F471111

General Info

Members Datasets Scaffolds Average Seq Length
633 364 628 283

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_0037412|Ga0496106_0037412_899_1861
Length 320
Sequence LARRDGWPAGGSGLASLPAPPSVYESVDGRRRATMLTILFDGIAYGMLLFVLACGLSVTLGLMNFVNLAHGAFAMAGGYITLVLVNRGGVPFAAGLAIAFVVTALIGVLLERTLYVHVYGKSPLEQVLFTIGLVFMSVAAVDYVMGSQQVFIQIPSVLEGRFEIFGIGIGRYRLLIIVICGLLTLALQMTLSNTRFGSRLRASVDDARVARGLGINVNAVFTLTFAVGSGLAGLGGALGAEILGLDPTFPLKYMVYFLIVVTVGGTSSITGPFAASLVIGIADVAGKYYVPKFGAFVIYTIMIIVLILRPQGLFARAAGR

Samples

Sample ID Description Type Environment
1 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
2 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
3 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
4 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
5 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
118 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
120 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
181 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
183 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
184 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
195 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
196 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
200 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
204 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
207 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
208 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
209 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
210 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
218 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
224 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
225 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
226 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
227 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
228 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
229 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
230 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
231 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
232 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
233 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
238 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
239 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
240 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
251 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
252 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
253 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
254 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
255 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
256 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
260 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
261 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
262 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
263 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
264 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
265 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
266 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
267 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
268 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
269 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
270 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
271 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
272 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
273 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
274 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
275 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
276 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
277 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
278 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
279 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
280 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
281 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
282 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
283 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
284 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
285 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
286 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
287 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
288 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
289 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
290 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
291 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
292 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
293 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
294 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
295 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
296 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
299 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
307 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
308 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
309 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
310 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
311 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
312 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
313 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
314 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
315 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
316 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
317 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
318 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
319 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
327 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
328 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
329 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
330 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
331 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
332 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
333 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
335 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
336 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
337 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
338 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
339 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
340 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
341 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
342 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
343 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
344 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
345 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
346 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
347 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
348 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
349 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
350 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
351 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
352 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
353 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
354 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
355 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
356 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
357 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
358 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
359 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
360 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
361 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
362 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
363 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
364 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0.16
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.11
Nodule 0.32
Rhizoplane 6.64
Rhizosphere 79.15
Stem 0
Stem Tuber 0
Unclassified 3.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000708 3300002739 Bacteria 6453
2 JGI25152J39213_1006388 3300002773 Bacteria 3230
3 JGI25152J39213_1008113 3300002773 Bacteria 2639
4 JGI25152J39213_1010246 3300002773 Bacteria 2161
5 JGI25150J39212_1006776 3300002774 Bacteria 2340
6 JGI25159J45721_1000233 3300002987 Bacteria 26229
7 JGI25406J46586_10037443 3300003203 Bacteria 1748
8 JGI25153J46596_10009427 3300003215 Bacteria 4538
9 JGI25153J46596_10012455 3300003215 Bacteria 3668
10 JGI25160J50197_1004561 3300003354 Bacteria 5966
11 JGI25161J50226_1000079 3300003374 Bacteria 83375
12 Ga0055526_1000231 3300003771 Bacteria 46760
13 Ga0055526_1003394 3300003771 Bacteria 10136
14 Ga0055524_1001230 3300003775 Bacteria 15132
15 Ga0055540_1004428 3300003792 Bacteria 6338
16 Ga0058692_1000687 3300003856 Bacteria 13920
17 Ga0058692_1012959 3300003856 Bacteria 1956
18 Ga0055543_1000031 3300004625 Bacteria 130583
19 Ga0065165_1013656 3300005262 Bacteria 3212
20 Ga0070658_10516307 3300005327 Bacteria 1033
21 Ga0070676_10001102 3300005328 Bacteria 13494
22 Ga0070676_10200924 3300005328 Bacteria 1307
23 Ga0070670_100002568 3300005331 Bacteria 15005
24 Ga0070670_100005641 3300005331 Bacteria 10561
25 Ga0070670_100158384 3300005331 Bacteria 1962
26 Ga0070677_10008646 3300005333 Bacteria 3433
27 Ga0068869_100000152 3300005334 Bacteria 34316
28 Ga0068869_100037437 3300005334 Bacteria 3449
29 Ga0070666_10017401 3300005335 Bacteria 4607
30 Ga0070682_100341303 3300005337 Bacteria 1113
31 Ga0070660_100197583 3300005339 Bacteria 1631
32 Ga0070689_100085509 3300005340 Bacteria 2480
33 Ga0070689_100426000 3300005340 Bacteria 1125
34 Ga0070691_10074316 3300005341 Bacteria 1654
35 Ga0070687_100012742 3300005343 Bacteria 3722
36 Ga0070668_100002160 3300005347 Bacteria 14394
37 Ga0070668_100003108 3300005347 Bacteria 12256
