F471111
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 633 | 364 | 628 | 283 |
Family's Representative Sequence
| Representative Sequence | 3300048909|Ga0496106_0037412|Ga0496106_0037412_899_1861 |
| Length | 320 |
| Sequence | LARRDGWPAGGSGLASLPAPPSVYESVDGRRRATMLTILFDGIAYGMLLFVLACGLSVTLGLMNFVNLAHGAFAMAGGYITLVLVNRGGVPFAAGLAIAFVVTALIGVLLERTLYVHVYGKSPLEQVLFTIGLVFMSVAAVDYVMGSQQVFIQIPSVLEGRFEIFGIGIGRYRLLIIVICGLLTLALQMTLSNTRFGSRLRASVDDARVARGLGINVNAVFTLTFAVGSGLAGLGGALGAEILGLDPTFPLKYMVYFLIVVTVGGTSSITGPFAASLVIGIADVAGKYYVPKFGAFVIYTIMIIVLILRPQGLFARAAGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 2 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 3 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 4 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 5 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 6 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 14 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 18 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 95 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 117 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 118 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 179 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 181 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 183 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 185 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 187 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 188 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 189 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 195 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 199 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 200 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 204 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 210 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 211 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 213 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 215 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 218 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 219 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 220 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 221 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 222 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 223 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 224 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 225 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 226 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 227 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 228 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 229 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 230 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 231 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 232 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 233 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 234 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 235 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 236 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 237 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 298 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 299 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 300 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 301 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 302 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 303 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 306 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 307 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 308 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 309 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 310 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 311 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 312 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 313 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 314 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 315 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 316 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 317 