ga0207649_10023399 3300025920 Bacteria 3577
325 Ga0207649_10061055 3300025920 Bacteria 2371
326 Ga0207649_10164762 3300025920 Unclassified 1539
327 Ga0207652_10331925 3300025921 Bacteria 1373
328 Ga0207646_10625053 3300025922 Unclassified 966
329 Ga0207646_10706360 3300025922 Unclassified 901
330 Ga0207646_10871786 3300025922 Unclassified 799
331 Ga0207681_10010680 3300025923 Bacteria 5633
332 Ga0207681_10141453 3300025923 Unclassified 1792
333 Ga0207681_10390654 3300025923 Bacteria 1122
334 Ga0207650_10111003 3300025925 Bacteria 2123
335 Ga0207650_10140124 3300025925 Bacteria 1900
336 Ga0207659_10035245 3300025926 Unclassified 3457
337 Ga0207659_10063814 3300025926 Bacteria 2664
338 Ga0207687_10076571 3300025927 Bacteria 2403
339 Ga0207700_10004391 3300025928 Bacteria 8307
340 Ga0207700_10017861 3300025928 Bacteria 4748
341 Ga0207664_10525546 3300025929 Bacteria 1061
342 Ga0207644_10696163 3300025931 Bacteria 847
343 Ga0207690_10385151 3300025932 Bacteria 1115
344 Ga0207706_10002234 3300025933 Bacteria 18904
345 Ga0207706_10282560 3300025933 Bacteria 1447
346 Ga0207686_10038718 3300025934 Bacteria 2887
347 Ga0207686_10186536 3300025934 Unclassified 1475
348 Ga0207686_10923362 3300025934 Unclassified 705
349 Ga0207670_10040850 3300025936 Bacteria 3046
350 Ga0207670_10962244 3300025936 Bacteria 717
351 Ga0207669_10039323 3300025937 Bacteria 2732
352 Ga0207669_10502294 3300025937 Bacteria 970
353 Ga0207669_10950485 3300025937 Bacteria 720
354 Ga0207669_11114735 3300025937 Unclassified 666
355 Ga0207704_10156224 3300025938 Bacteria 1617
356 Ga0207665_10000736 3300025939 Bacteria 22027
357 Ga0207665_10045384 3300025939 Unclassified 2943
358 Ga0207691_10006026 3300025940 Bacteria 11703
359 Ga0207691_10007102 3300025940 Bacteria 10810
360 Ga0207691_10062256 3300025940 Bacteria 3387
361 Ga0207691_10248474 3300025940 Bacteria 1536
362 Ga0207711_10208576 3300025941 Bacteria 1784
363 Ga0207711_10307435 3300025941 Bacteria 1463
364 Ga0207689_10001946 3300025942 Bacteria 19554
365 Ga0207689_10071435 3300025942 Unclassified 2851
366 Ga0207689_10291452 3300025942 Bacteria 1352
367 Ga0207661_10491841 3300025944 Bacteria 1120
368 Ga0207661_11043246 3300025944 Unclassified 753
369 Ga0207679_10008305 3300025945 Bacteria 6612
370 Ga0207679_10041799 3300025945 Bacteria 3290
371 Ga0207679_10053007 3300025945 Bacteria 2978
372 Ga0207667_10390924 3300025949 Bacteria 1416
373 Ga0207667_11695191 3300025949 Unclassified 599
374 Ga0207651_10162101 3300025960 Bacteria 1754
375 Ga0207651_10595188 3300025960 Bacteria 966
376 Ga0207712_10006939 3300025961 Bacteria 7146
377 Ga0207668_10036165 3300025972 Unclassified 3294
378 Ga0207668_10952863 3300025972 Unclassified 765
379 Ga0207640_10016116 3300025981 Bacteria 4340
380 Ga0207658_10165100 3300025986 Bacteria 1818
381 Ga0207677_10053984 3300026023 Bacteria 2739
382 Ga0207677_10274664 3300026023 Bacteria 1380
383 Ga0207677_10377368 3300026023 Unclassified 1196
384 Ga0207703_10143645 3300026035 Bacteria 2074
385 Ga0207703_10500801 3300026035 Bacteria 1140
386 Ga0207703_11109926 3300026035 Unclassified 760
387 Ga0207678_10027550 3300026067 Bacteria 4958
388 Ga0207708_10022063 3300026075 Bacteria 4807
389 Ga0207641_10059027 3300026088 Bacteria 3266
390 Ga0207641_10304436 3300026088 Unclassified 1506
391 Ga0207641_10403477 3300026088 Bacteria 1313
392 Ga0207641_10606761 3300026088 Bacteria 1072
393 Ga0207641_10777680 3300026088 Bacteria 946
394 Ga0207648_10032139 3300026089 Bacteria 4636
395 Ga0207648_10496898 3300026089 Bacteria 1116
396 Ga0207676_10411575 3300026095 Bacteria 1266
397 Ga0207676_10871843 3300026095 Bacteria 881
398 Ga0207674_10010447 3300026116 Bacteria 10514
399 Ga0207674_10047656 3300026116 Bacteria 4391
400 Ga0207675_100000209 3300026118 Bacteria 54603
401 Ga0207675_100790598 3300026118 Bacteria 962
402 Ga0207683_10068203 3300026121 Bacteria 3139
403 Ga0207698_10070872 3300026142 Bacteria 2763
404 Ga0209995_1044576 3300027471 Bacteria 751
405 Ga0209968_1064893 3300027526 Bacteria 646