38 Ga0070668_100120494 3300005347 Bacteria 2096
39 Ga0070669_100004064 3300005353 Bacteria 10590
40 Ga0070669_100020654 3300005353 Bacteria 4704
41 Ga0070669_100135810 3300005353 Bacteria 1891
42 Ga0070675_100271435 3300005354 Bacteria 1488
43 Ga0070671_100000803 3300005355 Bacteria 22698
44 Ga0070671_100163002 3300005355 Bacteria 1884
45 Ga0070674_100000274 3300005356 Bacteria 25095
46 Ga0070674_100015585 3300005356 Bacteria 4749
47 Ga0070674_100023054 3300005356 Bacteria 4022
48 Ga0070673_100035055 3300005364 Bacteria 3803
49 Ga0070673_100141932 3300005364 Bacteria 2027
50 Ga0070667_100002820 3300005367 Bacteria 14999
51 Ga0070667_100027156 3300005367 Bacteria 4764
52 Ga0070667_100126214 3300005367 Bacteria 2230
53 Ga0070667_100481237 3300005367 Bacteria 1136
54 Ga0070709_10113379 3300005434 Bacteria 1826
55 Ga0070714_100007015 3300005435 Bacteria 8732
56 Ga0070714_100237339 3300005435 Bacteria 1682
57 Ga0070713_100066957 3300005436 Bacteria 3022
58 Ga0070701_10101595 3300005438 Bacteria 1594
59 Ga0070708_100068532 3300005445 Bacteria 3189
60 Ga0070663_100139203 3300005455 Bacteria 1851
61 Ga0070678_100003193 3300005456 Bacteria 9096
62 Ga0070678_100367367 3300005456 Bacteria 1241
63 Ga0070662_100069348 3300005457 Bacteria 2594
64 Ga0068867_100001459 3300005459 Bacteria 16391
65 Ga0068867_100015097 3300005459 Bacteria 5476
66 Ga0068867_100046200 3300005459 Bacteria 3197
67 Ga0068867_100417150 3300005459 Bacteria 1136
68 Ga0070685_10015815 3300005466 Bacteria 4011
69 Ga0070699_100055573 3300005518 Bacteria 3427
70 Ga0070684_100068444 3300005535 Bacteria 3120
71 Ga0070697_100288301 3300005536 Bacteria 1410
72 Ga0068853_100008837 3300005539 Bacteria 8104
73 Ga0068853_100033048 3300005539 Bacteria 4386
74 Ga0070672_100000202 3300005543 Bacteria 32978
75 Ga0070672_100078159 3300005543 Bacteria 2647
76 Ga0070672_100259984 3300005543 Bacteria 1464
77 Ga0070695_100044773 3300005545 Bacteria 2819
78 Ga0070665_100000982 3300005548 Bacteria 36142
79 Ga0070665_100224300 3300005548 Bacteria 1880
80 Ga0070665_100231409 3300005548 Bacteria 1848
81 Ga0070704_100108511 3300005549 Bacteria 2108
82 Ga0070664_100056757 3300005564 Bacteria 3327
83 Ga0068857_100014270 3300005577 Bacteria 6922
84 Ga0068857_100643060 3300005577 Bacteria 1005
85 Ga0068854_100130973 3300005578 Bacteria 1915
86 Ga0068854_100199582 3300005578 Bacteria 1572
87 Ga0070702_100024230 3300005615 Bacteria 3235
88 Ga0068852_100002427 3300005616 Bacteria 12829
89 Ga0068859_100068581 3300005617 Bacteria 3581
90 Ga0068859_100139254 3300005617 Bacteria 2500
91 Ga0068859_100253316 3300005617 Bacteria 1851
92 Ga0068864_100003353 3300005618 Bacteria 13243
93 Ga0068864_100017389 3300005618 Bacteria 5996
94 Ga0068864_100158740 3300005618 Bacteria 2054
95 Ga0068861_100021528 3300005719 Bacteria 4634
96 Ga0068861_100047283 3300005719 Bacteria 3247
97 Ga0068851_10043974 3300005834 Bacteria 2253
98 Ga0068870_10004685 3300005840 Bacteria 5908
99 Ga0068863_100000894 3300005841 Bacteria 30053
100 Ga0068863_100030297 3300005841 Bacteria 5168
101 Ga0068863_100199696 3300005841 Bacteria 1923
102 Ga0068858_100042333 3300005842 Bacteria 4223
103 Ga0068858_100161103 3300005842 Bacteria 2112
104 Ga0068858_100420897 3300005842 Bacteria 1285
105 Ga0068860_100008238 3300005843 Bacteria 10374
106 Ga0068860_100038831 3300005843 Bacteria 4555
107 Ga0068860_100169022 3300005843 Bacteria 2111
108 Ga0068862_100001435 3300005844 Bacteria 22006
109 Ga0068862_100012376 3300005844 Bacteria 7054
110 Ga0068862_100171736 3300005844 Bacteria 1941
111 Ga0081455_10014294 3300005937 Bacteria 7789
112 Ga0081455_10027925 3300005937 Bacteria 5162
113 Ga0081455_10048549 3300005937 Bacteria 3666
114 Ga0081538_10000697 3300005981 Bacteria 36894
115 Ga0081538_10014451 3300005981 Bacteria 6181
116 Ga0081540_1001984 3300005983 Bacteria 17080
117 Ga0081539_10002187 3300005985 Bacteria 28690
118 Ga0070717_10041594 3300006028 Bacteria 3747
119 Ga0075365_10007019 3300006038 Bacteria 6267
120 Ga0075365_10279633 3300006038 Bacteria 1174
121 Ga0075368_10037922 3300006042 Bacteria 1885
122 Ga0075363_100021301 3300006048 Bacteria 3262
123 Ga0075364_10005843 3300006051 Bacteria 7184
124 Ga0070715_10000633 3300006163 Bacteria 9317
125 Ga0070712_100002594 3300006175 Bacteria 11168
126 Ga0070712_100008343 3300006175 Bacteria 6514
127 Ga0070712_100046579 3300006175 Bacteria 2998
128 Ga0075362_10002160 3300006177 Bacteria 6508
129 Ga0075362_10115924 3300006177 Bacteria 1265
130 Ga0075366_10061453 3300006195 Bacteria 2233
131 Ga0097621_100016521 3300006237 Bacteria 5580
132 Ga0097621_100092828 3300006237 Bacteria 2529
133 Ga0068871_100083825 3300006358 Bacteria 2644
134 Ga0068871_100106999 3300006358 Bacteria 2348
135 Ga0075428_100001309 3300006844 Bacteria 26388
136 Ga0075428_100126415 3300006844 Bacteria 2782
137 Ga0075430_100067822 3300006846 Bacteria 2994
138 Ga0075431_100000481 3300006847 Bacteria 33062
139 Ga0075431_100438732 3300006847 Bacteria 1303
140 Ga0075431_100700148 3300006847 Bacteria 991
141 Ga0075433_10021177 3300006852 Bacteria 5449
142 Ga0075434_100003619 3300006871 Bacteria 13794
143 Ga0075434_100021500 3300006871 Bacteria 6271
144 Ga0075434_100496375 3300006871 Bacteria 1241
145 Ga0075429_100004654 3300006880 Bacteria 11805
146 Ga0075429_100224127 3300006880 Bacteria 1647
147 Ga0068865_100156227 3300006881 Bacteria 1735
148 Ga0097620_100068573 3300006931 Bacteria 3581
149 Ga0097620_100139255 3300006931 Bacteria 2500
150 Ga0097620_100253315 3300006931 Bacteria 1851
151 Ga0075435_100020522 3300007076 Bacteria 5065
152 Ga0099794_10041774 3300007265 Bacteria 2184
153 Ga0105244_10032024 3300009036 Bacteria 2788
154 Ga0105240_10306224 3300009093 Bacteria 1816
155 Ga0111539_10002444 3300009094 Bacteria 24696
156 Ga0111539_10012307 3300009094 Bacteria 10722
157 Ga0111539_10067267 3300009094 Bacteria 4231
158 Ga0111539_10098515 3300009094 Bacteria 3434
159 Ga0111539_10400919 3300009094 Bacteria 1598
160 Ga0111539_10430116 3300009094 Bacteria 1537
161 Ga0111539_11106651 3300009094 Bacteria 920
162 Ga0105245_10063592 3300009098 Bacteria 3332
163 Ga0105247_10006956 3300009101 Bacteria 6965
164 Ga0105247_10069980 3300009101 Bacteria 2191
165 Ga0114129_10001244 3300009147 Bacteria 33939
166 Ga0114129_10265891 3300009147 Bacteria 2296
167 Ga0114129_10494395 3300009147 Bacteria 1598
168 Ga0114129_10729392 3300009147 Bacteria 1271
169 Ga0105243_10143768 3300009148 Bacteria 2038
170 Ga0105243_10227222 3300009148 Bacteria 1653
171 Ga0105243_10302999 3300009148 Bacteria 1449
172 Ga0105248_10028785 3300009177 Bacteria 6192
173 Ga0105248_10883544 3300009177 Bacteria 1009
174 Ga0105248_10889784 3300009177 Bacteria 1005
175 Ga0105238_10102421 3300009551 Bacteria 2845
176 Ga0105246_10184631 3300011119 Bacteria 1609
177 Ga0157370_10144693 3300013104 Bacteria 2214
178 Ga0171462_1027 3300013250 Bacteria 113319
179 Ga0157378_10073746 3300013297 Bacteria 3069
180 Ga0157378_10095706 3300013297 Bacteria 2705
181 Ga0157378_10161676 3300013297 Bacteria 2094
182 Ga0157378_10258259 3300013297 Bacteria 1670
183 Ga0157378_10542255 3300013297 Bacteria 1167
184 Ga0163162_10051729 3300013306 Bacteria 4122
185 Ga0157375_10001479 3300013308 Bacteria 20180
186 Ga0157375_10020299 3300013308 Bacteria 6066
187 Ga0157375_10415128 3300013308 Bacteria 1512
188 Ga0163163_10010522 3300014325 Bacteria 8323
189 Ga0163163_10023407 3300014325 Bacteria 5863
190 Ga0163163_10083633 3300014325 Bacteria 3197
191 Ga0163163_10215798 3300014325 Bacteria 1967
192 Ga0157380_10184102 3300014326 Bacteria 1838
193 Ga0157380_10882148 3300014326 Bacteria 919
194 Ga0157377_10050622 3300014745 Bacteria 2340
195 Ga0157379_10008008 3300014968 Bacteria 9167
196 Ga0157379_10250652 3300014968 Bacteria 1607
197 Ga0157376_10032604 3300014969 Bacteria 4184
198 Ga0157376_10110941 3300014969 Bacteria 2414
199 Ga0163161_10077002 3300017792 Bacteria 2449
200 Ga0163161_10109152 3300017792 Bacteria 2067
201 Ga0213876_10050262 3300021384 Bacteria 2203
202 Ga0213875_10001420 3300021388 Bacteria 15553
203 Ga0209436_100094 3300025208 Bacteria 43814
204 Ga0207425_1001536 3300025245 Bacteria 9473
205 Ga0207425_1021386 3300025245 Bacteria 1372
206 Ga0209129_1000862 3300025258 Bacteria 18900
207 Ga0209129_1007118 3300025258 Bacteria 3412
208 Ga0209673_1033222 3300025273 Bacteria 1577
209 Ga0209130_1000023 3300025284 Bacteria 359355
210 Ga0209025_1014429 3300025294 Bacteria 4855
211 Ga0209564_1000023 3300025295 Bacteria 555102
212 Ga0209564_1003021 3300025295 Bacteria 12012
213 Ga0209758_1000422 3300025297 Bacteria 71804
214 Ga0209758_1005087 3300025297 Bacteria 10411
215 Ga0209758_1046377 3300025297 Bacteria 1568
216 Ga0209758_1047686 3300025297 Bacteria 1530
217 Ga0209256_1000234 3300025299 Bacteria 99080
218 Ga0207426_1000087 3300025302 Bacteria 288870
219 Ga0209051_1005845 3300025303 Bacteria 7076
220 Ga0207682_10001271 3300025893 Bacteria 11579
221 Ga0207682_10005559 3300025893 Bacteria 5128
222 Ga0207710_10065845 3300025900 Bacteria 1652
223 Ga0207710_10146899 3300025900 Bacteria 1142
224 Ga0207688_10006266 3300025901 Bacteria 6477
225 Ga0207688_10010921 3300025901 Bacteria 4941
226 Ga0207680_10010358 3300025903 Bacteria 4662
227 Ga0207647_10044939 3300025904 Bacteria 2758
228 Ga0207645_10000242 3300025907 Bacteria 45222
229 Ga0207645_10039127 3300025907 Bacteria 3039
230 Ga0207645_10089906 3300025907 Bacteria 1975
231 Ga0207643_10006014 3300025908 Bacteria 6486
232 Ga0207643_10023880 3300025908 Bacteria 3373
233 Ga0207643_10164289 3300025908 Bacteria 1337
234 Ga0207705_10260400 3300025909 Bacteria 1324
235 Ga0207684_10011372 3300025910 Bacteria 7790
236 Ga0207654_10277529 3300025911 Bacteria 1132
237 Ga0207671_10488344 3300025914 Bacteria 982
238 Ga0207693_10000855 3300025915 Bacteria 27188
239 Ga0207693_10007507 3300025915 Bacteria 8954
240 Ga0207693_10069366 3300025915 Bacteria 2759
241 Ga0207693_10102320 3300025915 Bacteria 2247
242 Ga0207693_10184416 3300025915 Bacteria 1643