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 318 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 319 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 333 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 336 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 337 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 338 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 339 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 348 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 353 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 355 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 356 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 357 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 358 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 359 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 360 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 361 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 362 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 363 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.05 |
| Metatranscriptomes | 0.16 |
| Isolates | 0.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.11 |
| Nodule | 0.32 |
| Rhizoplane | 6.64 |
| Rhizosphere | 79.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25158J39367_1000708 | 3300002739 | Bacteria | 6453 |
| 2 | JGI25152J39213_1006388 | 3300002773 | Bacteria | 3230 |
| 3 | JGI25152J39213_1008113 | 3300002773 | Bacteria | 2639 |
| 4 | JGI25152J39213_1010246 | 3300002773 | Bacteria | 2161 |
| 5 | JGI25150J39212_1006776 | 3300002774 | Bacteria | 2340 |
| 6 | JGI25159J45721_1000233 | 3300002987 | Bacteria | 26229 |
| 7 | JGI25406J46586_10037443 | 3300003203 | Bacteria | 1748 |
| 8 | JGI25153J46596_10009427 | 3300003215 | Bacteria | 4538 |
| 9 | JGI25153J46596_10012455 | 3300003215 | Bacteria | 3668 |
| 10 | JGI25160J50197_1004561 | 3300003354 | Bacteria | 5966 |
| 11 | JGI25161J50226_1000079 | 3300003374 | Bacteria | 83375 |
| 12 | Ga0055526_1000231 | 3300003771 | Bacteria | 46760 |
| 13 | Ga0055526_1003394 | 3300003771 | Bacteria | 10136 |
| 14 | Ga0055524_1001230 | 3300003775 | Bacteria | 15132 |
| 15 | Ga0055540_1004428 | 3300003792 | Bacteria | 6338 |
| 16 | Ga0058692_1000687 | 3300003856 | Bacteria | 13920 |
| 17 | Ga0058692_1012959 | 3300003856 | Bacteria | 1956 |
| 18 | Ga0055543_1000031 | 3300004625 | Bacteria | 130583 |
| 19 | Ga0065165_1013656 | 3300005262 | Bacteria | 3212 |
| 20 | Ga0070658_10516307 | 3300005327 | Bacteria | 1033 |
| 21 | Ga0070676_10001102 | 3300005328 | Bacteria | 13494 |
| 22 | Ga0070676_10200924 | 3300005328 | Bacteria | 1307 |
| 23 | Ga0070670_100002568 | 3300005331 | Bacteria | 15005 |
| 24 | Ga0070670_100005641 | 3300005331 | Bacteria | 10561 |
| 25 | Ga0070670_100158384 | 3300005331 | Bacteria | 1962 |
| 26 | Ga0070677_10008646 | 3300005333 | Bacteria | 3433 |
| 27 | Ga0068869_100000152 | 3300005334 | Bacteria | 34316 |
| 28 | Ga0068869_100037437 | 3300005334 | Bacteria | 3449 |
| 29 | Ga0070666_10017401 | 3300005335 | Bacteria | 4607 |
| 30 | Ga0070682_100341303 | 3300005337 | Bacteria | 1113 |
| 31 | Ga0070660_100197583 | 3300005339 | Bacteria | 1631 |
| 32 | Ga0070689_100085509 | 3300005340 | Bacteria | 2480 |
| 33 | Ga0070689_100426000 | 3300005340 | Bacteria | 1125 |
| 34 | Ga0070691_10074316 | 3300005341 | Bacteria | 1654 |
| 35 | Ga0070687_100012742 | 3300005343 | Bacteria | 3722 |
| 36 | Ga0070668_100002160 | 3300005347 | Bacteria | 14394 |
| 37 | Ga0070668_100003108 | 3300005347 | Bacteria | 12256 |
| 38 | Ga0070668_100120494 | 3300005347 | Bacteria | 2096 |
| 39 | Ga0070669_100004064 | 3300005353 | Bacteria | 10590 |
| 40 | Ga0070669_100020654 | 3300005353 | Bacteria | 4704 |
| 41 | Ga0070669_100135810 | 3300005353 | Bacteria | 1891 |
| 42 | Ga0070675_100271435 | 3300005354 | Bacteria | 1488 |
| 43 | Ga0070671_100000803 | 3300005355 | Bacteria | 22698 |
| 44 | Ga0070671_100163002 | 3300005355 | Bacteria | 1884 |
| 45 | Ga0070674_100000274 | 3300005356 | Bacteria | 25095 |
| 46 | Ga0070674_100015585 | 3300005356 | Bacteria | 4749 |
| 47 | Ga0070674_100023054 | 3300005356 | Bacteria | 4022 |
| 48 | Ga0070673_100035055 | 3300005364 | Bacteria | 3803 |