406 Ga0209999_1087404 3300027543 Unclassified 603
407 Ga0209588_1055167 3300027671 Bacteria 1285
408 Ga0209971_1022557 3300027682 Bacteria 1500
409 Ga0207428_10338087 3300027907 Bacteria 1109
410 Ga0268266_10000490 3300028379 Bacteria 56757
411 Ga0268266_10020801 3300028379 Bacteria 5595
412 Ga0268266_10116620 3300028379 Bacteria 2372
413 Ga0268266_10234144 3300028379 Bacteria 1692
414 Ga0268266_10284766 3300028379 Bacteria 1538
415 Ga0268266_10912185 3300028379 Bacteria 850
416 Ga0268265_10020625 3300028380 Bacteria 4602
417 Ga0268265_10033237 3300028380 Bacteria 3748
418 Ga0268264_10026974 3300028381 Bacteria 4692
419 Ga0268264_10690959 3300028381 Unclassified 1013
420 Ga0268264_11220833 3300028381 Unclassified 761
421 Ga0268264_11587572 3300028381 Unclassified 665
422 Ga0307408_100059995 3300031548 Unclassified 2771
423 Ga0307408_100397625 3300031548 Unclassified 1182
424 Ga0307405_10103747 3300031731 Unclassified 1912
425 Ga0307405_10112359 3300031731 Unclassified 1848
426 Ga0307405_10253411 3300031731 Bacteria 1311
427 Ga0307413_10043498 3300031824 Unclassified 2647
428 Ga0307413_10051952 3300031824 Bacteria 2473
429 Ga0307413_10693160 3300031824 Bacteria 845
430 Ga0307413_11164705 3300031824 Unclassified 669
431 Ga0307410_10001136 3300031852 Bacteria 11682
432 Ga0307410_10094319 3300031852 Bacteria 2131
433 Ga0307410_10118745 3300031852 Bacteria 1925
434 Ga0307410_10188471 3300031852 Bacteria 1567
435 Ga0307410_10258959 3300031852 Bacteria 1356
436 Ga0307406_10055791 3300031901 Unclassified 2527
437 Ga0307406_11047751 3300031901 Bacteria 702
438 Ga0307407_10017952 3300031903 Bacteria 3565
439 Ga0307407_10504775 3300031903 Bacteria 887
440 Ga0307412_11224839 3300031911 Bacteria 673
441 Ga0307409_100235994 3300031995 Bacteria 1661
442 Ga0307409_100239745 3300031995 Bacteria 1650
443 Ga0307409_100856487 3300031995 Unclassified 920
444 Ga0307409_101076422 3300031995 Unclassified 824
445 Ga0307416_100002534 3300032002 Bacteria 10514
446 Ga0307416_100083428 3300032002 Unclassified 2711
447 Ga0307416_100104570 3300032002 Bacteria 2476
448 Ga0307416_100122064 3300032002 Unclassified 2324
449 Ga0307416_101060753 3300032002 Bacteria 914
450 Ga0307416_103886019 3300032002 Unclassified 500
451 Ga0307414_10060255 3300032004 Unclassified 2683
452 Ga0307414_10452714 3300032004 Unclassified 1126
453 Ga0307414_11797336 3300032004 Bacteria 572
454 Ga0307411_10012291 3300032005 Bacteria 4664
455 Ga0307411_10294493 3300032005 Bacteria 1298
456 Ga0307411_10759279 3300032005 Bacteria 850
457 Ga0307411_11934978 3300032005 Bacteria 549
458 Ga0307415_100276937 3300032126 Unclassified 1377
459 Ga0307415_100539099 3300032126 Unclassified 1028
460 Ga0307415_102035863 3300032126 Bacteria 560
461 Ga0373940_0317014 3300035088 Unclassified 540
462 Ga0373932_0344052 3300035112 Unclassified 566
463 Ga0373941_0054175 3300035115 Bacteria 1285
464 Ga0373924_0068511 3300035410 Bacteria 1494
465 Ga0373931_0085868 3300035691 Bacteria 1745
466 Ga0373931_0447657 3300035691 Bacteria 825
467 Ga0373935_0642039 3300035692 Bacteria 778
468 Ga0373935_1027309 3300035692 Unclassified 613
469 Ga0373947_0844145 3300035725 Unclassified 625
470 Ga0373937_0035715 3300036401 Bacteria 4525
471 Ga0395900_0113229 3300037418 Unclassified 2785
472 Ga0395905_0035026 3300037471 Bacteria 4713
473 Ga0395905_0071859 3300037471 Unclassified 3244
474 Ga0395905_0073308 3300037471 Unclassified 3209
475 Ga0395905_0348413 3300037471 Bacteria 1373
476 Ga0395905_0601916 3300037471 Bacteria 1001
477 Ga0395905_1033588 3300037471 Bacteria 725
478 Ga0395901_2157821 3300038443 Unclassified 501
479 Ga0451839_0855377 3300041496 Bacteria 692
480 Ga0439433_0178829 3300041999 Bacteria 555
481 Ga0439448_0022998 3300042005 Unclassified 1941
482 Ga0439448_0119035 3300042005 Bacteria 906
483 Ga0439455_0141913 3300042012 Unclassified 681
484 Ga0450920_108128 3300042122 Bacteria 580
485 Ga0450923_136118 3300042125 Unclassified 588
486 Ga0450891_033840 3300042129 Bacteria 535
487 Ga0450894_040867 3300042131 Bacteria 666