243 Ga0207662_10009537 3300025918 Bacteria 5347
244 Ga0207657_10045501 3300025919 Bacteria 3851
245 Ga0207681_10004880 3300025923 Bacteria 8243
246 Ga0207681_10088247 3300025923 Bacteria 2208
247 Ga0207694_10263094 3300025924 Bacteria 1413
248 Ga0207650_10062197 3300025925 Bacteria 2789
249 Ga0207650_10218648 3300025925 Bacteria 1532
250 Ga0207659_10109731 3300025926 Bacteria 2095
251 Ga0207659_10338537 3300025926 Bacteria 1245
252 Ga0207700_10209837 3300025928 Bacteria 1646
253 Ga0207644_10003418 3300025931 Bacteria 10251
254 Ga0207706_10008768 3300025933 Bacteria 9309
255 Ga0207706_10038152 3300025933 Bacteria 4262
256 Ga0207669_10002721 3300025937 Bacteria 7570
257 Ga0207669_10034073 3300025937 Bacteria 2881
258 Ga0207669_10258778 3300025937 Bacteria 1300
259 Ga0207704_10006650 3300025938 Bacteria 5411
260 Ga0207704_10086677 3300025938 Bacteria 2043
261 Ga0207704_10205458 3300025938 Bacteria 1445
262 Ga0207691_10000084 3300025940 Bacteria 80075
263 Ga0207691_10095536 3300025940 Bacteria 2658
264 Ga0207711_10252352 3300025941 Bacteria 1620
265 Ga0207689_10000946 3300025942 Bacteria 27914
266 Ga0207689_10005950 3300025942 Bacteria 10794
267 Ga0207667_10145792 3300025949 Bacteria 2437
268 Ga0207651_10005933 3300025960 Bacteria 6325
269 Ga0207651_10130394 3300025960 Bacteria 1923
270 Ga0207651_10288740 3300025960 Bacteria 1359
271 Ga0207712_10280986 3300025961 Bacteria 1359
272 Ga0207668_10013196 3300025972 Bacteria 5079
273 Ga0207668_10161101 3300025972 Bacteria 1748
274 Ga0207640_10505692 3300025981 Bacteria 1007
275 Ga0207658_10014338 3300025986 Bacteria 5428
276 Ga0207658_10377136 3300025986 Bacteria 1241
277 Ga0207703_10000292 3300026035 Bacteria 54983
278 Ga0207703_10029948 3300026035 Bacteria 4297
279 Ga0207703_10563959 3300026035 Bacteria 1075
280 Ga0207639_10009290 3300026041 Bacteria 6780
281 Ga0207678_10049460 3300026067 Bacteria 3633
282 Ga0207678_10154229 3300026067 Bacteria 1961
283 Ga0207708_10140114 3300026075 Bacteria 1896
284 Ga0207702_10194210 3300026078 Bacteria 1878
285 Ga0207641_10001732 3300026088 Bacteria 21075
286 Ga0207641_10234444 3300026088 Bacteria 1707
287 Ga0207641_10255903 3300026088 Bacteria 1637
288 Ga0207648_10000840 3300026089 Bacteria 34588
289 Ga0207648_10001002 3300026089 Bacteria 31804
290 Ga0207648_10002006 3300026089 Bacteria 22204
291 Ga0207648_10037903 3300026089 Bacteria 4243
292 Ga0207676_10001008 3300026095 Bacteria 21634
293 Ga0207676_10029108 3300026095 Bacteria 4132
294 Ga0207676_10080947 3300026095 Bacteria 2637
295 Ga0207674_10015916 3300026116 Bacteria 8242
296 Ga0207674_10032353 3300026116 Bacteria 5487
297 Ga0207674_10138180 3300026116 Bacteria 2398
298 Ga0207675_100001191 3300026118 Bacteria 25904
299 Ga0207675_100002492 3300026118 Bacteria 18230
300 Ga0207675_100016216 3300026118 Bacteria 6955
301 Ga0207683_10000003 3300026121 Bacteria 191866
302 Ga0207683_10007445 3300026121 Bacteria 9387
303 Ga0207683_10016614 3300026121 Bacteria 6264
304 Ga0209371_1000064 3300027312 Bacteria 218637
305 Ga0209371_1000163 3300027312 Bacteria 100853
306 Ga0209371_1002971 3300027312 Bacteria 8816
307 Ga0209588_1027072 3300027671 Bacteria 1823
308 Ga0207428_10006807 3300027907 Bacteria 10483
309 Ga0207428_10052817 3300027907 Bacteria 3243
310 Ga0207428_10277303 3300027907 Bacteria 1245
311 Ga0268266_10064760 3300028379 Bacteria 3158
312 Ga0268266_10107834 3300028379 Bacteria 2463
313 Ga0268265_10001824 3300028380 Bacteria 17021
314 Ga0268265_10194524 3300028380 Bacteria 1754
315 Ga0268264_10000854 3300028381 Bacteria 32463
316 Ga0268264_10025144 3300028381 Bacteria 4864
317 Ga0268264_10050111 3300028381 Bacteria 3476
318 Ga0268264_10129119 3300028381 Bacteria 2238
319 Ga0268264_10228348 3300028381 Bacteria 1717
320 Ga0307515_10011947 3300028794 Bacteria 16402
321 Ga0307515_10106705 3300028794 Bacteria 3319
322 Ga0265338_10009857 3300028800 Bacteria 11314
323 Ga0268256_1000028 3300030500 Bacteria 433179
324 Ga0268256_1002480 3300030500 Bacteria 9372
325 Ga0265762_1012367 3300030760 Bacteria 1531
326 Ga0265325_10014195 3300031241 Bacteria 4509
327 Ga0265329_10021321 3300031242 Bacteria 2177
328 Ga0265340_10050215 3300031247 Bacteria 2024
329 Ga0265339_10000067 3300031249 Bacteria 91730
330 Ga0265339_10069992 3300031249 Bacteria 1872
331 Ga0265339_10152998 3300031249 Bacteria 1165
332 Ga0265316_10057397 3300031344 Bacteria 3036
333 Ga0265316_10302160 3300031344 Bacteria 1165
334 Ga0307513_10291226 3300031456 Bacteria 1404
335 Ga0307408_100341803 3300031548 Bacteria 1267
336 Ga0265313_10000054 3300031595 Bacteria 110199
337 Ga0265314_10014038 3300031711 Bacteria 6436
338 Ga0307409_100252442 3300031995 Bacteria 1613
339 Ga0307414_10318480 3300032004 Bacteria 1323
340 Ga0307411_10197171 3300032005 Bacteria 1543
341 Ga0307411_10288430 3300032005 Bacteria 1310
342 Ga0373930_0033775 3300034816 Bacteria 1063
343 Ga0373934_0000167 3300035086 Bacteria 23997
344 Ga0373934_0011751 3300035086 Bacteria 3298
345 Ga0373934_0026423 3300035086 Bacteria 2252
346 Ga0373944_0012413 3300035089 Bacteria 2347
347 Ga0373923_0056335 3300035111 Bacteria 1659
348 Ga0373936_0006658 3300035113 Bacteria 4350
349 Ga0373945_0000969 3300035116 Bacteria 8556
350 Ga0373945_0006884 3300035116 Bacteria 3675
351 Ga0373953_0135373 3300035117 Bacteria 1052
352 Ga0373954_0003678 3300035118 Bacteria 6531
353 Ga0373954_0042470 3300035118 Bacteria 2120
354 Ga0373954_0063796 3300035118 Bacteria 1741
355 Ga0373956_0000005 3300035119 Bacteria 69067
356 Ga0373956_0017636 3300035119 Bacteria 3012
357 Ga0373957_0001547 3300035120 Bacteria 6270
358 Ga0373960_0090861 3300035121 Bacteria 976
359 Ga0373943_0000185 3300035170 Bacteria 24985
360 Ga0373943_0029216 3300035170 Bacteria 2604
361 Ga0373946_0000642 3300035171 Bacteria 11673
362 Ga0373946_0020381 3300035171 Bacteria 2562
363 Ga0373946_0053302 3300035171 Bacteria 1698
364 Ga0373955_0001424 3300035172 Bacteria 10177
365 Ga0373955_0002275 3300035172 Bacteria 8339
366 Ga0373955_0021411 3300035172 Bacteria 3263
367 Ga0373955_0094832 3300035172 Bacteria 1706
368 Ga0373942_0003621 3300035207 Bacteria 3623
369 Ga0373962_0061586 3300035242 Bacteria 1103
370 Ga0373924_0017153 3300035410 Bacteria 2774
371 Ga0373924_0024311 3300035410 Bacteria 2386
372 Ga0373924_0035283 3300035410 Bacteria 2028
373 Ga0373931_0145414 3300035691 Bacteria 1377
374 Ga0373927_0000434 3300035695 Bacteria 32038
375 Ga0373927_0041103 3300035695 Bacteria 2999
376 Ga0373927_0088315 3300035695 Bacteria 2012
377 Ga0373933_0000447 3300035724 Bacteria 25787
378 Ga0373933_0000883 3300035724 Bacteria 18320
379 Ga0373933_0003022 3300035724 Bacteria 9384
380 Ga0373947_0000583 3300035725 Bacteria 21422
381 Ga0373947_0019759 3300035725 Bacteria 3886
382 Ga0373937_0000912 3300036401 Bacteria 25128
383 Ga0373937_0004251 3300036401 Bacteria 12135
384 Ga0373937_0009273 3300036401 Bacteria 8543
385 Ga0373925_0328633 3300037068 Bacteria 1238
386 Ga0373925_0368428 3300037068 Bacteria 1168
387 Ga0395899_0264174 3300037312 Bacteria 1176
388 Ga0395900_0334282 3300037418 Bacteria 1492
389 Ga0395898_0109219 3300037466 Bacteria 2652
390 Ga0436364_0125248 3300037853 Bacteria 2636
391 Ga0436364_1334518 3300037853 Bacteria 1662
392 Ga0395901_0083724 3300038443 Bacteria 3334
393 Ga0395901_0461538 3300038443 Bacteria 1298
394 Ga0436365_0523999 3300039437 Bacteria 2674
395 Ga0436365_1280225 3300039437 Bacteria 1081
396 Ga0436361_0089618 3300039447 Bacteria 1028
397 Ga0436361_1189219 3300039447 Bacteria 3567
398 Ga0436362_0430762 3300039453 Bacteria 3666
399 Ga0439453_0008905 3300041408 Bacteria 1623
400 Ga0439465_0004447 3300041413 Bacteria 4537
401 Ga0439465_0017288 3300041413 Bacteria 2251
402 Ga0451853_2675021 3300041512 Bacteria 1600
403 Ga0439443_003461 3300042003 Bacteria 1990
404 Ga0439452_026510 3300042010 Bacteria 1462
405 Ga0439462_0010941 3300042015 Bacteria 2305
406 Ga0439462_0032598 3300042015 Bacteria 1381
407 Ga0439446_0052905 3300042156 Bacteria 1216
408 Ga0439435_0029550 3300042436 Bacteria 1480
409 Ga0466966_0162429 3300044684 Bacteria 1360
410 Ga0466963_0053084 3300044694 Bacteria 2691
411 Ga0466963_0150527 3300044694 Bacteria 1615
412 Ga0453684_0386395 3300044712 Bacteria 1571
413 Ga0466967_0138012 3300045976 Bacteria 2269
414 Ga0495617_033101 3300046452 Bacteria 1735
415 Ga0495627_021698 3300046453 Bacteria 2125
416 Ga0495592_0002231 3300046454 Bacteria 13664
417 Ga0495603_0069424 3300046455 Bacteria 2072
418 Ga0495629_0016538 3300046459 Bacteria 5295
419 Ga0495638_0016019 3300046460 Bacteria 5024
420 Ga0495651_0000479 3300046462 Bacteria 30785
421 Ga0495651_0000878 3300046462 Bacteria 23362
422 Ga0495653_0000553 3300046463 Bacteria 28588
423 Ga0495653_0039412 3300046463 Bacteria 3701
424 Ga0495582_0037901 3300046473 Bacteria 2652
425 Ga0495605_0089502 3300046474 Bacteria 1428
426 Ga0495605_0150021 3300046474 Bacteria 1041
427 Ga0495639_0006397 3300046475 Bacteria 5066
428 Ga0495662_0008076 3300046476 Bacteria 5186
429 Ga0495664_0001762 3300046477 Bacteria 11503
430 Ga0495594_0077678 3300046499 Bacteria 1852
431 Ga0495596_0024596 3300046500 Bacteria 2438
432 Ga0495583_0031569 3300046506 Bacteria 2567
433 Ga0495608_0000376 3300046511 Bacteria 31189
434 Ga0495610_0040813 3300046512 Bacteria 2335
435 Ga0495618_0046090 3300046514 Bacteria 2751
436 Ga0495620_0048516 3300046515 Bacteria 1822
437 Ga0495628_0119219 3300046516 Bacteria 2025
438 Ga0495630_0117972 3300046517 Bacteria 2012
439 Ga0495630_0140463 3300046517 Bacteria 1836
440 Ga0495643_0054560 3300046522 Bacteria 2139
441 Ga0495643_0212144 3300046522 Bacteria 923
442 Ga0495644_0131642 3300046523 Bacteria 953
443 Ga0495663_0088599 3300046525 Bacteria 1006
444 Ga0495666_0119974 3300046526 Bacteria 1232
445 Ga0495652_0006143 3300046529 Bacteria 11225
446 Ga0495665_0013808 3300046531 Bacteria 4362
447 Ga0495665_0133575 3300046531 Bacteria 1299
448 Ga0495640_0016106 3300046533 Bacteria 5599
449 Ga0495586_0027821 3300046535 Bacteria 3025