| 49 | Ga0070673_100141932 | 3300005364 | Bacteria | 2027 |
| 50 | Ga0070667_100002820 | 3300005367 | Bacteria | 14999 |
| 51 | Ga0070667_100027156 | 3300005367 | Bacteria | 4764 |
| 52 | Ga0070667_100126214 | 3300005367 | Bacteria | 2230 |
| 53 | Ga0070667_100481237 | 3300005367 | Bacteria | 1136 |
| 54 | Ga0070709_10113379 | 3300005434 | Bacteria | 1826 |
| 55 | Ga0070714_100007015 | 3300005435 | Bacteria | 8732 |
| 56 | Ga0070714_100237339 | 3300005435 | Bacteria | 1682 |
| 57 | Ga0070713_100066957 | 3300005436 | Bacteria | 3022 |
| 58 | Ga0070701_10101595 | 3300005438 | Bacteria | 1594 |
| 59 | Ga0070708_100068532 | 3300005445 | Bacteria | 3189 |
| 60 | Ga0070663_100139203 | 3300005455 | Bacteria | 1851 |
| 61 | Ga0070678_100003193 | 3300005456 | Bacteria | 9096 |
| 62 | Ga0070678_100367367 | 3300005456 | Bacteria | 1241 |
| 63 | Ga0070662_100069348 | 3300005457 | Bacteria | 2594 |
| 64 | Ga0068867_100001459 | 3300005459 | Bacteria | 16391 |
| 65 | Ga0068867_100015097 | 3300005459 | Bacteria | 5476 |
| 66 | Ga0068867_100046200 | 3300005459 | Bacteria | 3197 |
| 67 | Ga0068867_100417150 | 3300005459 | Bacteria | 1136 |
| 68 | Ga0070685_10015815 | 3300005466 | Bacteria | 4011 |
| 69 | Ga0070699_100055573 | 3300005518 | Bacteria | 3427 |
| 70 | Ga0070684_100068444 | 3300005535 | Bacteria | 3120 |
| 71 | Ga0070697_100288301 | 3300005536 | Bacteria | 1410 |
| 72 | Ga0068853_100008837 | 3300005539 | Bacteria | 8104 |
| 73 | Ga0068853_100033048 | 3300005539 | Bacteria | 4386 |
| 74 | Ga0070672_100000202 | 3300005543 | Bacteria | 32978 |
| 75 | Ga0070672_100078159 | 3300005543 | Bacteria | 2647 |
| 76 | Ga0070672_100259984 | 3300005543 | Bacteria | 1464 |
| 77 | Ga0070695_100044773 | 3300005545 | Bacteria | 2819 |
| 78 | Ga0070665_100000982 | 3300005548 | Bacteria | 36142 |
| 79 | Ga0070665_100224300 | 3300005548 | Bacteria | 1880 |
| 80 | Ga0070665_100231409 | 3300005548 | Bacteria | 1848 |
| 81 | Ga0070704_100108511 | 3300005549 | Bacteria | 2108 |
| 82 | Ga0070664_100056757 | 3300005564 | Bacteria | 3327 |
| 83 | Ga0068857_100014270 | 3300005577 | Bacteria | 6922 |
| 84 | Ga0068857_100643060 | 3300005577 | Bacteria | 1005 |
| 85 | Ga0068854_100130973 | 3300005578 | Bacteria | 1915 |
| 86 | Ga0068854_100199582 | 3300005578 | Bacteria | 1572 |
| 87 | Ga0070702_100024230 | 3300005615 | Bacteria | 3235 |
| 88 | Ga0068852_100002427 | 3300005616 | Bacteria | 12829 |
| 89 | Ga0068859_100068581 | 3300005617 | Bacteria | 3581 |
| 90 | Ga0068859_100139254 | 3300005617 | Bacteria | 2500 |
| 91 | Ga0068859_100253316 | 3300005617 | Bacteria | 1851 |
| 92 | Ga0068864_100003353 | 3300005618 | Bacteria | 13243 |
| 93 | Ga0068864_100017389 | 3300005618 | Bacteria | 5996 |
| 94 | Ga0068864_100158740 | 3300005618 | Bacteria | 2054 |
| 95 | Ga0068861_100021528 | 3300005719 | Bacteria | 4634 |
| 96 | Ga0068861_100047283 | 3300005719 | Bacteria | 3247 |
| 97 | Ga0068851_10043974 | 3300005834 | Bacteria | 2253 |
| 98 | Ga0068870_10004685 | 3300005840 | Bacteria | 5908 |
| 99 | Ga0068863_100000894 | 3300005841 | Bacteria | 30053 |
| 100 | Ga0068863_100030297 | 3300005841 | Bacteria | 5168 |
| 101 | Ga0068863_100199696 | 3300005841 | Bacteria | 1923 |
| 102 | Ga0068858_100042333 | 3300005842 | Bacteria | 4223 |
| 103 | Ga0068858_100161103 | 3300005842 | Bacteria | 2112 |
| 104 | Ga0068858_100420897 | 3300005842 | Bacteria | 1285 |
| 105 | Ga0068860_100008238 | 3300005843 | Bacteria | 10374 |
| 106 | Ga0068860_100038831 | 3300005843 | Bacteria | 4555 |
| 107 | Ga0068860_100169022 | 3300005843 | Bacteria | 2111 |
| 108 | Ga0068862_100001435 | 3300005844 | Bacteria | 22006 |
| 109 | Ga0068862_100012376 | 3300005844 | Bacteria | 7054 |
| 110 | Ga0068862_100171736 | 3300005844 | Bacteria | 1941 |
| 111 | Ga0081455_10014294 | 3300005937 | Bacteria | 7789 |
| 112 | Ga0081455_10027925 | 3300005937 | Bacteria | 5162 |
| 113 | Ga0081455_10048549 | 3300005937 | Bacteria | 3666 |
| 114 | Ga0081538_10000697 | 3300005981 | Bacteria | 36894 |
| 115 | Ga0081538_10014451 | 3300005981 | Bacteria | 6181 |
| 116 | Ga0081540_1001984 | 3300005983 | Bacteria | 17080 |
| 117 | Ga0081539_10002187 | 3300005985 | Bacteria | 28690 |
| 118 | Ga0070717_10041594 | 3300006028 | Bacteria | 3747 |