488 Ga0450898_001005 3300042134 Unclassified 3570
489 Ga0450898_047147 3300042134 Bacteria 826
490 Ga0450910_012142 3300042147 Bacteria 1243
491 Ga0439446_0065941 3300042156 Unclassified 1101
492 Ga0439435_0136283 3300042436 Unclassified 779
493 Ga0451577_0328879 3300042876 Unclassified 1386
494 Ga0453683_0934207 3300044673 Bacteria 574
495 Ga0453684_1267320 3300044712 Unclassified 771
496 Ga0466960_1044516 3300044901 Bacteria 503
497 Ga0451576_0029704 3300045051 Bacteria 5847
498 Ga0451576_0790414 3300045051 Bacteria 996
499 Ga0451576_0847438 3300045051 Bacteria 959
500 Ga0495603_0302588 3300046455 Bacteria 918
501 Ga0495590_0130089 3300046457 Unclassified 905
502 Ga0495580_0390450 3300046472 Unclassified 939
503 Ga0495639_0210912 3300046475 Bacteria 953
504 Ga0495640_0058955 3300046533 Bacteria 2617
505 Ga0495647_0072542 3300046681 Unclassified 1381
506 Ga0495647_0154990 3300046681 Bacteria 984
507 Ga0495658_0386457 3300046683 Unclassified 891
508 Ga0495624_0413844 3300046690 Bacteria 809
509 Ga0496101_1435378 3300048904 Bacteria 538
510 Ga0496102_1065979 3300048905 Unclassified 728
511 Ga0496102_1169281 3300048905 Unclassified 689
512 Ga0496102_1262184 3300048905 Unclassified 658
513 Ga0496104_0224382 3300048907 Unclassified 1791
514 Ga0496107_0163204 3300048910 Unclassified 1652
515 Ga0496107_0750802 3300048910 Unclassified 716
516 Ga0496115_0102598 3300048918 Unclassified 2346
517 Ga0496115_0444166 3300048918 Unclassified 1048
518 Ga0496115_0871379 3300048918 Bacteria 696
519 Ga0496115_1348266 3300048918 Unclassified 529
520 Ga0501296_004630 3300049519 Unclassified 1508
521 Ga0501299_016808 3300049522 Bacteria 1299
522 Ga0501031_0062341 3300049568 Bacteria 2430
523 Ga0501031_0154831 3300049568 Unclassified 1498
524 Ga0501031_0174126 3300049568 Bacteria 1406
525 Ga0501036_0031838 3300049572 Bacteria 4456
526 Ga0501036_0436605 3300049572 Bacteria 1091
527 Ga0501036_0603826 3300049572 Bacteria 910
528 Ga0501039_0143637 3300049575 Bacteria 1875
529 Ga0501040_0256630 3300049576 Unclassified 1247
530 Ga0501040_0735048 3300049576 Unclassified 714
531 Ga0501041_0009638 3300049577 Bacteria 5694
532 Ga0501041_0092452 3300049577 Unclassified 1868
533 Ga0501042_0142489 3300049578 Bacteria 1728
534 Ga0501042_0446431 3300049578 Bacteria 938
535 Ga0501067_0091835 3300049583 Unclassified 1685
536 Ga0501068_0234740 3300049584 Unclassified 1167
537 Ga0501069_0017036 3300049585 Bacteria 3906
538 Ga0501070_0069168 3300049586 Bacteria 2923
539 Ga0501071_0034045 3300049587 Bacteria 3623
540 Ga0501071_0185123 3300049587 Unclassified 1561
541 Ga0501072_0058832 3300049588 Bacteria 3029
542 Ga0501074_1184923 3300049590 Bacteria 536
543 Ga0501075_0100711 3300049591 Unclassified 2194
544 Ga0501075_0300661 3300049591 Bacteria 1223
545 Ga0501075_0954853 3300049591 Bacteria 651
546 Ga0501075_1082544 3300049591 Unclassified 609
547 Ga0501076_0011562 3300049592 Bacteria 6582
548 Ga0501076_0885091 3300049592 Bacteria 736
549 Ga0501077_0000625 3300049593 Bacteria 21450
550 Ga0501077_0112067 3300049593 Bacteria 1729
551 Ga0501201_018636 3300049651 Unclassified 723
552 Ga0501216_027401 3300049660 Bacteria 1034
553 Ga0501235_022072 3300049669 Unclassified 1415
554 Ga0501239_009652 3300049672 Unclassified 1053
555 Ga0501243_006193 3300049675 Unclassified 1812
556 Ga0501246_039438 3300049676 Unclassified 560
557 Ga0501248_027322 3300049678 Unclassified 631
558 Ga0501249_013688 3300049679 Unclassified 1725
559 Ga0501259_034162 3300049688 Unclassified 974
560 Ga0501259_066292 3300049688 Bacteria 765
561 Ga0501221_114472 3300049704 Bacteria 683
562 Ga0501079_0012479 3300049741 Bacteria 6486
563 Ga0501080_0049489 3300049742 Bacteria 3912
564 Ga0501080_0937415 3300049742 Unclassified 753
565 Ga0501081_0064621 3300049743 Unclassified 2542
566 Ga0501272_005048 3300049769 Unclassified 1384
567 Ga0501273_000267 3300049770 Unclassified 3961
568 Ga0501275_013710 3300049772 Unclassified 911
569 Ga0501035_1096801 3300049822 Bacteria 622
570 Ga0501045_0008186 3300049824 Bacteria 7281