450 Ga0495587_0001125 3300046536 Bacteria 17493
451 Ga0495598_0089923 3300046537 Bacteria 999
452 Ga0495645_0010377 3300046543 Bacteria 6527
453 Ga0495667_0000294 3300046559 Bacteria 32145
454 Ga0495667_0037649 3300046559 Bacteria 3223
455 Ga0495656_0054467 3300046615 Bacteria 1721
456 Ga0495634_0033547 3300046642 Bacteria 3527
457 Ga0495611_0105323 3300046648 Bacteria 1312
458 Ga0495635_0000880 3300046663 Bacteria 19715
459 Ga0495635_0005117 3300046663 Bacteria 9119
460 Ga0495635_0192986 3300046663 Bacteria 1382
461 Ga0495657_0021192 3300046675 Bacteria 4665
462 Ga0495657_0133733 3300046675 Bacteria 1551
463 Ga0495599_0004220 3300046678 Bacteria 8490
464 Ga0495623_0001907 3300046679 Bacteria 13995
465 Ga0495647_0130526 3300046681 Bacteria 1064
466 Ga0495658_0006634 3300046683 Bacteria 5688
467 Ga0495613_0032385 3300046689 Bacteria 3883
468 Ga0495670_0143255 3300046691 Bacteria 1251
469 Ga0495600_0003489 3300046809 Bacteria 9244
470 Ga0495600_0050142 3300046809 Bacteria 2724
471 Ga0495600_0116845 3300046809 Bacteria 1736
472 Ga0495660_0141454 3300046810 Bacteria 1197
473 Ga0495581_0029496 3300047315 Bacteria 3179
474 Ga0495581_0036697 3300047315 Bacteria 2836
475 Ga0495604_0000972 3300047317 Bacteria 23909
476 Ga0495674_0009055 3300047319 Bacteria 9455
477 Ga0495676_0004556 3300047321 Bacteria 12679
478 Ga0495680_0003955 3300047322 Bacteria 14330
479 Ga0495675_0019173 3300047444 Bacteria 4346
480 Ga0495675_0150212 3300047444 Bacteria 1440
481 Ga0495685_074652 3300047447 Bacteria 1133
482 Ga0495684_0075695 3300047471 Bacteria 2557
483 Ga0495593_0019912 3300047673 Bacteria 3759
484 Ga0495593_0092449 3300047673 Bacteria 1557
485 Ga0495602_0014347 3300048088 Bacteria 8047
486 Ga0495602_0184344 3300048088 Bacteria 1607
487 Ga0495615_0009871 3300048090 Bacteria 1890
488 Ga0496100_0005463 3300048903 Bacteria 6850
489 Ga0496100_0065103 3300048903 Bacteria 2414
490 Ga0496101_0001025 3300048904 Bacteria 16469
491 Ga0496102_0006587 3300048905 Bacteria 9920
492 Ga0496102_0010694 3300048905 Bacteria 7904
493 Ga0496103_0008670 3300048906 Bacteria 6039
494 Ga0496104_0002070 3300048907 Bacteria 17419
495 Ga0496104_0003048 3300048907 Bacteria 14438
496 Ga0496104_0004791 3300048907 Bacteria 11784
497 Ga0496105_0005922 3300048908 Bacteria 9329
498 Ga0496105_0441541 3300048908 Bacteria 1028
499 Ga0496106_0037412 3300048909 Bacteria 3631
500 Ga0496106_0272003 3300048909 Bacteria 1356
501 Ga0496107_0007469 3300048910 Bacteria 7535
502 Ga0496108_0000256 3300048911 Bacteria 46076
503 Ga0496108_0002364 3300048911 Bacteria 15107
504 Ga0496108_0141800 3300048911 Bacteria 2070
505 Ga0496109_0001401 3300048912 Bacteria 19982
506 Ga0496109_0002461 3300048912 Bacteria 15523
507 Ga0496109_0022323 3300048912 Bacteria 5605
508 Ga0496109_0047344 3300048912 Bacteria 3909
509 Ga0496110_0003528 3300048913 Bacteria 12009
510 Ga0496110_0011641 3300048913 Bacteria 7212
511 Ga0496110_0037760 3300048913 Bacteria 4199
512 Ga0496110_0158270 3300048913 Bacteria 2053
513 Ga0496111_0003518 3300048914 Bacteria 9693
514 Ga0496111_0477043 3300048914 Bacteria 919
515 Ga0496112_0002247 3300048915 Bacteria 15427
516 Ga0496112_0008922 3300048915 Bacteria 9001
517 Ga0496112_0107598 3300048915 Bacteria 2758
518 Ga0496112_0231771 3300048915 Bacteria 1801
519 Ga0496112_0487108 3300048915 Bacteria 1169
520 Ga0496112_0513845 3300048915 Bacteria 1133
521 Ga0496113_0000175 3300048916 Bacteria 28436
522 Ga0496113_0001647 3300048916 Bacteria 12592
523 Ga0496113_0187648 3300048916 Bacteria 1640
524 Ga0496114_0305233 3300048917 Bacteria 1405
525 Ga0496115_0059335 3300048918 Bacteria 3081
526 Ga0496115_0247874 3300048918 Bacteria 1467
527 Ga0496115_0305467 3300048918 Bacteria 1303
528 Ga0496115_0372882 3300048918 Bacteria 1161
529 Ga0496116_0019351 3300048919 Bacteria 5214
530 Ga0496117_0112305 3300048920 Bacteria 1694
531 Ga0496118_0005218 3300048921 Bacteria 14858
532 Ga0496121_0022335 3300048924 Bacteria 6146
533 Ga0496122_0026166 3300048925 Bacteria 5041
534 Ga0496122_0156620 3300048925 Bacteria 1397
535 Ga0496122_0203611 3300048925 Bacteria 1154
536 Ga0496123_0020537 3300048926 Bacteria 5163
537 Ga0496123_0086856 3300048926 Bacteria 1873
538 Ga0496124_0137628 3300048927 Bacteria 1931
539 Ga0496125_0005483 3300048928 Bacteria 14077
540 Ga0496125_0011871 3300048928 Bacteria 8678
541 Ga0501033_0000059 3300049570 Bacteria 105311
542 Ga0501034_0060021 3300049571 Bacteria 3820
543 Ga0501034_0335244 3300049571 Bacteria 1443
544 Ga0501037_0228626 3300049573 Bacteria 1306
545 Ga0501039_0318958 3300049575 Bacteria 1222
546 Ga0501040_0167152 3300049576 Bacteria 1557
547 Ga0501041_0087700 3300049577 Bacteria 1921
548 Ga0501046_0171128 3300049580 Bacteria 1630
549 Ga0501046_0243746 3300049580 Bacteria 1325
550 Ga0501067_0047581 3300049583 Bacteria 2379
551 Ga0501068_0136724 3300049584 Bacteria 1535
552 Ga0501070_0024591 3300049586 Bacteria 5050
553 Ga0501070_0352213 3300049586 Bacteria 1195
554 Ga0501079_0081607 3300049741 Bacteria 2501
555 Ga0501080_0233049 3300049742 Bacteria 1682
556 Ga0501083_0143757 3300049744 Bacteria 1562
557 Ga0501241_006236 3300049758 Bacteria 2199
558 Ga0501035_0000213 3300049822 Bacteria 69670
559 Ga0501035_0152813 3300049822 Bacteria 2002
560 Ga0501044_0047070 3300049823 Bacteria 4462
561 Ga0501044_0342532 3300049823 Bacteria 1416
562 nmdc:mga03683_104487_c1 3300050489 Bacteria 1247
563 nmdc:mga03683_87817_c1 3300050489 Bacteria 1352
564 nmdc:mga03n38_156733_c1 3300050490 Bacteria 1150
565 nmdc:mga03n38_47199_c1 3300050490 Bacteria 1905
566 nmdc:mga0yw44_36112_c1 3300050492 Bacteria 2910
567 nmdc:mga0yw44_48488_c1 3300050492 Bacteria 2561
568 nmdc:mga0yw44_51691_c1 3300050492 Bacteria 2489
569 nmdc:mga0yw44_91712_c1 3300050492 Bacteria 1922
570 nmdc:mga06z11_219721_c1 3300050494 Bacteria 1110
571 nmdc:mga05p37_28962_c1 3300050507 Bacteria 6757
572 nmdc:mga05p37_408232_c1 3300050507 Bacteria 1584
573 nmdc:mga05p37_528_c1 3300050507 Bacteria 42336
574 nmdc:mga09592_124292_c1 3300050508 Bacteria 2217
575 nmdc:mga09592_185841_c1 3300050508 Bacteria 1798
576 nmdc:mga09592_193588_c1 3300050508 Bacteria 1760
577 nmdc:mga09592_704_c1 3300050508 Bacteria 25621
578 nmdc:mga0qj67_101221_c1 3300050509 Bacteria 2323
579 nmdc:mga0qj67_139917_c1 3300050509 Bacteria 1962
580 nmdc:mga06r32_189063_c1 3300050510 Bacteria 2046
581 nmdc:mga06r32_241_c1 3300050510 Bacteria 44852
582 nmdc:mga08y16_166046_c1 3300050511 Bacteria 2293
583 nmdc:mga08y16_23292_c1 3300050511 Bacteria 6540
584 nmdc:mga08y16_25976_c1 3300050511 Bacteria 6178
585 nmdc:mga08y16_340596_c1 3300050511 Bacteria 1541
586 nmdc:mga08y16_384977_c1 3300050511 Bacteria 1437
587 nmdc:mga08y16_427_c1 3300050511 Bacteria 38825
588 nmdc:mga08y16_83933_c1 3300050511 Bacteria 3320
589 nmdc:mga0n895_12352_c1 3300050512 Bacteria 7657
590 nmdc:mga0n895_12968_c2 3300050512 Bacteria 5030
591 nmdc:mga0n895_320793_c1 3300050512 Bacteria 1570
592 nmdc:mga0n895_7409_c1 3300050512 Bacteria 9417
593 nmdc:mga0rr50_205386_c1 3300050513 Bacteria 1621
594 nmdc:mga0rr50_84520_c1 3300050513 Bacteria 2457
595 nmdc:mga0a205_25125_c1 3300050515 Bacteria 5672
596 nmdc:mga0a205_49071_c1 3300050515 Bacteria 4073
597 nmdc:mga0a205_5012_c1 3300050515 Bacteria 11924
598 nmdc:mga0a205_96567_c1 3300050515 Bacteria 2854
599 nmdc:mga0sz30_111345_c1 3300050516 Bacteria 1200
600 Ga0495601_0001493 3300053077 Bacteria 12895
601 Ga0495601_0015849 3300053077 Bacteria 4561
602 Ga0495601_0019807 3300053077 Bacteria 4107
603 Ga0495601_0060880 3300053077 Bacteria 2396
604 Ga0495612_0001332 3300053078 Bacteria 10178
605 Ga0495612_0009950 3300053078 Bacteria 3850
606 Ga0495595_0000657 3300053084 Bacteria 13138
607 Ga0495595_0008331 3300053084 Bacteria 4255
608 Ga0495619_0000426 3300053085 Bacteria 28605
609 Ga0495619_0002191 3300053085 Bacteria 12937
610 Ga0495619_0004170 3300053085 Bacteria 9234
611 Ga0495619_0038587 3300053085 Bacteria 3116
612 Ga0500643_039304 3300053087 Bacteria 1398
613 Ga0500644_0001423 3300053088 Bacteria 6351
614 Ga0500569_014997 3300053109 Bacteria 1932
615 Ga0500569_027884 3300053109 Bacteria 1561
616 Ga0500658_0144937 3300053134 Bacteria 1067
617 Ga0500568_0008666 3300053139 Bacteria 4882
618 Ga0500616_0010830 3300053153 Bacteria 5435
619 Ga0500622_0000206 3300053156 Bacteria 62842
620 Ga0500622_0006538 3300053156 Bacteria 6736
621 Ga0500627_0086767 3300053158 Bacteria 1399
622 Ga0500634_0080943 3300053161 Unclassified 1674
623 Ga0500636_0001934 3300053177 Bacteria 11375
624 Ga0500645_000051 3300053730 Bacteria 98521
625 Ga0501082_0000205 3300060353 Bacteria 51540
626 Ga0501082_0066377 3300060353 Bacteria 3107
627 Ga0530510_0032448 3300061734 Bacteria 3758
628 Ga0530510_0336436 3300061734 Bacteria 1133

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0000059 Ga0501033_0000059_62303_63163 257
2 3300049583 Ga0501067_0047581 Ga0501067_0047581_1574_2347 257
3 3300049822 Ga0501035_0000213 Ga0501035_0000213_43321_44181 257
4 3300035242 Ga0373962_0061586 Ga0373962_0061586_303_1079 258
5 3300053161 Ga0500634_0080943 Ga0500634_0080943_418_1293 260
6 3300049758 Ga0501241_006236 Ga0501241_006236_496_1353 262
7 3300005328 Ga0070676_10001102 Ga0070676_1000110214 263
8 3300005331 Ga0070670_100002568 Ga0070670_1000025689 263
9 3300005334 Ga0068869_100000152 Ga0068869_10000015217 263
10 3300005347 Ga0070668_100003108 Ga0070668_10000310810 263
11 3300005353 Ga0070669_100004064 Ga0070669_10000406410 263
12 3300005364 Ga0070673_100035055 Ga0070673_1000350555 263
13 3300005367 Ga0070667_100002820 Ga0070667_1000028203 263
14 3300005455 Ga0070663_100139203 Ga0070663_1001392031 263
15 3300005459 Ga0068867_100015097 Ga0068867_1000150973 263
16 3300005545 Ga0070695_100044773 Ga0070695_1000447731 263
17 3300005577 Ga0068857_100014270 Ga0068857_1000142708 263
18 3300005578 Ga0068854_100130973 Ga0068854_1001309732 263
19 3300005617 Ga0068859_100068581 Ga0068859_1000685813 263