| 119 | Ga0075365_10007019 | 3300006038 | Bacteria | 6267 |
| 120 | Ga0075365_10279633 | 3300006038 | Bacteria | 1174 |
| 121 | Ga0075368_10037922 | 3300006042 | Bacteria | 1885 |
| 122 | Ga0075363_100021301 | 3300006048 | Bacteria | 3262 |
| 123 | Ga0075364_10005843 | 3300006051 | Bacteria | 7184 |
| 124 | Ga0070715_10000633 | 3300006163 | Bacteria | 9317 |
| 125 | Ga0070712_100002594 | 3300006175 | Bacteria | 11168 |
| 126 | Ga0070712_100008343 | 3300006175 | Bacteria | 6514 |
| 127 | Ga0070712_100046579 | 3300006175 | Bacteria | 2998 |
| 128 | Ga0075362_10002160 | 3300006177 | Bacteria | 6508 |
| 129 | Ga0075362_10115924 | 3300006177 | Bacteria | 1265 |
| 130 | Ga0075366_10061453 | 3300006195 | Bacteria | 2233 |
| 131 | Ga0097621_100016521 | 3300006237 | Bacteria | 5580 |
| 132 | Ga0097621_100092828 | 3300006237 | Bacteria | 2529 |
| 133 | Ga0068871_100083825 | 3300006358 | Bacteria | 2644 |
| 134 | Ga0068871_100106999 | 3300006358 | Bacteria | 2348 |
| 135 | Ga0075428_100001309 | 3300006844 | Bacteria | 26388 |
| 136 | Ga0075428_100126415 | 3300006844 | Bacteria | 2782 |
| 137 | Ga0075430_100067822 | 3300006846 | Bacteria | 2994 |
| 138 | Ga0075431_100000481 | 3300006847 | Bacteria | 33062 |
| 139 | Ga0075431_100438732 | 3300006847 | Bacteria | 1303 |
| 140 | Ga0075431_100700148 | 3300006847 | Bacteria | 991 |
| 141 | Ga0075433_10021177 | 3300006852 | Bacteria | 5449 |
| 142 | Ga0075434_100003619 | 3300006871 | Bacteria | 13794 |
| 143 | Ga0075434_100021500 | 3300006871 | Bacteria | 6271 |
| 144 | Ga0075434_100496375 | 3300006871 | Bacteria | 1241 |
| 145 | Ga0075429_100004654 | 3300006880 | Bacteria | 11805 |
| 146 | Ga0075429_100224127 | 3300006880 | Bacteria | 1647 |
| 147 | Ga0068865_100156227 | 3300006881 | Bacteria | 1735 |
| 148 | Ga0097620_100068573 | 3300006931 | Bacteria | 3581 |
| 149 | Ga0097620_100139255 | 3300006931 | Bacteria | 2500 |
| 150 | Ga0097620_100253315 | 3300006931 | Bacteria | 1851 |
| 151 | Ga0075435_100020522 | 3300007076 | Bacteria | 5065 |
| 152 | Ga0099794_10041774 | 3300007265 | Bacteria | 2184 |
| 153 | Ga0105244_10032024 | 3300009036 | Bacteria | 2788 |
| 154 | Ga0105240_10306224 | 3300009093 | Bacteria | 1816 |
| 155 | Ga0111539_10002444 | 3300009094 | Bacteria | 24696 |
| 156 | Ga0111539_10012307 | 3300009094 | Bacteria | 10722 |
| 157 | Ga0111539_10067267 | 3300009094 | Bacteria | 4231 |
| 158 | Ga0111539_10098515 | 3300009094 | Bacteria | 3434 |
| 159 | Ga0111539_10400919 | 3300009094 | Bacteria | 1598 |
| 160 | Ga0111539_10430116 | 3300009094 | Bacteria | 1537 |
| 161 | Ga0111539_11106651 | 3300009094 | Bacteria | 920 |
| 162 | Ga0105245_10063592 | 3300009098 | Bacteria | 3332 |
| 163 | Ga0105247_10006956 | 3300009101 | Bacteria | 6965 |
| 164 | Ga0105247_10069980 | 3300009101 | Bacteria | 2191 |
| 165 | Ga0114129_10001244 | 3300009147 | Bacteria | 33939 |
| 166 | Ga0114129_10265891 | 3300009147 | Bacteria | 2296 |
| 167 | Ga0114129_10494395 | 3300009147 | Bacteria | 1598 |
| 168 | Ga0114129_10729392 | 3300009147 | Bacteria | 1271 |
| 169 | Ga0105243_10143768 | 3300009148 | Bacteria | 2038 |
| 170 | Ga0105243_10227222 | 3300009148 | Bacteria | 1653 |
| 171 | Ga0105243_10302999 | 3300009148 | Bacteria | 1449 |
| 172 | Ga0105248_10028785 | 3300009177 | Bacteria | 6192 |
| 173 | Ga0105248_10883544 | 3300009177 | Bacteria | 1009 |
| 174 | Ga0105248_10889784 | 3300009177 | Bacteria | 1005 |
| 175 | Ga0105238_10102421 | 3300009551 | Bacteria | 2845 |
| 176 | Ga0105246_10184631 | 3300011119 | Bacteria | 1609 |
| 177 | Ga0157370_10144693 | 3300013104 | Bacteria | 2214 |
| 178 | Ga0171462_1027 | 3300013250 | Bacteria | 113319 |
| 179 | Ga0157378_10073746 | 3300013297 | Bacteria | 3069 |
| 180 | Ga0157378_10095706 | 3300013297 | Bacteria | 2705 |
| 181 | Ga0157378_10161676 | 3300013297 | Bacteria | 2094 |
| 182 | Ga0157378_10258259 | 3300013297 | Bacteria | 1670 |
| 183 | Ga0157378_10542255 | 3300013297 | Bacteria | 1167 |
| 184 | Ga0163162_10051729 | 3300013306 | Bacteria | 4122 |
| 185 | Ga0157375_10001479 | 3300013308 | Bacteria | 20180 |
| 186 | Ga0157375_10020299 | 3300013308 | Bacteria | 6066 |
| 187 | Ga0157375_10415128 | 3300013308 | Bacteria | 1512 |
| 188 | Ga0163163_10010522 | 3300014325 | Bacteria | 8323 |