571 Ga0501045_0018723 3300049824 Bacteria 4930
572 Ga0501045_0478837 3300049824 Unclassified 925
573 nmdc:mga05p37_248560_c1 3300050507 Bacteria 2134
574 nmdc:mga05p37_25032_c1 3300050507 Bacteria 7256
575 nmdc:mga05p37_289555_c1 3300050507 Bacteria 1950
576 nmdc:mga05p37_34983_c1 3300050507 Bacteria 6157
577 nmdc:mga05p37_351478_c1 3300050507 Unclassified 1735
578 nmdc:mga05p37_36873_c2 3300050507 Bacteria 5459
579 nmdc:mga05p37_601296_c1 3300050507 Bacteria 1241
580 nmdc:mga05p37_69114_c1 3300050507 Unclassified 4344
581 nmdc:mga05p37_892606_c1 3300050507 Bacteria 960
582 nmdc:mga05p37_972566_c1 3300050507 Bacteria 905
583 nmdc:mga09592_121748_c1 3300050508 Bacteria 2241
584 nmdc:mga09592_25873_c1 3300050508 Bacteria 4860
585 nmdc:mga09592_47371_c1 3300050508 Unclassified 3623
586 nmdc:mga09592_821418_c1 3300050508 Bacteria 785
587 nmdc:mga0qj67_721883_c1 3300050509 Unclassified 792
588 nmdc:mga0qj67_7450_c1 3300050509 Bacteria 8083
589 nmdc:mga0qj67_90715_c1 3300050509 Bacteria 2455
590 nmdc:mga06r32_139553_c1 3300050510 Unclassified 2399
591 nmdc:mga06r32_1546475_c1 3300050510 Bacteria 603
592 nmdc:mga06r32_2053996_c1 3300050510 Unclassified 505
593 nmdc:mga06r32_22845_c1 3300050510 Bacteria 5784
594 nmdc:mga06r32_31599_c1 3300050510 Bacteria 4974
595 nmdc:mga06r32_530194_c1 3300050510 Bacteria 1153
596 nmdc:mga06r32_62418_c1 3300050510 Unclassified 3590
597 nmdc:mga06r32_65214_c1 3300050510 Bacteria 3512
598 nmdc:mga06r32_793491_c1 3300050510 Bacteria 908
599 nmdc:mga08y16_1698837_c1 3300050511 Unclassified 587
600 nmdc:mga0n895_133336_c1 3300050512 Bacteria 2510
601 nmdc:mga0n895_1864_c1 3300050512 Bacteria 16086
602 nmdc:mga0n895_4637_c1 3300050512 Bacteria 11333
603 nmdc:mga0n895_53518_c1 3300050512 Bacteria 3966
604 nmdc:mga0rr50_1486610_c1 3300050513 Unclassified 573
605 nmdc:mga0rr50_230790_c1 3300050513 Unclassified 1531
606 nmdc:mga0rr50_394476_c1 3300050513 Bacteria 1168
607 nmdc:mga0rr50_56434_c1 3300050513 Unclassified 2934
608 nmdc:mga0rr50_580316_c1 3300050513 Bacteria 955
609 nmdc:mga0rr50_798649_c1 3300050513 Unclassified 805
610 nmdc:mga08x19_1055859_c1 3300050514 Unclassified 577
611 nmdc:mga08x19_603536_c1 3300050514 Unclassified 778
612 nmdc:mga08x19_729940_c1 3300050514 Unclassified 703
613 nmdc:mga0a205_136551_c1 3300050515 Bacteria 2353
614 nmdc:mga0a205_182669_c1 3300050515 Bacteria 1991
615 nmdc:mga0a205_39616_c1 3300050515 Bacteria 4534
616 nmdc:mga0a205_431478_c1 3300050515 Bacteria 1179
617 nmdc:mga0a205_5302_c1 3300050515 Bacteria 11608
618 nmdc:mga0a205_69322_c1 3300050515 Bacteria 3405
619 nmdc:mga0a205_72357_c1 3300050515 Bacteria 3330
620 nmdc:mga0a205_89907_c1 3300050515 Unclassified 2967
621 Ga0495601_1031877 3300053077 Unclassified 516
622 Ga0495612_0276758 3300053078 Unclassified 750
623 Ga0501084_0174476 3300054114 Bacteria 1814
624 Ga0501084_0709257 3300054114 Bacteria 848
625 Ga0590071_002274 3300059421 Unclassified 4865
626 Ga0590071_008954 3300059421 Bacteria 2354
627 Ga0590071_010410 3300059421 Unclassified 2178
628 Ga0590071_020991 3300059421 Bacteria 1538
629 Ga0590075_031921 3300059424 Bacteria 1336
630 Ga0590077_003787 3300059426 Unclassified 3120
631 Ga0590077_019119 3300059426 Bacteria 1449
632 Ga0501082_0082619 3300060353 Bacteria 2772
633 Ga0501082_0407285 3300060353 Unclassified 1187
634 Ga0501082_1259293 3300060353 Unclassified 646
635 Ga0157377_10014549
636 Ga0065704_10222115
637 Ga0065712_10384546
638 Ga0065715_10473653
639 Ga0065707_10115772
640 Ga0065707_10917806
641 Ga0070658_10330703
642 Ga0070676_10009219
643 Ga0070676_10667020
644 Ga0070683_100024574
645 Ga0070683_101175988
646 Ga0070690_100242544
647 Ga0070690_101154442
648 Ga0070670_100065198
649 Ga0070670_100139678
650 Ga0070670_100157991
651 Ga0070670_101247227
652 Ga0070677_10073701
653 Ga0068869_100002300
654 Ga0068869_100633274
655 Ga0070666_10047670
656 Ga0070680_100067435
657 Ga0070682_100325712
658 Ga0068868_100004787
659 Ga0068868_100069932
660 Ga0068868_100323982
661 Ga0070660_100003800
662 Ga0070689_100006406