20 3300005618 Ga0068864_100003353 Ga0068864_1000033533 263
21 3300005719 Ga0068861_100021528 Ga0068861_1000215283 263
22 3300005840 Ga0068870_10004685 Ga0068870_100046852 263
23 3300005841 Ga0068863_100000894 Ga0068863_10000089413 263
24 3300005842 Ga0068858_100161103 Ga0068858_1001611031 263
25 3300005843 Ga0068860_100008238 Ga0068860_10000823810 263
26 3300005844 Ga0068862_100001435 Ga0068862_1000014353 263
27 3300006844 Ga0075428_100001309 Ga0075428_10000130927 263
28 3300006846 Ga0075430_100067822 Ga0075430_1000678222 263
29 3300006847 Ga0075431_100000481 Ga0075431_10000048116 263
30 3300006880 Ga0075429_100004654 Ga0075429_1000046548 263
31 3300006881 Ga0068865_100156227 Ga0068865_1001562271 263
32 3300006931 Ga0097620_100068573 Ga0097620_1000685733 263
33 3300009094 Ga0111539_10002444 Ga0111539_1000244410 263
34 3300009101 Ga0105247_10006956 Ga0105247_100069562 263
35 3300009147 Ga0114129_10001244 Ga0114129_1000124419 263
36 3300009148 Ga0105243_10143768 Ga0105243_101437681 263
37 3300009177 Ga0105248_10028785 Ga0105248_100287854 263
38 3300014325 Ga0163163_10023407 Ga0163163_100234072 263
39 3300014968 Ga0157379_10008008 Ga0157379_100080081 263
40 3300025900 Ga0207710_10065845 Ga0207710_100658451 263
41 3300025908 Ga0207643_10006014 Ga0207643_100060143 263
42 3300025923 Ga0207681_10004880 Ga0207681_100048802 263
43 3300025938 Ga0207704_10086677 Ga0207704_100866771 263
44 3300025942 Ga0207689_10000946 Ga0207689_1000094616 263
45 3300025949 Ga0207667_10145792 Ga0207667_101457923 263
46 3300025960 Ga0207651_10005933 Ga0207651_100059334 263
47 3300025972 Ga0207668_10013196 Ga0207668_100131965 263
48 3300025986 Ga0207658_10014338 Ga0207658_100143382 263
49 3300026035 Ga0207703_10000292 Ga0207703_1000029247 263
50 3300026067 Ga0207678_10154229 Ga0207678_101542292 263
51 3300026088 Ga0207641_10001732 Ga0207641_1000173211 263
52 3300026089 Ga0207648_10001002 Ga0207648_1000100216 263
53 3300026095 Ga0207676_10001008 Ga0207676_100010086 263
54 3300026116 Ga0207674_10015916 Ga0207674_100159163 263
55 3300026118 Ga0207675_100001191 Ga0207675_10000119119 263
56 3300027907 Ga0207428_10006807 Ga0207428_1000680710 263
57 3300028380 Ga0268265_10001824 Ga0268265_1000182414 263
58 3300028381 Ga0268264_10000854 Ga0268264_1000085414 263
59 3300028794 Ga0307515_10011947 Ga0307515_100119477 263
60 3300048905 Ga0496102_0006587 Ga0496102_0006587_4649_5509 263
61 3300048906 Ga0496103_0008670 Ga0496103_0008670_3952_4812 263
62 3300048912 Ga0496109_0022323 Ga0496109_0022323_33_893 263
63 3300050507 nmdc:mga05p37_528_c1 nmdc:mga05p37_528_c1_36609_37469 263
64 3300050508 nmdc:mga09592_704_c1 nmdc:mga09592_704_c1_20105_20965 263
65 3300050509 nmdc:mga0qj67_101221_c1 nmdc:mga0qj67_101221_c1_1098_1958 263
66 3300050510 nmdc:mga06r32_241_c1 nmdc:mga06r32_241_c1_33472_34332 263
67 3300050511 nmdc:mga08y16_427_c1 nmdc:mga08y16_427_c1_8358_9218 263
68 3300005543 Ga0070672_100259984 Ga0070672_1002599842 265
69 3300031548 Ga0307408_100341803 Ga0307408_1003418032 265
70 3300032004 Ga0307414_10318480 Ga0307414_103184801 265
71 3300032005 Ga0307411_10288430 Ga0307411_102884302 265
72 3300049823 Ga0501044_0342532 Ga0501044_0342532_177_1037 265
73 3300013297 Ga0157378_10095706 Ga0157378_100957062 266
74 3300014325 Ga0163163_10010522 Ga0163163_100105224 266
75 3300013104 Ga0157370_10144693 Ga0157370_101446932 271
76 3300013297 Ga0157378_10073746 Ga0157378_100737463 273
77 3300049586 Ga0501070_0352213 Ga0501070_0352213_173_1033 273
78 3300005356 Ga0070674_100015585 Ga0070674_1000155852 274
79 3300005367 Ga0070667_100027156 Ga0070667_1000271562 274
80 3300005456 Ga0070678_100003193 Ga0070678_10000319311 274
81 3300005459 Ga0068867_100417150 Ga0068867_1004171501 274
82 3300005548 Ga0070665_100000982 Ga0070665_10000098232 274
83 3300025903 Ga0207680_10010358 Ga0207680_100103582 274
84 3300026035 Ga0207703_10563959 Ga0207703_105639591 274
85 3300026121 Ga0207683_10016614 Ga0207683_100166144 274
86 3300028379 Ga0268266_10107834 Ga0268266_101078342 274
87 3300050513 nmdc:mga0rr50_205386_c1 nmdc:mga0rr50_205386_c1_14_838 274
88 3300053158 Ga0500627_0086767 Ga0500627_0086767_554_1378 274
89 3300013297 Ga0157378_10258259 Ga0157378_102582592 275
90 3300014969 Ga0157376_10032604 Ga0157376_100326044 275
91 3300049571 Ga0501034_0060021 Ga0501034_0060021_2823_3683 276
92 3300006852 Ga0075433_10021177 Ga0075433_100211775 277
93 3300006871 Ga0075434_100021500 Ga0075434_1000215002 277
94 3300009094 Ga0111539_10067267 Ga0111539_100672674 277
95 3300027907 Ga0207428_10277303 Ga0207428_102773031 277
96 3300050511 nmdc:mga08y16_25976_c1 nmdc:mga08y16_25976_c1_2162_3022 277
97 3300050512 nmdc:mga0n895_7409_c1 nmdc:mga0n895_7409_c1_1775_2635 277
98 3300050515 nmdc:mga0a205_25125_c1 nmdc:mga0a205_25125_c1_3849_4709 277
99 iso_pu_bacteria 2558860983 2561468497 280
100 iso_pu_bacteria 2775506901 2776260515 280
101 iso_pu_bacteria 2775507049 2776911776 280
102 iso_pu_bacteria 2802429605 2805931320 280
103 iso_pu_bacteria 2894232714 2894233269 280
104 3300003856 Ga0058692_1000687 Ga0058692_10006879 284
105 3300003856 Ga0058692_1012959 Ga0058692_10129592 284
106 3300005327 Ga0070658_10516307 Ga0070658_105163071 284
107 3300005331 Ga0070670_100158384 Ga0070670_1001583842 284
108 3300005335 Ga0070666_10017401 Ga0070666_100174014 284
109 3300005347 Ga0070668_100002160 Ga0070668_10000216010 284
110 3300005355 Ga0070671_100000803 Ga0070671_1000008034 284
111 3300005356 Ga0070674_100000274 Ga0070674_10000027411 284
112 3300005367 Ga0070667_100126214 Ga0070667_1001262141 284
113 3300005459 Ga0068867_100001459 Ga0068867_10000145916 284
114 3300005539 Ga0068853_100008837 Ga0068853_10000883710 284
115 3300005543 Ga0070672_100000202 Ga0070672_10000020216 284
116 3300005616 Ga0068852_100002427 Ga0068852_1000024278 284
117 3300005617 Ga0068859_100253316 Ga0068859_1002533162 284
118 3300005618 Ga0068864_100017389 Ga0068864_1000173896 284
119 3300005719 Ga0068861_100047283 Ga0068861_1000472832 284
120 3300005842 Ga0068858_100042333 Ga0068858_1000423332 284
121 3300005843 Ga0068860_100038831 Ga0068860_1000388314 284
122 3300006237 Ga0097621_100016521 Ga0097621_1000165212 284
123 3300006358 Ga0068871_100106999 Ga0068871_1001069992 284
124 3300006931 Ga0097620_100253315 Ga0097620_1002533152 284
125 3300009094 Ga0111539_11106651 Ga0111539_111066511 284
126 3300009148 Ga0105243_10302999 Ga0105243_103029992 284
127 3300011119 Ga0105246_10184631 Ga0105246_101846312 284
128 3300013308 Ga0157375_10001479 Ga0157375_1000147916 284
129 3300013308 Ga0157375_10020299 Ga0157375_100202998 284
130 3300017792 Ga0163161_10109152 Ga0163161_101091522 284
131 3300021388 Ga0213875_10001420 Ga0213875_100014203 284
132 3300025893 Ga0207682_10001271 Ga0207682_100012719 284
133 3300025901 Ga0207688_10010921 Ga0207688_100109214 284
134 3300025907 Ga0207645_10000242 Ga0207645_100002424 284
135 3300025909 Ga0207705_10260400 Ga0207705_102604002 284
136 3300025926 Ga0207659_10109731 Ga0207659_101097312 284
137 3300025931 Ga0207644_10003418 Ga0207644_1000341811 284
138 3300025937 Ga0207669_10002721 Ga0207669_100027218 284
139 3300025938 Ga0207704_10006650 Ga0207704_100066507 284
140 3300025940 Ga0207691_10000084 Ga0207691_1000008440 284
141 3300025941 Ga0207711_10252352 Ga0207711_102523522 284
142 3300025960 Ga0207651_10130394 Ga0207651_101303942 284
143 3300026035 Ga0207703_10029948 Ga0207703_100299482 284
144 3300026041 Ga0207639_10009290 Ga0207639_100092909 284
145 3300026075 Ga0207708_10140114 Ga0207708_101401142 284
146 3300026089 Ga0207648_10002006 Ga0207648_1000200616 284
147 3300026095 Ga0207676_10080947 Ga0207676_100809472 284
148 3300026118 Ga0207675_100016216 Ga0207675_1000162162 284
149 3300026121 Ga0207683_10000003 Ga0207683_10000003137 284
150 3300027312 Ga0209371_1000064 Ga0209371_100006438 284
151 3300027312 Ga0209371_1000163 Ga0209371_100016384 284
152 3300027312 Ga0209371_1002971 Ga0209371_10029715 284
153 3300028379 Ga0268266_10064760 Ga0268266_100647604 284
154 3300028381 Ga0268264_10025144 Ga0268264_100251442 284
155 3300028794 Ga0307515_10106705 Ga0307515_101067052 284
156 3300030500 Ga0268256_1000028 Ga0268256_1000028198 284
157 3300030500 Ga0268256_1002480 Ga0268256_10024806 284
158 3300031995 Ga0307409_100252442 Ga0307409_1002524422 284
159 3300032005 Ga0307411_10197171 Ga0307411_101971712 284
160 3300039437 Ga0436365_1280225 Ga0436365_1280225_58_912 284
161 3300039453 Ga0436362_0430762 Ga0436362_0430762_1286_2140 284
162 3300046522 Ga0495643_0054560 Ga0495643_0054560_1247_2101 284
163 3300046691 Ga0495670_0143255 Ga0495670_0143255_370_1224 284
164 3300049571 Ga0501034_0335244 Ga0501034_0335244_254_1108 284
165 3300049573 Ga0501037_0228626 Ga0501037_0228626_205_1059 284
166 3300049822 Ga0501035_0152813 Ga0501035_0152813_762_1616 284
167 3300050511 nmdc:mga08y16_340596_c1 nmdc:mga08y16_340596_c1_19_873 284
168 3300053109 Ga0500569_014997 Ga0500569_014997_749_1603 284
169 3300053109 Ga0500569_027884 Ga0500569_027884_380_1234 284
170 3300053134 Ga0500658_0144937 Ga0500658_0144937_65_919 284
171 3300053153 Ga0500616_0010830 Ga0500616_0010830_3257_4111 284
172 3300053156 Ga0500622_0006538 Ga0500622_0006538_4452_5306 284
173 3300053177 Ga0500636_0001934 Ga0500636_0001934_1295_2149 284
174 3300003771 Ga0055526_1000231 Ga0055526_100023122 285
175 3300013250 Ga0171462_1027 Ga0171462_102730 285
176 3300025295 Ga0209564_1000023 Ga0209564_1000023388 285
177 3300025299 Ga0209256_1000234 Ga0209256_100023424 285
178 3300044694 Ga0466963_0150527 Ga0466963_0150527_109_969 285
179 3300048903 Ga0496100_0005463 Ga0496100_0005463_5300_6208 285
180 3300048904 Ga0496101_0001025 Ga0496101_0001025_4880_5788 285
181 3300048905 Ga0496102_0010694 Ga0496102_0010694_1877_2785 285
182 3300048907 Ga0496104_0004791 Ga0496104_0004791_9300_10208 285
183 3300048908 Ga0496105_0441541 Ga0496105_0441541_28_885 285
184 3300048910 Ga0496107_0007469 Ga0496107_0007469_1331_2239 285