| 189 | Ga0163163_10023407 | 3300014325 | Bacteria | 5863 |
| 190 | Ga0163163_10083633 | 3300014325 | Bacteria | 3197 |
| 191 | Ga0163163_10215798 | 3300014325 | Bacteria | 1967 |
| 192 | Ga0157380_10184102 | 3300014326 | Bacteria | 1838 |
| 193 | Ga0157380_10882148 | 3300014326 | Bacteria | 919 |
| 194 | Ga0157377_10050622 | 3300014745 | Bacteria | 2340 |
| 195 | Ga0157379_10008008 | 3300014968 | Bacteria | 9167 |
| 196 | Ga0157379_10250652 | 3300014968 | Bacteria | 1607 |
| 197 | Ga0157376_10032604 | 3300014969 | Bacteria | 4184 |
| 198 | Ga0157376_10110941 | 3300014969 | Bacteria | 2414 |
| 199 | Ga0163161_10077002 | 3300017792 | Bacteria | 2449 |
| 200 | Ga0163161_10109152 | 3300017792 | Bacteria | 2067 |
| 201 | Ga0213876_10050262 | 3300021384 | Bacteria | 2203 |
| 202 | Ga0213875_10001420 | 3300021388 | Bacteria | 15553 |
| 203 | Ga0209436_100094 | 3300025208 | Bacteria | 43814 |
| 204 | Ga0207425_1001536 | 3300025245 | Bacteria | 9473 |
| 205 | Ga0207425_1021386 | 3300025245 | Bacteria | 1372 |
| 206 | Ga0209129_1000862 | 3300025258 | Bacteria | 18900 |
| 207 | Ga0209129_1007118 | 3300025258 | Bacteria | 3412 |
| 208 | Ga0209673_1033222 | 3300025273 | Bacteria | 1577 |
| 209 | Ga0209130_1000023 | 3300025284 | Bacteria | 359355 |
| 210 | Ga0209025_1014429 | 3300025294 | Bacteria | 4855 |
| 211 | Ga0209564_1000023 | 3300025295 | Bacteria | 555102 |
| 212 | Ga0209564_1003021 | 3300025295 | Bacteria | 12012 |
| 213 | Ga0209758_1000422 | 3300025297 | Bacteria | 71804 |
| 214 | Ga0209758_1005087 | 3300025297 | Bacteria | 10411 |
| 215 | Ga0209758_1046377 | 3300025297 | Bacteria | 1568 |
| 216 | Ga0209758_1047686 | 3300025297 | Bacteria | 1530 |
| 217 | Ga0209256_1000234 | 3300025299 | Bacteria | 99080 |
| 218 | Ga0207426_1000087 | 3300025302 | Bacteria | 288870 |
| 219 | Ga0209051_1005845 | 3300025303 | Bacteria | 7076 |
| 220 | Ga0207682_10001271 | 3300025893 | Bacteria | 11579 |
| 221 | Ga0207682_10005559 | 3300025893 | Bacteria | 5128 |
| 222 | Ga0207710_10065845 | 3300025900 | Bacteria | 1652 |
| 223 | Ga0207710_10146899 | 3300025900 | Bacteria | 1142 |
| 224 | Ga0207688_10006266 | 3300025901 | Bacteria | 6477 |
| 225 | Ga0207688_10010921 | 3300025901 | Bacteria | 4941 |
| 226 | Ga0207680_10010358 | 3300025903 | Bacteria | 4662 |
| 227 | Ga0207647_10044939 | 3300025904 | Bacteria | 2758 |
| 228 | Ga0207645_10000242 | 3300025907 | Bacteria | 45222 |
| 229 | Ga0207645_10039127 | 3300025907 | Bacteria | 3039 |
| 230 | Ga0207645_10089906 | 3300025907 | Bacteria | 1975 |
| 231 | Ga0207643_10006014 | 3300025908 | Bacteria | 6486 |
| 232 | Ga0207643_10023880 | 3300025908 | Bacteria | 3373 |
| 233 | Ga0207643_10164289 | 3300025908 | Bacteria | 1337 |
| 234 | Ga0207705_10260400 | 3300025909 | Bacteria | 1324 |
| 235 | Ga0207684_10011372 | 3300025910 | Bacteria | 7790 |
| 236 | Ga0207654_10277529 | 3300025911 | Bacteria | 1132 |
| 237 | Ga0207671_10488344 | 3300025914 | Bacteria | 982 |
| 238 | Ga0207693_10000855 | 3300025915 | Bacteria | 27188 |
| 239 | Ga0207693_10007507 | 3300025915 | Bacteria | 8954 |
| 240 | Ga0207693_10069366 | 3300025915 | Bacteria | 2759 |
| 241 | Ga0207693_10102320 | 3300025915 | Bacteria | 2247 |
| 242 | Ga0207693_10184416 | 3300025915 | Bacteria | 1643 |
| 243 | Ga0207662_10009537 | 3300025918 | Bacteria | 5347 |
| 244 | Ga0207657_10045501 | 3300025919 | Bacteria | 3851 |
| 245 | Ga0207681_10004880 | 3300025923 | Bacteria | 8243 |
| 246 | Ga0207681_10088247 | 3300025923 | Bacteria | 2208 |
| 247 | Ga0207694_10263094 | 3300025924 | Bacteria | 1413 |
| 248 | Ga0207650_10062197 | 3300025925 | Bacteria | 2789 |
| 249 | Ga0207650_10218648 | 3300025925 | Bacteria | 1532 |
| 250 | Ga0207659_10109731 | 3300025926 | Bacteria | 2095 |
| 251 | Ga0207659_10338537 | 3300025926 | Bacteria | 1245 |
| 252 | Ga0207700_10209837 | 3300025928 | Bacteria | 1646 |
| 253 | Ga0207644_10003418 | 3300025931 | Bacteria | 10251 |
| 254 | Ga0207706_10008768 | 3300025933 | Bacteria | 9309 |
| 255 | Ga0207706_10038152 | 3300025933 | Bacteria | 4262 |
| 256 | Ga0207669_10002721 | 3300025937 | Bacteria | 7570 |
| 257 | Ga0207669_10034073 | 3300025937 | Bacteria | 2881 |
| 258 | Ga0207669_10258778 | 3300025937 | Bacteria | 1300 |
| 259 | Ga0207704_10006650 | 3300025938 | Bacteria | 5411 |