663 Ga0070687_100001841
664 Ga0070661_100074706
665 Ga0070661_100293303
666 Ga0070661_100913360
667 Ga0070661_101548942
668 Ga0070692_10259501
669 Ga0070668_100001609
670 Ga0070668_100007927
671 Ga0070668_100067394
672 Ga0070669_100003869
673 Ga0070669_100006973
674 Ga0070669_100203446
675 Ga0070669_100911026
676 Ga0070675_100060485
677 Ga0070675_100079269
678 Ga0070675_100103587
679 Ga0070671_100388684
680 Ga0070674_100083589
681 Ga0070674_100093754
682 Ga0070674_100314836
683 Ga0070674_101058691
684 Ga0070673_100028343
685 Ga0070673_100738006
686 Ga0070688_100260239
687 Ga0070659_100008138
688 Ga0070659_100012596
689 Ga0070667_100136760
690 Ga0070667_100453870
691 Ga0070709_10002192
692 Ga0070709_10277264
693 Ga0070709_10411056
694 Ga0070709_10628032
695 Ga0070709_10802792
696 Ga0070714_100464839
697 Ga0070714_100709618
698 Ga0070713_100005287
699 Ga0070710_10009906
700 Ga0070710_10968118
701 Ga0070710_11543522
702 Ga0070711_100006406
703 Ga0070711_101356575
704 Ga0070711_101801056
705 Ga0070700_100038154
706 Ga0070700_100043751
707 Ga0070694_100003556
708 Ga0070694_100292192
709 Ga0070694_101778433
710 Ga0070708_100139326
711 Ga0070708_100187257
712 Ga0070708_100299124
713 Ga0070708_100573032
714 Ga0070663_100015206
715 Ga0070678_101015405
716 Ga0070662_100023823
717 Ga0070681_10093349
718 Ga0068867_100091584
719 Ga0068867_100122396
720 Ga0068867_100135862
721 Ga0068867_100454600
722 Ga0068867_100696359
723 Ga0070685_10029782
724 Ga0070706_100419250
725 Ga0070706_100766023
726 Ga0070707_100814106
727 Ga0070707_102331088
728 Ga0070698_100043341
729 Ga0070699_100193745
730 Ga0070699_100277744
731 Ga0070699_101567642
732 Ga0070679_100020989
733 Ga0070684_100019666
734 Ga0070684_100148836
735 Ga0070684_100358884
736 Ga0070684_100621937
737 Ga0070697_100120726
738 Ga0070697_100146076
739 Ga0070697_100929028
740 Ga0068853_100303279
741 Ga0070672_100010482
742 Ga0070672_100030978
743 Ga0070672_100092254
744 Ga0070672_100099865
745 Ga0070686_100121019
746 Ga0070695_100010916
747 Ga0070696_100264612
748 Ga0070696_100421246
749 Ga0070693_100568584
750 Ga0070665_100010959
751 Ga0070665_100040145
752 Ga0070665_100090545
753 Ga0070665_100376510
754 Ga0070665_101437613
755 Ga0070704_100282072
756 Ga0070704_100355400
757 Ga0070704_100545587
758 Ga0068855_100458380
759 Ga0068855_101812412
760 Ga0068855_102506263
761 Ga0070664_100046376
762 Ga0070664_100048841
763 Ga0070664_100236856
764 Ga0068857_100001626
765 Ga0068857_100039807
766 Ga0068857_100398504
767 Ga0068854_100054816
768 Ga0068854_100288693
769 Ga0068854_101894738
770 Ga0068856_100244885
771 Ga0068852_100005183
772 Ga0068859_100059940
773 Ga0068859_100212230
774 Ga0068859_100378054
775 Ga0068859_102332141
776 Ga0068864_100268554
777 Ga0068864_100325709
778 Ga0068864_100345730
779 Ga0068864_101057210
780 Ga0068866_11056260
781 Ga0068861_100001250
782 Ga0068861_100060638
783 Ga0068861_100704678
784 Ga0068851_10028199
785 Ga0068851_10144993
786 Ga0068870_10008485
787 Ga0068863_100006527
788 Ga0068863_100100043
789 Ga0068863_100431155
790 Ga0068863_100833749
791 Ga0068858_100007580
792 Ga0068858_100343230
793 Ga0068858_100364222
794 Ga0068858_100744411
795 Ga0068858_100814989
796 Ga0068860_100043775
797 Ga0068860_100177472
798 Ga0068860_100399951
799 Ga0068862_100020253
800 Ga0068862_100317929
801 Ga0068862_101033932
802 Ga0081455_10343461
803 Ga0081538_10010385
804 Ga0070717_10203984
805 Ga0070715_11068368
806 Ga0070716_100002029
807 Ga0070716_100011053
808 Ga0070712_100000397
809 Ga0070712_100091510
810 Ga0070712_100150632
811 Ga0070712_101679096
812 Ga0097621_100014992
813 Ga0097621_100139860
814 Ga0097621_100331550
815 Ga0068871_100009482
816 Ga0068871_100020709
817 Ga0075428_100094655
818 Ga0075428_100505006
819 Ga0075430_100197914
820 Ga0075430_100656751
821 Ga0075431_100009772
822 Ga0075431_100011776
823 Ga0075431_100068200
824 Ga0075431_100120507
825 Ga0075431_100476220
826 Ga0075431_100691056
827 Ga0075431_100720934
828 Ga0075431_102186857
829 Ga0075433_10005549
830 Ga0075433_10015035