185 3300048911 Ga0496108_0002364 Ga0496108_0002364_13453_14361 285
186 3300048912 Ga0496109_0001401 Ga0496109_0001401_2239_3096 285
187 3300048912 Ga0496109_0002461 Ga0496109_0002461_5286_6194 285
188 3300048913 Ga0496110_0003528 Ga0496110_0003528_4969_5877 285
189 3300048913 Ga0496110_0011641 Ga0496110_0011641_3951_4808 285
190 3300048914 Ga0496111_0003518 Ga0496111_0003518_5244_6152 285
191 3300048915 Ga0496112_0008922 Ga0496112_0008922_1066_1974 285
192 3300048916 Ga0496113_0001647 Ga0496113_0001647_11074_11982 285
193 3300048925 Ga0496122_0156620 Ga0496122_0156620_351_1208 285
194 3300048925 Ga0496122_0203611 Ga0496122_0203611_283_1140 285
195 3300048926 Ga0496123_0086856 Ga0496123_0086856_938_1795 285
196 3300002739 JGI25158J39367_1000708 JGI25158J39367_10007082 286
197 3300002773 JGI25152J39213_1006388 JGI25152J39213_10063882 286
198 3300002773 JGI25152J39213_1008113 JGI25152J39213_10081132 286
199 3300002773 JGI25152J39213_1010246 JGI25152J39213_10102462 286
200 3300002774 JGI25150J39212_1006776 JGI25150J39212_10067762 286
201 3300002987 JGI25159J45721_1000233 JGI25159J45721_100023326 286
202 3300003203 JGI25406J46586_10037443 JGI25406J46586_100374431 286
203 3300003215 JGI25153J46596_10009427 JGI25153J46596_100094272 286
204 3300003215 JGI25153J46596_10012455 JGI25153J46596_100124555 286
205 3300003354 JGI25160J50197_1004561 JGI25160J50197_10045612 286
206 3300003374 JGI25161J50226_1000079 JGI25161J50226_100007967 286
207 3300003771 Ga0055526_1003394 Ga0055526_10033943 286
208 3300003775 Ga0055524_1001230 Ga0055524_10012309 286
209 3300003792 Ga0055540_1004428 Ga0055540_10044285 286
210 3300004625 Ga0055543_1000031 Ga0055543_100003152 286
211 3300005262 Ga0065165_1013656 Ga0065165_10136563 286
212 3300005328 Ga0070676_10200924 Ga0070676_102009242 286
213 3300005331 Ga0070670_100005641 Ga0070670_1000056413 286
214 3300005333 Ga0070677_10008646 Ga0070677_100086461 286
215 3300005334 Ga0068869_100037437 Ga0068869_1000374372 286
216 3300005337 Ga0070682_100341303 Ga0070682_1003413031 286
217 3300005339 Ga0070660_100197583 Ga0070660_1001975832 286
218 3300005340 Ga0070689_100085509 Ga0070689_1000855092 286
219 3300005340 Ga0070689_100426000 Ga0070689_1004260002 286
220 3300005341 Ga0070691_10074316 Ga0070691_100743161 286
221 3300005343 Ga0070687_100012742 Ga0070687_1000127424 286
222 3300005347 Ga0070668_100120494 Ga0070668_1001204942 286
223 3300005353 Ga0070669_100020654 Ga0070669_1000206543 286
224 3300005353 Ga0070669_100135810 Ga0070669_1001358102 286
225 3300005354 Ga0070675_100271435 Ga0070675_1002714352 286
226 3300005355 Ga0070671_100163002 Ga0070671_1001630022 286
227 3300005356 Ga0070674_100023054 Ga0070674_1000230543 286
228 3300005364 Ga0070673_100141932 Ga0070673_1001419322 286
229 3300005367 Ga0070667_100481237 Ga0070667_1004812372 286
230 3300005434 Ga0070709_10113379 Ga0070709_101133792 286
231 3300005435 Ga0070714_100007015 Ga0070714_1000070156 286
232 3300005435 Ga0070714_100237339 Ga0070714_1002373392 286
233 3300005436 Ga0070713_100066957 Ga0070713_1000669573 286
234 3300005438 Ga0070701_10101595 Ga0070701_101015951 286
235 3300005445 Ga0070708_100068532 Ga0070708_1000685322 286
236 3300005456 Ga0070678_100367367 Ga0070678_1003673672 286
237 3300005457 Ga0070662_100069348 Ga0070662_1000693483 286
238 3300005459 Ga0068867_100046200 Ga0068867_1000462003 286
239 3300005466 Ga0070685_10015815 Ga0070685_100158152 286
240 3300005518 Ga0070699_100055573 Ga0070699_1000555732 286
241 3300005535 Ga0070684_100068444 Ga0070684_1000684442 286
242 3300005536 Ga0070697_100288301 Ga0070697_1002883012 286
243 3300005539 Ga0068853_100033048 Ga0068853_1000330481 286
244 3300005543 Ga0070672_100078159 Ga0070672_1000781592 286
245 3300005548 Ga0070665_100224300 Ga0070665_1002243002 286
246 3300005548 Ga0070665_100231409 Ga0070665_1002314091 286
247 3300005549 Ga0070704_100108511 Ga0070704_1001085112 286
248 3300005564 Ga0070664_100056757 Ga0070664_1000567572 286
249 3300005577 Ga0068857_100643060 Ga0068857_1006430601 286
250 3300005578 Ga0068854_100199582 Ga0068854_1001995822 286
251 3300005615 Ga0070702_100024230 Ga0070702_1000242302 286
252 3300005617 Ga0068859_100139254 Ga0068859_1001392542 286
253 3300005618 Ga0068864_100158740 Ga0068864_1001587402 286
254 3300005834 Ga0068851_10043974 Ga0068851_100439742 286
255 3300005841 Ga0068863_100030297 Ga0068863_1000302973 286
256 3300005841 Ga0068863_100199696 Ga0068863_1001996962 286
257 3300005842 Ga0068858_100420897 Ga0068858_1004208972 286
258 3300005843 Ga0068860_100169022 Ga0068860_1001690223 286
259 3300005844 Ga0068862_100012376 Ga0068862_1000123767 286
260 3300005844 Ga0068862_100171736 Ga0068862_1001717362 286
261 3300005937 Ga0081455_10014294 Ga0081455_100142948 286
262 3300005937 Ga0081455_10027925 Ga0081455_100279251 286
263 3300005937 Ga0081455_10048549 Ga0081455_100485491 286
264 3300005981 Ga0081538_10000697 Ga0081538_1000069719 286
265 3300005981 Ga0081538_10014451 Ga0081538_100144516 286
266 3300005983 Ga0081540_1001984 Ga0081540_10019845 286
267 3300005985 Ga0081539_10002187 Ga0081539_100021875 286
268 3300006028 Ga0070717_10041594 Ga0070717_100415943 286
269 3300006038 Ga0075365_10007019 Ga0075365_100070193 286
270 3300006038 Ga0075365_10279633 Ga0075365_102796332 286
271 3300006042 Ga0075368_10037922 Ga0075368_100379222 286
272 3300006048 Ga0075363_100021301 Ga0075363_1000213012 286
273 3300006051 Ga0075364_10005843 Ga0075364_100058434 286
274 3300006163 Ga0070715_10000633 Ga0070715_100006335 286
275 3300006175 Ga0070712_100002594 Ga0070712_1000025946 286
276 3300006175 Ga0070712_100008343 Ga0070712_1000083432 286
277 3300006175 Ga0070712_100046579 Ga0070712_1000465793 286
278 3300006177 Ga0075362_10002160 Ga0075362_100021604 286
279 3300006177 Ga0075362_10115924 Ga0075362_101159242 286
280 3300006195 Ga0075366_10061453 Ga0075366_100614532 286
281 3300006237 Ga0097621_100092828 Ga0097621_1000928282 286
282 3300006358 Ga0068871_100083825 Ga0068871_1000838252 286
283 3300006844 Ga0075428_100126415 Ga0075428_1001264152 286
284 3300006847 Ga0075431_100438732 Ga0075431_1004387322 286
285 3300006847 Ga0075431_100700148 Ga0075431_1007001481 286
286 3300006871 Ga0075434_100003619 Ga0075434_1000036193 286
287 3300006871 Ga0075434_100496375 Ga0075434_1004963752 286
288 3300006880 Ga0075429_100224127 Ga0075429_1002241272 286
289 3300006931 Ga0097620_100139255 Ga0097620_1001392552 286
290 3300007076 Ga0075435_100020522 Ga0075435_1000205225 286
291 3300007265 Ga0099794_10041774 Ga0099794_100417741 286
292 3300009036 Ga0105244_10032024 Ga0105244_100320242 286
293 3300009093 Ga0105240_10306224 Ga0105240_103062242 286
294 3300009094 Ga0111539_10012307 Ga0111539_100123075 286
295 3300009094 Ga0111539_10098515 Ga0111539_100985152 286
296 3300009094 Ga0111539_10400919 Ga0111539_104009192 286
297 3300009094 Ga0111539_10430116 Ga0111539_104301162 286
298 3300009098 Ga0105245_10063592 Ga0105245_100635922 286
299 3300009101 Ga0105247_10069980 Ga0105247_100699802 286
300 3300009147 Ga0114129_10265891 Ga0114129_102658912 286
301 3300009147 Ga0114129_10494395 Ga0114129_104943951 286
302 3300009147 Ga0114129_10729392 Ga0114129_107293921 286
303 3300009148 Ga0105243_10227222 Ga0105243_102272222 286
304 3300009177 Ga0105248_10883544 Ga0105248_108835441 286
305 3300009177 Ga0105248_10889784 Ga0105248_108897841 286
306 3300009551 Ga0105238_10102421 Ga0105238_101024212 286
307 3300013297 Ga0157378_10161676 Ga0157378_101616762 286
308 3300013297 Ga0157378_10542255 Ga0157378_105422552 286
309 3300013306 Ga0163162_10051729 Ga0163162_100517293 286
310 3300013308 Ga0157375_10415128 Ga0157375_104151282 286
311 3300014325 Ga0163163_10083633 Ga0163163_100836334 286
312 3300014325 Ga0163163_10215798 Ga0163163_102157982 286
313 3300014326 Ga0157380_10184102 Ga0157380_101841022 286
314 3300014326 Ga0157380_10882148 Ga0157380_108821481 286
315 3300014745 Ga0157377_10050622 Ga0157377_100506221 286
316 3300014968 Ga0157379_10250652 Ga0157379_102506522 286
317 3300014969 Ga0157376_10110941 Ga0157376_101109412 286
318 3300017792 Ga0163161_10077002 Ga0163161_100770023 286
319 3300021384 Ga0213876_10050262 Ga0213876_100502622 286
320 3300025208 Ga0209436_100094 Ga0209436_1000945 286
321 3300025245 Ga0207425_1001536 Ga0207425_10015364 286
322 3300025245 Ga0207425_1021386 Ga0207425_10213862 286
323 3300025258 Ga0209129_1000862 Ga0209129_100086213 286
324 3300025258 Ga0209129_1007118 Ga0209129_10071184 286
325 3300025273 Ga0209673_1033222 Ga0209673_10332222 286
326 3300025284 Ga0209130_1000023 Ga0209130_1000023287 286
327 3300025294 Ga0209025_1014429 Ga0209025_10144292 286
328 3300025295 Ga0209564_1003021 Ga0209564_10030218 286
329 3300025297 Ga0209758_1000422 Ga0209758_100042260 286
330 3300025297 Ga0209758_1005087 Ga0209758_10050872 286
331 3300025297 Ga0209758_1046377 Ga0209758_10463772 286
332 3300025297 Ga0209758_1047686 Ga0209758_10476862 286
333 3300025302 Ga0207426_1000087 Ga0207426_100008775 286
334 3300025303 Ga0209051_1005845 Ga0209051_10058452 286
335 3300025893 Ga0207682_10005559 Ga0207682_100055592 286
336 3300025900 Ga0207710_10146899 Ga0207710_101468992 286
337 3300025901 Ga0207688_10006266 Ga0207688_100062663 286
338 3300025904 Ga0207647_10044939 Ga0207647_100449392 286
339 3300025907 Ga0207645_10039127 Ga0207645_100391273 286
340 3300025907 Ga0207645_10089906 Ga0207645_100899062 286
341 3300025908 Ga0207643_10023880 Ga0207643_100238802 286
342 3300025908 Ga0207643_10164289 Ga0207643_101642892 286
343 3300025910 Ga0207684_10011372 Ga0207684_100113728 286
344 3300025911 Ga0207654_10277529 Ga0207654_102775292 286
345 3300025914 Ga0207671_10488344 Ga0207671_104883441 286
346 3300025915 Ga0207693_10000855 Ga0207693_1000085518 286
347 3300025915 Ga0207693_10007507 Ga0207693_100075074 286
348 3300025915 Ga0207693_10069366 Ga0207693_100693662 286
349 3300025915 Ga0207693_10102320 Ga0207693_101023202 286
350 3300025915 Ga0207693_10184416 Ga0207693_101844162 286