| 260 | Ga0207704_10086677 | 3300025938 | Bacteria | 2043 |
| 261 | Ga0207704_10205458 | 3300025938 | Bacteria | 1445 |
| 262 | Ga0207691_10000084 | 3300025940 | Bacteria | 80075 |
| 263 | Ga0207691_10095536 | 3300025940 | Bacteria | 2658 |
| 264 | Ga0207711_10252352 | 3300025941 | Bacteria | 1620 |
| 265 | Ga0207689_10000946 | 3300025942 | Bacteria | 27914 |
| 266 | Ga0207689_10005950 | 3300025942 | Bacteria | 10794 |
| 267 | Ga0207667_10145792 | 3300025949 | Bacteria | 2437 |
| 268 | Ga0207651_10005933 | 3300025960 | Bacteria | 6325 |
| 269 | Ga0207651_10130394 | 3300025960 | Bacteria | 1923 |
| 270 | Ga0207651_10288740 | 3300025960 | Bacteria | 1359 |
| 271 | Ga0207712_10280986 | 3300025961 | Bacteria | 1359 |
| 272 | Ga0207668_10013196 | 3300025972 | Bacteria | 5079 |
| 273 | Ga0207668_10161101 | 3300025972 | Bacteria | 1748 |
| 274 | Ga0207640_10505692 | 3300025981 | Bacteria | 1007 |
| 275 | Ga0207658_10014338 | 3300025986 | Bacteria | 5428 |
| 276 | Ga0207658_10377136 | 3300025986 | Bacteria | 1241 |
| 277 | Ga0207703_10000292 | 3300026035 | Bacteria | 54983 |
| 278 | Ga0207703_10029948 | 3300026035 | Bacteria | 4297 |
| 279 | Ga0207703_10563959 | 3300026035 | Bacteria | 1075 |
| 280 | Ga0207639_10009290 | 3300026041 | Bacteria | 6780 |
| 281 | Ga0207678_10049460 | 3300026067 | Bacteria | 3633 |
| 282 | Ga0207678_10154229 | 3300026067 | Bacteria | 1961 |
| 283 | Ga0207708_10140114 | 3300026075 | Bacteria | 1896 |
| 284 | Ga0207702_10194210 | 3300026078 | Bacteria | 1878 |
| 285 | Ga0207641_10001732 | 3300026088 | Bacteria | 21075 |
| 286 | Ga0207641_10234444 | 3300026088 | Bacteria | 1707 |
| 287 | Ga0207641_10255903 | 3300026088 | Bacteria | 1637 |
| 288 | Ga0207648_10000840 | 3300026089 | Bacteria | 34588 |
| 289 | Ga0207648_10001002 | 3300026089 | Bacteria | 31804 |
| 290 | Ga0207648_10002006 | 3300026089 | Bacteria | 22204 |
| 291 | Ga0207648_10037903 | 3300026089 | Bacteria | 4243 |
| 292 | Ga0207676_10001008 | 3300026095 | Bacteria | 21634 |
| 293 | Ga0207676_10029108 | 3300026095 | Bacteria | 4132 |
| 294 | Ga0207676_10080947 | 3300026095 | Bacteria | 2637 |
| 295 | Ga0207674_10015916 | 3300026116 | Bacteria | 8242 |
| 296 | Ga0207674_10032353 | 3300026116 | Bacteria | 5487 |
| 297 | Ga0207674_10138180 | 3300026116 | Bacteria | 2398 |
| 298 | Ga0207675_100001191 | 3300026118 | Bacteria | 25904 |
| 299 | Ga0207675_100002492 | 3300026118 | Bacteria | 18230 |
| 300 | Ga0207675_100016216 | 3300026118 | Bacteria | 6955 |
| 301 | Ga0207683_10000003 | 3300026121 | Bacteria | 191866 |
| 302 | Ga0207683_10007445 | 3300026121 | Bacteria | 9387 |
| 303 | Ga0207683_10016614 | 3300026121 | Bacteria | 6264 |
| 304 | Ga0209371_1000064 | 3300027312 | Bacteria | 218637 |
| 305 | Ga0209371_1000163 | 3300027312 | Bacteria | 100853 |
| 306 | Ga0209371_1002971 | 3300027312 | Bacteria | 8816 |
| 307 | Ga0209588_1027072 | 3300027671 | Bacteria | 1823 |
| 308 | Ga0207428_10006807 | 3300027907 | Bacteria | 10483 |
| 309 | Ga0207428_10052817 | 3300027907 | Bacteria | 3243 |
| 310 | Ga0207428_10277303 | 3300027907 | Bacteria | 1245 |
| 311 | Ga0268266_10064760 | 3300028379 | Bacteria | 3158 |
| 312 | Ga0268266_10107834 | 3300028379 | Bacteria | 2463 |
| 313 | Ga0268265_10001824 | 3300028380 | Bacteria | 17021 |
| 314 | Ga0268265_10194524 | 3300028380 | Bacteria | 1754 |
| 315 | Ga0268264_10000854 | 3300028381 | Bacteria | 32463 |
| 316 | Ga0268264_10025144 | 3300028381 | Bacteria | 4864 |
| 317 | Ga0268264_10050111 | 3300028381 | Bacteria | 3476 |
| 318 | Ga0268264_10129119 | 3300028381 | Bacteria | 2238 |
| 319 | Ga0268264_10228348 | 3300028381 | Bacteria | 1717 |
| 320 | Ga0307515_10011947 | 3300028794 | Bacteria | 16402 |
| 321 | Ga0307515_10106705 | 3300028794 | Bacteria | 3319 |
| 322 | Ga0265338_10009857 | 3300028800 | Bacteria | 11314 |
| 323 | Ga0268256_1000028 | 3300030500 | Bacteria | 433179 |
| 324 | Ga0268256_1002480 | 3300030500 | Bacteria | 9372 |
| 325 | Ga0265762_1012367 | 3300030760 | Bacteria | 1531 |
| 326 | Ga0265325_10014195 | 3300031241 | Bacteria | 4509 |
| 327 | Ga0265329_10021321 | 3300031242 | Bacteria | 2177 |
| 328 | Ga0265340_10050215 | 3300031247 | Bacteria | 2024 |
| 329 | Ga0265339_10000067 | 3300031249 | Bacteria | 91730 |