831 Ga0075433_10129789
832 Ga0075433_10143950
833 Ga0075433_10245678
834 Ga0075433_10454359
835 Ga0075434_100002635
836 Ga0075434_100002849
837 Ga0075434_100034731
838 Ga0075434_100096574
839 Ga0075434_100671778
840 Ga0075429_100005412
841 Ga0075429_100044359
842 Ga0075429_100127649
843 Ga0075429_100179781
844 Ga0075429_100343257
845 Ga0068865_100011263
846 Ga0068865_100016404
847 Ga0068865_102172305
848 Ga0075436_100255397
849 Ga0075436_100592258
850 Ga0097620_100059943
851 Ga0097620_100212226
852 Ga0097620_100378068
853 Ga0097620_102331612
854 Ga0075435_100036588
855 Ga0075435_100187792
856 Ga0075435_100419832
857 Ga0075435_100606553
858 Ga0099794_10043130
859 Ga0105250_10280358
860 Ga0111539_10159017
861 Ga0111539_12050946
862 Ga0105245_10007325
863 Ga0105245_10205910
864 Ga0105245_11168886
865 Ga0105247_10503272
866 Ga0114129_10005584
867 Ga0114129_10026566
868 Ga0114129_10034555
869 Ga0114129_10089001
870 Ga0114129_10101321
871 Ga0114129_10129989
872 Ga0114129_10171378
873 Ga0114129_10385087
874 Ga0114129_10940145
875 Ga0114129_11118056
876 Ga0114129_11181968
877 Ga0114129_13320978
878 Ga0105243_11150090
879 Ga0105241_10271315
880 Ga0105241_10709653
881 Ga0105242_10006285
882 Ga0105242_10006561
883 Ga0105242_10015193
884 Ga0105242_10373983
885 Ga0105248_10020428
886 Ga0105248_10045687
887 Ga0105248_10376702
888 Ga0105248_11065805
889 Ga0105248_12939766
890 Ga0105237_10055382
891 Ga0105237_10410040
892 Ga0105237_11101307
893 Ga0105238_10361194
894 Ga0105238_11366390
895 Ga0105249_10001997
896 Ga0105239_10151218
897 Ga0105239_10361896
898 Ga0105239_10435209
899 Ga0105246_11713307
900 Ga0157373_10222307
901 Ga0157373_11072980
902 Ga0157371_10127256
903 Ga0157369_10292731
904 Ga0157374_10036586
905 Ga0157374_10036723
906 Ga0157374_10056985
907 Ga0157374_11979746
908 Ga0157378_10014491
909 Ga0157378_10045300
910 Ga0157378_10050088
911 Ga0157378_10420469
912 Ga0163162_10002300
913 Ga0163162_10282982
914 Ga0163162_12350683
915 Ga0163162_12963097
916 Ga0157372_10895933
917 Ga0157375_10049536
918 Ga0157375_10292383
919 Ga0157375_10382001
920 Ga0157375_10982028
921 Ga0157375_11225572
922 Ga0157375_13609319
923 Ga0163163_10129833
924 Ga0163163_10493996
925 Ga0163163_10600450
926 Ga0157380_10006591
927 Ga0157377_10471013
928 Ga0157379_10031370
929 Ga0157379_10050728
930 Ga0157376_10007113
931 Ga0157376_10020881
932 Ga0207697_10005536
933 Ga0207697_10149033
934 Ga0207697_10246214
935 Ga0207692_10004197
936 Ga0207692_10407728
937 Ga0207642_10084606
938 Ga0207688_10031328
939 Ga0207680_10038211
940 Ga0207647_10103196
941 Ga0207685_10127913
942 Ga0207685_10385634
943 Ga0207699_10000395
944 Ga0207699_10241976
945 Ga0207699_10332008
946 Ga0207645_10003441
947 Ga0207645_10255862
948 Ga0207645_10289077
949 Ga0207705_10163234
950 Ga0207654_10517800
951 Ga0207707_10125626
952 Ga0207693_10000033
953 Ga0207693_10124648
954 Ga0207663_10083452
955 Ga0207660_10009757
956 Ga0207662_10004311
957 Ga0207657_10007318
958 Ga0207649_10023399
959 Ga0207649_10061055
960 Ga0207649_10164762
961 Ga0207652_10331925
962 Ga0207646_10625053
963 Ga0207646_10706360
964 Ga0207646_10871786
965 Ga0207681_10010680
966 Ga0207681_10141453
967 Ga0207681_10390654
968 Ga0207650_10111003
969 Ga0207650_10140124
970 Ga0207659_10035245
971 Ga0207659_10063814
972 Ga0207687_10076571
973 Ga0207700_10004391
974 Ga0207700_10017861
975 Ga0207664_10525546
976 Ga0207644_10696163
977 Ga0207690_10385151
978 Ga0207706_10002234
979 Ga0207706_10282560
980 Ga0207686_10038718
981 Ga0207686_10186536
982 Ga0207686_10923362
983 Ga0207670_10040850
984 Ga0207670_10962244
985 Ga0207669_10039323
986 Ga0207669_10502294
987 Ga0207669_10950485
988 Ga0207669_11114735
989 Ga0207704_10156224
990 Ga0207665_10000736
991 Ga0207665_10045384
992 Ga0207691_10006026
993 Ga0207691_10007102
994 Ga0207691_10062256
995 Ga0207691_10248474
996 Ga0207711_10208576
997 Ga0207711_10307435
998 Ga0207689_10001946
999 Ga0207689_10071435
1000 Ga0207689_10291452
1001 Ga0207661_10491841
1002 Ga0207661_11043246
1003 Ga0207679_10008305