351 3300025918 Ga0207662_10009537 Ga0207662_100095374 286
352 3300025919 Ga0207657_10045501 Ga0207657_100455014 286
353 3300025923 Ga0207681_10088247 Ga0207681_100882472 286
354 3300025924 Ga0207694_10263094 Ga0207694_102630941 286
355 3300025925 Ga0207650_10062197 Ga0207650_100621972 286
356 3300025925 Ga0207650_10218648 Ga0207650_102186481 286
357 3300025926 Ga0207659_10338537 Ga0207659_103385372 286
358 3300025928 Ga0207700_10209837 Ga0207700_102098372 286
359 3300025933 Ga0207706_10008768 Ga0207706_100087684 286
360 3300025933 Ga0207706_10038152 Ga0207706_100381522 286
361 3300025937 Ga0207669_10034073 Ga0207669_100340731 286
362 3300025937 Ga0207669_10258778 Ga0207669_102587781 286
363 3300025938 Ga0207704_10205458 Ga0207704_102054582 286
364 3300025940 Ga0207691_10095536 Ga0207691_100955362 286
365 3300025942 Ga0207689_10005950 Ga0207689_100059509 286
366 3300025960 Ga0207651_10288740 Ga0207651_102887402 286
367 3300025961 Ga0207712_10280986 Ga0207712_102809861 286
368 3300025972 Ga0207668_10161101 Ga0207668_101611012 286
369 3300025981 Ga0207640_10505692 Ga0207640_105056921 286
370 3300025986 Ga0207658_10377136 Ga0207658_103771361 286
371 3300026067 Ga0207678_10049460 Ga0207678_100494604 286
372 3300026078 Ga0207702_10194210 Ga0207702_101942101 286
373 3300026088 Ga0207641_10234444 Ga0207641_102344442 286
374 3300026088 Ga0207641_10255903 Ga0207641_102559032 286
375 3300026089 Ga0207648_10000840 Ga0207648_1000084029 286
376 3300026089 Ga0207648_10037903 Ga0207648_100379034 286
377 3300026095 Ga0207676_10029108 Ga0207676_100291082 286
378 3300026116 Ga0207674_10032353 Ga0207674_100323532 286
379 3300026116 Ga0207674_10138180 Ga0207674_101381802 286
380 3300026118 Ga0207675_100002492 Ga0207675_10000249210 286
381 3300026121 Ga0207683_10007445 Ga0207683_100074459 286
382 3300027671 Ga0209588_1027072 Ga0209588_10270722 286
383 3300027907 Ga0207428_10052817 Ga0207428_100528172 286
384 3300028380 Ga0268265_10194524 Ga0268265_101945242 286
385 3300028381 Ga0268264_10050111 Ga0268264_100501112 286
386 3300028381 Ga0268264_10129119 Ga0268264_101291192 286
387 3300028381 Ga0268264_10228348 Ga0268264_102283482 286
388 3300028800 Ga0265338_10009857 Ga0265338_100098577 286
389 3300030760 Ga0265762_1012367 Ga0265762_10123672 286
390 3300031241 Ga0265325_10014195 Ga0265325_100141952 286
391 3300031242 Ga0265329_10021321 Ga0265329_100213212 286
392 3300031247 Ga0265340_10050215 Ga0265340_100502152 286
393 3300031249 Ga0265339_10000067 Ga0265339_1000006791 286
394 3300031249 Ga0265339_10069992 Ga0265339_100699922 286
395 3300031249 Ga0265339_10152998 Ga0265339_101529981 286
396 3300031344 Ga0265316_10057397 Ga0265316_100573972 286
397 3300031344 Ga0265316_10302160 Ga0265316_103021602 286
398 3300031456 Ga0307513_10291226 Ga0307513_102912262 286
399 3300031595 Ga0265313_10000054 Ga0265313_10000054101 286
400 3300031711 Ga0265314_10014038 Ga0265314_100140384 286
401 3300034816 Ga0373930_0033775 Ga0373930_0033775_47_907 286
402 3300035086 Ga0373934_0000167 Ga0373934_0000167_5043_5903 286
403 3300035086 Ga0373934_0011751 Ga0373934_0011751_1991_2851 286
404 3300035086 Ga0373934_0026423 Ga0373934_0026423_1362_2222 286
405 3300035089 Ga0373944_0012413 Ga0373944_0012413_749_1609 286
406 3300035111 Ga0373923_0056335 Ga0373923_0056335_148_1008 286
407 3300035113 Ga0373936_0006658 Ga0373936_0006658_2630_3490 286
408 3300035116 Ga0373945_0000969 Ga0373945_0000969_858_1718 286
409 3300035116 Ga0373945_0006884 Ga0373945_0006884_2659_3519 286
410 3300035117 Ga0373953_0135373 Ga0373953_0135373_112_972 286
411 3300035118 Ga0373954_0003678 Ga0373954_0003678_624_1484 286
412 3300035118 Ga0373954_0042470 Ga0373954_0042470_25_885 286
413 3300035118 Ga0373954_0063796 Ga0373954_0063796_95_955 286
414 3300035119 Ga0373956_0000005 Ga0373956_0000005_50647_51507 286
415 3300035119 Ga0373956_0017636 Ga0373956_0017636_644_1504 286
416 3300035120 Ga0373957_0001547 Ga0373957_0001547_3303_4163 286
417 3300035121 Ga0373960_0090861 Ga0373960_0090861_23_883 286
418 3300035170 Ga0373943_0000185 Ga0373943_0000185_17285_18145 286
419 3300035170 Ga0373943_0029216 Ga0373943_0029216_1260_2120 286
420 3300035171 Ga0373946_0000642 Ga0373946_0000642_10137_10997 286
421 3300035171 Ga0373946_0020381 Ga0373946_0020381_1545_2405 286
422 3300035171 Ga0373946_0053302 Ga0373946_0053302_71_931 286
423 3300035172 Ga0373955_0001424 Ga0373955_0001424_8541_9401 286
424 3300035172 Ga0373955_0002275 Ga0373955_0002275_2090_2950 286
425 3300035172 Ga0373955_0021411 Ga0373955_0021411_1649_2509 286
426 3300035172 Ga0373955_0094832 Ga0373955_0094832_834_1694 286
427 3300035207 Ga0373942_0003621 Ga0373942_0003621_214_1074 286
428 3300035410 Ga0373924_0017153 Ga0373924_0017153_635_1495 286
429 3300035410 Ga0373924_0024311 Ga0373924_0024311_605_1465 286
430 3300035410 Ga0373924_0035283 Ga0373924_0035283_187_1047 286
431 3300035691 Ga0373931_0145414 Ga0373931_0145414_471_1331 286
432 3300035695 Ga0373927_0000434 Ga0373927_0000434_21067_21927 286
433 3300035695 Ga0373927_0041103 Ga0373927_0041103_816_1676 286
434 3300035695 Ga0373927_0088315 Ga0373927_0088315_315_1175 286
435 3300035724 Ga0373933_0000447 Ga0373933_0000447_9214_10074 286
436 3300035724 Ga0373933_0000883 Ga0373933_0000883_11050_11910 286
437 3300035724 Ga0373933_0003022 Ga0373933_0003022_3956_4816 286
438 3300035725 Ga0373947_0000583 Ga0373947_0000583_10124_10984 286
439 3300035725 Ga0373947_0019759 Ga0373947_0019759_2445_3305 286
440 3300036401 Ga0373937_0000912 Ga0373937_0000912_4464_5324 286
441 3300036401 Ga0373937_0004251 Ga0373937_0004251_501_1361 286
442 3300036401 Ga0373937_0009273 Ga0373937_0009273_3172_4032 286
443 3300037068 Ga0373925_0328633 Ga0373925_0328633_271_1131 286
444 3300037068 Ga0373925_0368428 Ga0373925_0368428_82_942 286
445 3300037312 Ga0395899_0264174 Ga0395899_0264174_144_1004 286
446 3300037418 Ga0395900_0334282 Ga0395900_0334282_251_1111 286
447 3300037466 Ga0395898_0109219 Ga0395898_0109219_858_1718 286
448 3300037853 Ga0436364_0125248 Ga0436364_0125248_132_992 286
449 3300037853 Ga0436364_1334518 Ga0436364_1334518_495_1355 286
450 3300038443 Ga0395901_0083724 Ga0395901_0083724_1991_2851 286
451 3300038443 Ga0395901_0461538 Ga0395901_0461538_106_966 286
452 3300039437 Ga0436365_0523999 Ga0436365_0523999_1224_2084 286
453 3300039447 Ga0436361_0089618 Ga0436361_0089618_35_895 286
454 3300039447 Ga0436361_1189219 Ga0436361_1189219_2065_2925 286
455 3300041408 Ga0439453_0008905 Ga0439453_0008905_737_1597 286
456 3300041413 Ga0439465_0004447 Ga0439465_0004447_3398_4258 286
457 3300041413 Ga0439465_0017288 Ga0439465_0017288_643_1503 286
458 3300041512 Ga0451853_2675021 Ga0451853_2675021_139_999 286
459 3300042003 Ga0439443_003461 Ga0439443_003461_1044_1904 286
460 3300042010 Ga0439452_026510 Ga0439452_026510_187_1047 286
461 3300042015 Ga0439462_0010941 Ga0439462_0010941_919_1797 286
462 3300042015 Ga0439462_0032598 Ga0439462_0032598_351_1229 286
463 3300042156 Ga0439446_0052905 Ga0439446_0052905_328_1188 286
464 3300042436 Ga0439435_0029550 Ga0439435_0029550_284_1144 286
465 3300044684 Ga0466966_0162429 Ga0466966_0162429_324_1184 286
466 3300044694 Ga0466963_0053084 Ga0466963_0053084_1612_2472 286
467 3300044712 Ga0453684_0386395 Ga0453684_0386395_258_1121 286
468 3300045976 Ga0466967_0138012 Ga0466967_0138012_192_1052 286
469 3300046452 Ga0495617_033101 Ga0495617_033101_107_967 286
470 3300046453 Ga0495627_021698 Ga0495627_021698_174_1034 286
471 3300046454 Ga0495592_0002231 Ga0495592_0002231_4826_5686 286
472 3300046455 Ga0495603_0069424 Ga0495603_0069424_699_1559 286
473 3300046459 Ga0495629_0016538 Ga0495629_0016538_312_1172 286
474 3300046460 Ga0495638_0016019 Ga0495638_0016019_1992_2852 286
475 3300046462 Ga0495651_0000479 Ga0495651_0000479_19039_19899 286
476 3300046462 Ga0495651_0000878 Ga0495651_0000878_16161_17021 286
477 3300046463 Ga0495653_0000553 Ga0495653_0000553_19952_20812 286
478 3300046463 Ga0495653_0039412 Ga0495653_0039412_2057_2917 286
479 3300046473 Ga0495582_0037901 Ga0495582_0037901_1167_2027 286
480 3300046474 Ga0495605_0089502 Ga0495605_0089502_557_1417 286
481 3300046474 Ga0495605_0150021 Ga0495605_0150021_49_909 286
482 3300046475 Ga0495639_0006397 Ga0495639_0006397_2631_3491 286
483 3300046476 Ga0495662_0008076 Ga0495662_0008076_3539_4399 286
484 3300046477 Ga0495664_0001762 Ga0495664_0001762_4085_4945 286
485 3300046499 Ga0495594_0077678 Ga0495594_0077678_71_931 286
486 3300046500 Ga0495596_0024596 Ga0495596_0024596_826_1686 286
487 3300046506 Ga0495583_0031569 Ga0495583_0031569_968_1828 286
488 3300046511 Ga0495608_0000376 Ga0495608_0000376_26438_27298 286
489 3300046512 Ga0495610_0040813 Ga0495610_0040813_105_965 286
490 3300046514 Ga0495618_0046090 Ga0495618_0046090_1025_1885 286
491 3300046515 Ga0495620_0048516 Ga0495620_0048516_773_1633 286
492 3300046516 Ga0495628_0119219 Ga0495628_0119219_876_1736 286
493 3300046517 Ga0495630_0117972 Ga0495630_0117972_1085_1945 286
494 3300046517 Ga0495630_0140463 Ga0495630_0140463_521_1381 286
495 3300046522 Ga0495643_0212144 Ga0495643_0212144_27_887 286
496 3300046523 Ga0495644_0131642 Ga0495644_0131642_53_913 286
497 3300046525 Ga0495663_0088599 Ga0495663_0088599_91_951 286
498 3300046526 Ga0495666_0119974 Ga0495666_0119974_240_1100 286
499 3300046529 Ga0495652_0006143 Ga0495652_0006143_7643_8503 286
500 3300046531 Ga0495665_0013808 Ga0495665_0013808_738_1598 286
501 3300046531 Ga0495665_0133575 Ga0495665_0133575_209_1069 286
502 3300046533 Ga0495640_0016106 Ga0495640_0016106_646_1506 286
503 3300046535 Ga0495586_0027821 Ga0495586_0027821_2069_2929 286
504 3300046536 Ga0495587_0001125 Ga0495587_0001125_9731_10591 286
505 3300046537 Ga0495598_0089923 Ga0495598_0089923_69_929 286
506 3300046543 Ga0495645_0010377 Ga0495645_0010377_2671_3531 286
507 3300046559 Ga0495667_0000294 Ga0495667_0000294_10278_11138 286
508 3300046559 Ga0495667_0037649 Ga0495667_0037649_1084_1944 286