| 330 | Ga0265339_10069992 | 3300031249 | Bacteria | 1872 |
| 331 | Ga0265339_10152998 | 3300031249 | Bacteria | 1165 |
| 332 | Ga0265316_10057397 | 3300031344 | Bacteria | 3036 |
| 333 | Ga0265316_10302160 | 3300031344 | Bacteria | 1165 |
| 334 | Ga0307513_10291226 | 3300031456 | Bacteria | 1404 |
| 335 | Ga0307408_100341803 | 3300031548 | Bacteria | 1267 |
| 336 | Ga0265313_10000054 | 3300031595 | Bacteria | 110199 |
| 337 | Ga0265314_10014038 | 3300031711 | Bacteria | 6436 |
| 338 | Ga0307409_100252442 | 3300031995 | Bacteria | 1613 |
| 339 | Ga0307414_10318480 | 3300032004 | Bacteria | 1323 |
| 340 | Ga0307411_10197171 | 3300032005 | Bacteria | 1543 |
| 341 | Ga0307411_10288430 | 3300032005 | Bacteria | 1310 |
| 342 | Ga0373930_0033775 | 3300034816 | Bacteria | 1063 |
| 343 | Ga0373934_0000167 | 3300035086 | Bacteria | 23997 |
| 344 | Ga0373934_0011751 | 3300035086 | Bacteria | 3298 |
| 345 | Ga0373934_0026423 | 3300035086 | Bacteria | 2252 |
| 346 | Ga0373944_0012413 | 3300035089 | Bacteria | 2347 |
| 347 | Ga0373923_0056335 | 3300035111 | Bacteria | 1659 |
| 348 | Ga0373936_0006658 | 3300035113 | Bacteria | 4350 |
| 349 | Ga0373945_0000969 | 3300035116 | Bacteria | 8556 |
| 350 | Ga0373945_0006884 | 3300035116 | Bacteria | 3675 |
| 351 | Ga0373953_0135373 | 3300035117 | Bacteria | 1052 |
| 352 | Ga0373954_0003678 | 3300035118 | Bacteria | 6531 |
| 353 | Ga0373954_0042470 | 3300035118 | Bacteria | 2120 |
| 354 | Ga0373954_0063796 | 3300035118 | Bacteria | 1741 |
| 355 | Ga0373956_0000005 | 3300035119 | Bacteria | 69067 |
| 356 | Ga0373956_0017636 | 3300035119 | Bacteria | 3012 |
| 357 | Ga0373957_0001547 | 3300035120 | Bacteria | 6270 |
| 358 | Ga0373960_0090861 | 3300035121 | Bacteria | 976 |
| 359 | Ga0373943_0000185 | 3300035170 | Bacteria | 24985 |
| 360 | Ga0373943_0029216 | 3300035170 | Bacteria | 2604 |
| 361 | Ga0373946_0000642 | 3300035171 | Bacteria | 11673 |
| 362 | Ga0373946_0020381 | 3300035171 | Bacteria | 2562 |
| 363 | Ga0373946_0053302 | 3300035171 | Bacteria | 1698 |
| 364 | Ga0373955_0001424 | 3300035172 | Bacteria | 10177 |
| 365 | Ga0373955_0002275 | 3300035172 | Bacteria | 8339 |
| 366 | Ga0373955_0021411 | 3300035172 | Bacteria | 3263 |
| 367 | Ga0373955_0094832 | 3300035172 | Bacteria | 1706 |
| 368 | Ga0373942_0003621 | 3300035207 | Bacteria | 3623 |
| 369 | Ga0373962_0061586 | 3300035242 | Bacteria | 1103 |
| 370 | Ga0373924_0017153 | 3300035410 | Bacteria | 2774 |
| 371 | Ga0373924_0024311 | 3300035410 | Bacteria | 2386 |
| 372 | Ga0373924_0035283 | 3300035410 | Bacteria | 2028 |
| 373 | Ga0373931_0145414 | 3300035691 | Bacteria | 1377 |
| 374 | Ga0373927_0000434 | 3300035695 | Bacteria | 32038 |
| 375 | Ga0373927_0041103 | 3300035695 | Bacteria | 2999 |
| 376 | Ga0373927_0088315 | 3300035695 | Bacteria | 2012 |
| 377 | Ga0373933_0000447 | 3300035724 | Bacteria | 25787 |
| 378 | Ga0373933_0000883 | 3300035724 | Bacteria | 18320 |
| 379 | Ga0373933_0003022 | 3300035724 | Bacteria | 9384 |
| 380 | Ga0373947_0000583 | 3300035725 | Bacteria | 21422 |
| 381 | Ga0373947_0019759 | 3300035725 | Bacteria | 3886 |
| 382 | Ga0373937_0000912 | 3300036401 | Bacteria | 25128 |
| 383 | Ga0373937_0004251 | 3300036401 | Bacteria | 12135 |
| 384 | Ga0373937_0009273 | 3300036401 | Bacteria | 8543 |
| 385 | Ga0373925_0328633 | 3300037068 | Bacteria | 1238 |
| 386 | Ga0373925_0368428 | 3300037068 | Bacteria | 1168 |
| 387 | Ga0395899_0264174 | 3300037312 | Bacteria | 1176 |
| 388 | Ga0395900_0334282 | 3300037418 | Bacteria | 1492 |
| 389 | Ga0395898_0109219 | 3300037466 | Bacteria | 2652 |
| 390 | Ga0436364_0125248 | 3300037853 | Bacteria | 2636 |
| 391 | Ga0436364_1334518 | 3300037853 | Bacteria | 1662 |
| 392 | Ga0395901_0083724 | 3300038443 | Bacteria | 3334 |
| 393 | Ga0395901_0461538 | 3300038443 | Bacteria | 1298 |
| 394 | Ga0436365_0523999 | 3300039437 | Bacteria | 2674 |
| 395 | Ga0436365_1280225 | 3300039437 | Bacteria | 1081 |
| 396 | Ga0436361_0089618 | 3300039447 | Bacteria | 1028 |
| 397 | Ga0436361_1189219 | 3300039447 | Bacteria | 3567 |
| 398 | Ga0436362_0430762 | 3300039453 | Bacteria | 3666 |
| 399 | Ga0439453_0008905 | 3300041408 | Bacteria | 1623 |
| 400 | Ga0439465_0004447 | 3300041413 | Bacteria | 4537 |