1004 Ga0207679_10041799
1005 Ga0207679_10053007
1006 Ga0207667_10390924
1007 Ga0207667_11695191
1008 Ga0207651_10162101
1009 Ga0207651_10595188
1010 Ga0207712_10006939
1011 Ga0207668_10036165
1012 Ga0207668_10952863
1013 Ga0207640_10016116
1014 Ga0207658_10165100
1015 Ga0207677_10053984
1016 Ga0207677_10274664
1017 Ga0207677_10377368
1018 Ga0207703_10143645
1019 Ga0207703_10500801
1020 Ga0207703_11109926
1021 Ga0207678_10027550
1022 Ga0207708_10022063
1023 Ga0207641_10059027
1024 Ga0207641_10304436
1025 Ga0207641_10403477
1026 Ga0207641_10606761
1027 Ga0207641_10777680
1028 Ga0207648_10032139
1029 Ga0207648_10496898
1030 Ga0207676_10411575
1031 Ga0207676_10871843
1032 Ga0207674_10010447
1033 Ga0207674_10047656
1034 Ga0207675_100000209
1035 Ga0207675_100790598
1036 Ga0207683_10068203
1037 Ga0207698_10070872
1038 Ga0209995_1044576
1039 Ga0209968_1064893
1040 Ga0209999_1087404
1041 Ga0209588_1055167
1042 Ga0209971_1022557
1043 Ga0207428_10338087
1044 Ga0268266_10000490
1045 Ga0268266_10020801
1046 Ga0268266_10116620
1047 Ga0268266_10234144
1048 Ga0268266_10284766
1049 Ga0268266_10912185
1050 Ga0268265_10020625
1051 Ga0268265_10033237
1052 Ga0268264_10026974
1053 Ga0268264_10690959
1054 Ga0268264_11220833
1055 Ga0268264_11587572
1056 Ga0307408_100059995
1057 Ga0307408_100397625
1058 Ga0307405_10103747
1059 Ga0307405_10112359
1060 Ga0307405_10253411
1061 Ga0307413_10043498
1062 Ga0307413_10051952
1063 Ga0307413_10693160
1064 Ga0307413_11164705
1065 Ga0307410_10001136
1066 Ga0307410_10094319
1067 Ga0307410_10118745
1068 Ga0307410_10188471
1069 Ga0307410_10258959
1070 Ga0307406_10055791
1071 Ga0307406_11047751
1072 Ga0307407_10017952
1073 Ga0307407_10504775
1074 Ga0307412_11224839
1075 Ga0307409_100235994
1076 Ga0307409_100239745
1077 Ga0307409_100856487
1078 Ga0307409_101076422
1079 Ga0307416_100002534
1080 Ga0307416_100083428
1081 Ga0307416_100104570
1082 Ga0307416_100122064
1083 Ga0307416_101060753
1084 Ga0307416_103886019
1085 Ga0307414_10060255
1086 Ga0307414_10452714
1087 Ga0307414_11797336
1088 Ga0307411_10012291
1089 Ga0307411_10294493
1090 Ga0307411_10759279
1091 Ga0307411_11934978
1092 Ga0307415_100276937
1093 Ga0307415_100539099
1094 Ga0307415_102035863
1095 Ga0373940_0317014
1096 Ga0373932_0344052
1097 Ga0373941_0054175
1098 Ga0373924_0068511
1099 Ga0373931_0085868
1100 Ga0373931_0447657
1101 Ga0373935_0642039
1102 Ga0373935_1027309
1103 Ga0373947_0844145
1104 Ga0373937_0035715
1105 Ga0395900_0113229
1106 Ga0395905_0035026
1107 Ga0395905_0071859
1108 Ga0395905_0073308
1109 Ga0395905_0348413
1110 Ga0395905_0601916
1111 Ga0395905_1033588
1112 Ga0395901_2157821
1113 Ga0451839_0855377
1114 Ga0439433_0178829
1115 Ga0439448_0022998
1116 Ga0439448_0119035
1117 Ga0439455_0141913
1118 Ga0450920_108128
1119 Ga0450923_136118
1120 Ga0450891_033840
1121 Ga0450894_040867
1122 Ga0450898_001005
1123 Ga0450898_047147
1124 Ga0450910_012142
1125 Ga0439446_0065941
1126 Ga0439435_0136283
1127 Ga0451577_0328879
1128 Ga0453683_0934207
1129 Ga0453684_1267320
1130 Ga0466960_1044516
1131 Ga0451576_0029704
1132 Ga0451576_0790414
1133 Ga0451576_0847438
1134 Ga0495603_0302588
1135 Ga0495590_0130089
1136 Ga0495580_0390450
1137 Ga0495639_0210912
1138 Ga0495640_0058955
1139 Ga0495647_0072542
1140 Ga0495647_0154990
1141 Ga0495658_0386457
1142 Ga0495624_0413844
1143 Ga0496101_1435378
1144 Ga0496102_1065979
1145 Ga0496102_1169281
1146 Ga0496102_1262184
1147 Ga0496104_0224382
1148 Ga0496107_0163204
1149 Ga0496107_0750802
1150 Ga0496115_0102598
1151 Ga0496115_0444166
1152 Ga0496115_0871379
1153 Ga0496115_1348266
1154 Ga0501296_004630
1155 Ga0501299_016808
1156 Ga0501031_0062341
1157 Ga0501031_0154831
1158 Ga0501031_0174126
1159 Ga0501036_0031838
1160 Ga0501036_0436605
1161 Ga0501036_0603826
1162 Ga0501039_0143637
1163 Ga0501040_0256630
1164 Ga0501040_0735048
1165 Ga0501041_0009638
1166 Ga0501041_0092452
1167 Ga0501042_0142489
1168 Ga0501042_0446431
1169 Ga0501067_0091835
1170 Ga0501068_0234740
1171 Ga0501069_0017036
1172 Ga0501070_0069168
1173 Ga0501071_0034045