509 3300046615 Ga0495656_0054467 Ga0495656_0054467_802_1662 286
510 3300046642 Ga0495634_0033547 Ga0495634_0033547_1409_2269 286
511 3300046648 Ga0495611_0105323 Ga0495611_0105323_238_1098 286
512 3300046663 Ga0495635_0000880 Ga0495635_0000880_17476_18336 286
513 3300046663 Ga0495635_0005117 Ga0495635_0005117_1832_2692 286
514 3300046663 Ga0495635_0192986 Ga0495635_0192986_265_1125 286
515 3300046675 Ga0495657_0021192 Ga0495657_0021192_2464_3324 286
516 3300046675 Ga0495657_0133733 Ga0495657_0133733_528_1388 286
517 3300046678 Ga0495599_0004220 Ga0495599_0004220_661_1521 286
518 3300046679 Ga0495623_0001907 Ga0495623_0001907_8451_9311 286
519 3300046681 Ga0495647_0130526 Ga0495647_0130526_158_1018 286
520 3300046683 Ga0495658_0006634 Ga0495658_0006634_1283_2143 286
521 3300046689 Ga0495613_0032385 Ga0495613_0032385_153_1013 286
522 3300046809 Ga0495600_0003489 Ga0495600_0003489_5627_6487 286
523 3300046809 Ga0495600_0050142 Ga0495600_0050142_949_1809 286
524 3300046809 Ga0495600_0116845 Ga0495600_0116845_841_1701 286
525 3300046810 Ga0495660_0141454 Ga0495660_0141454_98_958 286
526 3300047315 Ga0495581_0029496 Ga0495581_0029496_416_1276 286
527 3300047315 Ga0495581_0036697 Ga0495581_0036697_100_960 286
528 3300047317 Ga0495604_0000972 Ga0495604_0000972_8758_9618 286
529 3300047319 Ga0495674_0009055 Ga0495674_0009055_1260_2120 286
530 3300047321 Ga0495676_0004556 Ga0495676_0004556_4010_4870 286
531 3300047322 Ga0495680_0003955 Ga0495680_0003955_9836_10696 286
532 3300047444 Ga0495675_0019173 Ga0495675_0019173_2876_3736 286
533 3300047444 Ga0495675_0150212 Ga0495675_0150212_52_912 286
534 3300047447 Ga0495685_074652 Ga0495685_074652_52_912 286
535 3300047471 Ga0495684_0075695 Ga0495684_0075695_319_1179 286
536 3300047673 Ga0495593_0019912 Ga0495593_0019912_2502_3362 286
537 3300047673 Ga0495593_0092449 Ga0495593_0092449_16_876 286
538 3300048088 Ga0495602_0014347 Ga0495602_0014347_1862_2722 286
539 3300048088 Ga0495602_0184344 Ga0495602_0184344_583_1443 286
540 3300048090 Ga0495615_0009871 Ga0495615_0009871_976_1836 286
541 3300048903 Ga0496100_0065103 Ga0496100_0065103_1226_2086 286
542 3300048907 Ga0496104_0002070 Ga0496104_0002070_3011_3871 286
543 3300048907 Ga0496104_0003048 Ga0496104_0003048_4272_5132 286
544 3300048908 Ga0496105_0005922 Ga0496105_0005922_4470_5330 286
545 3300048909 Ga0496106_0037412 Ga0496106_0037412_899_1861 286
546 3300048909 Ga0496106_0272003 Ga0496106_0272003_155_1015 286
547 3300048911 Ga0496108_0000256 Ga0496108_0000256_1877_2737 286
548 3300048911 Ga0496108_0141800 Ga0496108_0141800_1200_2060 286
549 3300048912 Ga0496109_0047344 Ga0496109_0047344_998_1858 286
550 3300048913 Ga0496110_0037760 Ga0496110_0037760_616_1476 286
551 3300048913 Ga0496110_0158270 Ga0496110_0158270_1062_2024 286
552 3300048914 Ga0496111_0477043 Ga0496111_0477043_13_873 286
553 3300048915 Ga0496112_0002247 Ga0496112_0002247_1018_1878 286
554 3300048915 Ga0496112_0107598 Ga0496112_0107598_394_1254 286
555 3300048915 Ga0496112_0231771 Ga0496112_0231771_86_946 286
556 3300048915 Ga0496112_0487108 Ga0496112_0487108_247_1107 286
557 3300048915 Ga0496112_0513845 Ga0496112_0513845_130_990 286
558 3300048916 Ga0496113_0000175 Ga0496113_0000175_15678_16538 286
559 3300048916 Ga0496113_0187648 Ga0496113_0187648_578_1438 286
560 3300048917 Ga0496114_0305233 Ga0496114_0305233_105_965 286
561 3300048918 Ga0496115_0059335 Ga0496115_0059335_745_1605 286
562 3300048918 Ga0496115_0247874 Ga0496115_0247874_60_920 286
563 3300048918 Ga0496115_0305467 Ga0496115_0305467_23_883 286
564 3300048918 Ga0496115_0372882 Ga0496115_0372882_267_1127 286
565 3300048919 Ga0496116_0019351 Ga0496116_0019351_2665_3525 286
566 3300048920 Ga0496117_0112305 Ga0496117_0112305_566_1426 286
567 3300048921 Ga0496118_0005218 Ga0496118_0005218_8885_9745 286
568 3300048924 Ga0496121_0022335 Ga0496121_0022335_4812_5687 286
569 3300048925 Ga0496122_0026166 Ga0496122_0026166_2249_3109 286
570 3300048926 Ga0496123_0020537 Ga0496123_0020537_1973_2833 286
571 3300048927 Ga0496124_0137628 Ga0496124_0137628_45_905 286
572 3300048928 Ga0496125_0005483 Ga0496125_0005483_5677_6537 286
573 3300048928 Ga0496125_0011871 Ga0496125_0011871_172_1047 286
574 3300049575 Ga0501039_0318958 Ga0501039_0318958_313_1173 286
575 3300049576 Ga0501040_0167152 Ga0501040_0167152_494_1354 286
576 3300049577 Ga0501041_0087700 Ga0501041_0087700_190_1050 286
577 3300049580 Ga0501046_0171128 Ga0501046_0171128_217_1077 286
578 3300049580 Ga0501046_0243746 Ga0501046_0243746_174_1034 286
579 3300049584 Ga0501068_0136724 Ga0501068_0136724_404_1264 286
580 3300049586 Ga0501070_0024591 Ga0501070_0024591_2523_3383 286
581 3300049741 Ga0501079_0081607 Ga0501079_0081607_515_1375 286
582 3300049742 Ga0501080_0233049 Ga0501080_0233049_18_878 286
583 3300049744 Ga0501083_0143757 Ga0501083_0143757_663_1523 286
584 3300049823 Ga0501044_0047070 Ga0501044_0047070_432_1292 286
585 3300050489 nmdc:mga03683_104487_c1 nmdc:mga03683_104487_c1_76_936 286
586 3300050489 nmdc:mga03683_87817_c1 nmdc:mga03683_87817_c1_401_1261 286
587 3300050490 nmdc:mga03n38_156733_c1 nmdc:mga03n38_156733_c1_148_1008 286
588 3300050490 nmdc:mga03n38_47199_c1 nmdc:mga03n38_47199_c1_140_1000 286
589 3300050492 nmdc:mga0yw44_36112_c1 nmdc:mga0yw44_36112_c1_269_1129 286
590 3300050492 nmdc:mga0yw44_48488_c1 nmdc:mga0yw44_48488_c1_498_1358 286
591 3300050492 nmdc:mga0yw44_51691_c1 nmdc:mga0yw44_51691_c1_270_1130 286
592 3300050492 nmdc:mga0yw44_91712_c1 nmdc:mga0yw44_91712_c1_520_1380 286
593 3300050494 nmdc:mga06z11_219721_c1 nmdc:mga06z11_219721_c1_143_1003 286
594 3300050507 nmdc:mga05p37_28962_c1 nmdc:mga05p37_28962_c1_338_1264 286
595 3300050507 nmdc:mga05p37_408232_c1 nmdc:mga05p37_408232_c1_170_1030 286
596 3300050508 nmdc:mga09592_124292_c1 nmdc:mga09592_124292_c1_1178_2038 286
597 3300050508 nmdc:mga09592_185841_c1 nmdc:mga09592_185841_c1_762_1688 286
598 3300050508 nmdc:mga09592_193588_c1 nmdc:mga09592_193588_c1_481_1341 286
599 3300050509 nmdc:mga0qj67_139917_c1 nmdc:mga0qj67_139917_c1_723_1583 286
600 3300050510 nmdc:mga06r32_189063_c1 nmdc:mga06r32_189063_c1_365_1225 286
601 3300050511 nmdc:mga08y16_166046_c1 nmdc:mga08y16_166046_c1_229_1089 286
602 3300050511 nmdc:mga08y16_23292_c1 nmdc:mga08y16_23292_c1_2847_3707 286
603 3300050511 nmdc:mga08y16_384977_c1 nmdc:mga08y16_384977_c1_508_1368 286
604 3300050511 nmdc:mga08y16_83933_c1 nmdc:mga08y16_83933_c1_1470_2330 286
605 3300050512 nmdc:mga0n895_12352_c1 nmdc:mga0n895_12352_c1_5558_6418 286
606 3300050512 nmdc:mga0n895_12968_c2 nmdc:mga0n895_12968_c2_3349_4209 286
607 3300050512 nmdc:mga0n895_320793_c1 nmdc:mga0n895_320793_c1_359_1219 286
608 3300050513 nmdc:mga0rr50_84520_c1 nmdc:mga0rr50_84520_c1_620_1582 286
609 3300050515 nmdc:mga0a205_49071_c1 nmdc:mga0a205_49071_c1_1897_2757 286
610 3300050515 nmdc:mga0a205_5012_c1 nmdc:mga0a205_5012_c1_7171_8031 286
611 3300050515 nmdc:mga0a205_96567_c1 nmdc:mga0a205_96567_c1_843_1703 286
612 3300050516 nmdc:mga0sz30_111345_c1 nmdc:mga0sz30_111345_c1_185_1045 286
613 3300053077 Ga0495601_0001493 Ga0495601_0001493_4147_5007 286
614 3300053077 Ga0495601_0015849 Ga0495601_0015849_3391_4251 286
615 3300053077 Ga0495601_0019807 Ga0495601_0019807_2346_3206 286
616 3300053077 Ga0495601_0060880 Ga0495601_0060880_835_1695 286
617 3300053078 Ga0495612_0001332 Ga0495612_0001332_304_1164 286
618 3300053078 Ga0495612_0009950 Ga0495612_0009950_1505_2365 286
619 3300053084 Ga0495595_0000657 Ga0495595_0000657_348_1208 286
620 3300053084 Ga0495595_0008331 Ga0495595_0008331_2480_3340 286
621 3300053085 Ga0495619_0000426 Ga0495619_0000426_18038_18898 286
622 3300053085 Ga0495619_0002191 Ga0495619_0002191_2618_3478 286
623 3300053085 Ga0495619_0004170 Ga0495619_0004170_2510_3370 286
624 3300053085 Ga0495619_0038587 Ga0495619_0038587_33_893 286
625 3300053087 Ga0500643_039304 Ga0500643_039304_368_1228 286
626 3300053088 Ga0500644_0001423 Ga0500644_0001423_4578_5438 286
627 3300053139 Ga0500568_0008666 Ga0500568_0008666_2140_3000 286
628 3300053156 Ga0500622_0000206 Ga0500622_0000206_2161_3021 286
629 3300053730 Ga0500645_000051 Ga0500645_000051_3955_4815 286
630 3300060353 Ga0501082_0000205 Ga0501082_0000205_17546_18406 286
631 3300060353 Ga0501082_0066377 Ga0501082_0066377_148_1008 286
632 3300061734 Ga0530510_0032448 Ga0530510_0032448_505_1365 286
633 3300061734 Ga0530510_0336436 Ga0530510_0336436_235_1095 286

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

38

306

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.5615 5 274
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.5303 5 274
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5168 2 274
4dbl-assembly2.cif.gz_F crystal structure of e159q mutant of btucdf 0.5156 7 273
4dbl-assembly2.cif.gz_F crystal structure of e159q mutant of btucdf 0.484 7 273
ID Description Score Start End Superfamily
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8844 5 272 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8403 5 272 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8373 5 273 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8146 1 272 1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8121 5 270 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A060ICN4-F1-model_v4 High-affinity branched-chain amino acid ABC transporter permease protein 0.9839 1 246 GO:0005886
GO:0006865
GO:0022857
AF-A0A3C0Y9Y6-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9761 1 260 GO:0005886
GO:0006865
GO:0022857
AF-A0A522GJA6-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9733 2 284 GO:0005886
GO:0006865
GO:0022857
AF-A0A127F4L3-F1-model_v4 Branched-chain amino acid ABC transport system permease 0.9724 4 284 GO:0005886
GO:0006865
GO:0022857
AF-A0A537X4V6-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9717 44 279 GO:0005886
GO:0006865
GO:0022857

Feature Viewer

pLDDT pTM Quality
85.26 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map