1174 Ga0501071_0185123
1175 Ga0501072_0058832
1176 Ga0501074_1184923
1177 Ga0501075_0100711
1178 Ga0501075_0300661
1179 Ga0501075_0954853
1180 Ga0501075_1082544
1181 Ga0501076_0011562
1182 Ga0501076_0885091
1183 Ga0501077_0000625
1184 Ga0501077_0112067
1185 Ga0501201_018636
1186 Ga0501216_027401
1187 Ga0501235_022072
1188 Ga0501239_009652
1189 Ga0501243_006193
1190 Ga0501246_039438
1191 Ga0501248_027322
1192 Ga0501249_013688
1193 Ga0501259_034162
1194 Ga0501259_066292
1195 Ga0501221_114472
1196 Ga0501079_0012479
1197 Ga0501080_0049489
1198 Ga0501080_0937415
1199 Ga0501081_0064621
1200 Ga0501272_005048
1201 Ga0501273_000267
1202 Ga0501275_013710
1203 Ga0501035_1096801
1204 Ga0501045_0008186
1205 Ga0501045_0018723
1206 Ga0501045_0478837
1207 nmdc:mga05p37_248560_c1
1208 nmdc:mga05p37_25032_c1
1209 nmdc:mga05p37_289555_c1
1210 nmdc:mga05p37_34983_c1
1211 nmdc:mga05p37_351478_c1
1212 nmdc:mga05p37_36873_c2
1213 nmdc:mga05p37_601296_c1
1214 nmdc:mga05p37_69114_c1
1215 nmdc:mga05p37_892606_c1
1216 nmdc:mga05p37_972566_c1
1217 nmdc:mga09592_121748_c1
1218 nmdc:mga09592_25873_c1
1219 nmdc:mga09592_47371_c1
1220 nmdc:mga09592_821418_c1
1221 nmdc:mga0qj67_721883_c1
1222 nmdc:mga0qj67_7450_c1
1223 nmdc:mga0qj67_90715_c1
1224 nmdc:mga06r32_139553_c1
1225 nmdc:mga06r32_1546475_c1
1226 nmdc:mga06r32_2053996_c1
1227 nmdc:mga06r32_22845_c1
1228 nmdc:mga06r32_31599_c1
1229 nmdc:mga06r32_530194_c1
1230 nmdc:mga06r32_62418_c1
1231 nmdc:mga06r32_65214_c1
1232 nmdc:mga06r32_793491_c1
1233 nmdc:mga08y16_1698837_c1
1234 nmdc:mga0n895_133336_c1
1235 nmdc:mga0n895_1864_c1
1236 nmdc:mga0n895_4637_c1
1237 nmdc:mga0n895_53518_c1
1238 nmdc:mga0rr50_1486610_c1
1239 nmdc:mga0rr50_230790_c1
1240 nmdc:mga0rr50_394476_c1
1241 nmdc:mga0rr50_56434_c1
1242 nmdc:mga0rr50_580316_c1
1243 nmdc:mga0rr50_798649_c1
1244 nmdc:mga08x19_1055859_c1
1245 nmdc:mga08x19_603536_c1
1246 nmdc:mga08x19_729940_c1
1247 nmdc:mga0a205_136551_c1
1248 nmdc:mga0a205_182669_c1
1249 nmdc:mga0a205_39616_c1
1250 nmdc:mga0a205_431478_c1
1251 nmdc:mga0a205_5302_c1
1252 nmdc:mga0a205_69322_c1
1253 nmdc:mga0a205_72357_c1
1254 nmdc:mga0a205_89907_c1
1255 Ga0495601_1031877
1256 Ga0495612_0276758
1257 Ga0501084_0174476
1258 Ga0501084_0709257
1259 Ga0590071_002274
1260 Ga0590071_008954
1261 Ga0590071_010410
1262 Ga0590071_020991
1263 Ga0590075_031921
1264 Ga0590077_003787
1265 Ga0590077_019119
1266 Ga0501082_0082619
1267 Ga0501082_0407285
1268 Ga0501082_1259293

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02311

AraC_binding

AraC-like ligand binding domain

36

102

0.95

PF07883

Cupin_2

Cupin domain

33

90

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fah-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans a85h mutant 0.9425 27 103
3nst-assembly1.cif.gz_A crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans 0.9422 27 103
4fag-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant in complex with gentisate 0.9418 27 103
3nw4-assembly1.cif.gz_A crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans in complex with gentisate 0.9391 27 103
2oa2-assembly1.cif.gz_A-2 crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution 0.9353 28 106
ID Description Score Start End Superfamily
3nvcA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9415 27 103 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9344 26 100 2.60.120.10
af_F1LVA4_66_267_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9276 27 110 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9254 27 110 2.60.120.10
4e2gD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.923 26 104 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2V9W3Z9-F1-model_v4 Cupin domain-containing protein 0.9966 1 110
AF-A0A2V8EP27-F1-model_v4 Cupin type-2 domain-containing protein 0.9944 1 110
AF-A0A1G7MWA7-F1-model_v4 Cupin domain-containing protein 0.9941 1 110
AF-A0A2W0BMR1-F1-model_v4 Cupin type-2 domain-containing protein 0.9927 1 110
AF-A0A2V6D631-F1-model_v4 Cupin domain-containing protein 0.9923 30 110

Map