| 401 | Ga0439465_0017288 | 3300041413 | Bacteria | 2251 |
| 402 | Ga0451853_2675021 | 3300041512 | Bacteria | 1600 |
| 403 | Ga0439443_003461 | 3300042003 | Bacteria | 1990 |
| 404 | Ga0439452_026510 | 3300042010 | Bacteria | 1462 |
| 405 | Ga0439462_0010941 | 3300042015 | Bacteria | 2305 |
| 406 | Ga0439462_0032598 | 3300042015 | Bacteria | 1381 |
| 407 | Ga0439446_0052905 | 3300042156 | Bacteria | 1216 |
| 408 | Ga0439435_0029550 | 3300042436 | Bacteria | 1480 |
| 409 | Ga0466966_0162429 | 3300044684 | Bacteria | 1360 |
| 410 | Ga0466963_0053084 | 3300044694 | Bacteria | 2691 |
| 411 | Ga0466963_0150527 | 3300044694 | Bacteria | 1615 |
| 412 | Ga0453684_0386395 | 3300044712 | Bacteria | 1571 |
| 413 | Ga0466967_0138012 | 3300045976 | Bacteria | 2269 |
| 414 | Ga0495617_033101 | 3300046452 | Bacteria | 1735 |
| 415 | Ga0495627_021698 | 3300046453 | Bacteria | 2125 |
| 416 | Ga0495592_0002231 | 3300046454 | Bacteria | 13664 |
| 417 | Ga0495603_0069424 | 3300046455 | Bacteria | 2072 |
| 418 | Ga0495629_0016538 | 3300046459 | Bacteria | 5295 |
| 419 | Ga0495638_0016019 | 3300046460 | Bacteria | 5024 |
| 420 | Ga0495651_0000479 | 3300046462 | Bacteria | 30785 |
| 421 | Ga0495651_0000878 | 3300046462 | Bacteria | 23362 |
| 422 | Ga0495653_0000553 | 3300046463 | Bacteria | 28588 |
| 423 | Ga0495653_0039412 | 3300046463 | Bacteria | 3701 |
| 424 | Ga0495582_0037901 | 3300046473 | Bacteria | 2652 |
| 425 | Ga0495605_0089502 | 3300046474 | Bacteria | 1428 |
| 426 | Ga0495605_0150021 | 3300046474 | Bacteria | 1041 |
| 427 | Ga0495639_0006397 | 3300046475 | Bacteria | 5066 |
| 428 | Ga0495662_0008076 | 3300046476 | Bacteria | 5186 |
| 429 | Ga0495664_0001762 | 3300046477 | Bacteria | 11503 |
| 430 | Ga0495594_0077678 | 3300046499 | Bacteria | 1852 |
| 431 | Ga0495596_0024596 | 3300046500 | Bacteria | 2438 |
| 432 | Ga0495583_0031569 | 3300046506 | Bacteria | 2567 |
| 433 | Ga0495608_0000376 | 3300046511 | Bacteria | 31189 |
| 434 | Ga0495610_0040813 | 3300046512 | Bacteria | 2335 |
| 435 | Ga0495618_0046090 | 3300046514 | Bacteria | 2751 |
| 436 | Ga0495620_0048516 | 3300046515 | Bacteria | 1822 |
| 437 | Ga0495628_0119219 | 3300046516 | Bacteria | 2025 |
| 438 | Ga0495630_0117972 | 3300046517 | Bacteria | 2012 |
| 439 | Ga0495630_0140463 | 3300046517 | Bacteria | 1836 |
| 440 | Ga0495643_0054560 | 3300046522 | Bacteria | 2139 |
| 441 | Ga0495643_0212144 | 3300046522 | Bacteria | 923 |
| 442 | Ga0495644_0131642 | 3300046523 | Bacteria | 953 |
| 443 | Ga0495663_0088599 | 3300046525 | Bacteria | 1006 |
| 444 | Ga0495666_0119974 | 3300046526 | Bacteria | 1232 |
| 445 | Ga0495652_0006143 | 3300046529 | Bacteria | 11225 |
| 446 | Ga0495665_0013808 | 3300046531 | Bacteria | 4362 |
| 447 | Ga0495665_0133575 | 3300046531 | Bacteria | 1299 |
| 448 | Ga0495640_0016106 | 3300046533 | Bacteria | 5599 |
| 449 | Ga0495586_0027821 | 3300046535 | Bacteria | 3025 |
| 450 | Ga0495587_0001125 | 3300046536 | Bacteria | 17493 |
| 451 | Ga0495598_0089923 | 3300046537 | Bacteria | 999 |
| 452 | Ga0495645_0010377 | 3300046543 | Bacteria | 6527 |
| 453 | Ga0495667_0000294 | 3300046559 | Bacteria | 32145 |
| 454 | Ga0495667_0037649 | 3300046559 | Bacteria | 3223 |
| 455 | Ga0495656_0054467 | 3300046615 | Bacteria | 1721 |
| 456 | Ga0495634_0033547 | 3300046642 | Bacteria | 3527 |
| 457 | Ga0495611_0105323 | 3300046648 | Bacteria | 1312 |
| 458 | Ga0495635_0000880 | 3300046663 | Bacteria | 19715 |
| 459 | Ga0495635_0005117 | 3300046663 | Bacteria | 9119 |
| 460 | Ga0495635_0192986 | 3300046663 | Bacteria | 1382 |
| 461 | Ga0495657_0021192 | 3300046675 | Bacteria | 4665 |
| 462 | Ga0495657_0133733 | 3300046675 | Bacteria | 1551 |
| 463 | Ga0495599_0004220 | 3300046678 | Bacteria | 8490 |
| 464 | Ga0495623_0001907 | 3300046679 | Bacteria | 13995 |
| 465 | Ga0495647_0130526 | 3300046681 | Bacteria | 1064 |
| 466 | Ga0495658_0006634 | 3300046683 | Bacteria | 5688 |
| 467 | Ga0495613_0032385 | 3300046689 | Bacteria | 3883 |
| 468 | Ga0495670_0143255 | 3300046691 | Bacteria | 1251 |
| 469 | Ga0495600_0003489 | 3300046809 | Bacteria | 9244 |
| 470 | Ga0495600_0050142 | 3300046809 | Bacteria | 2724 |
| 471 | Ga0495600_0116845 | 3300046809 | Bacteria | 1736 |
| 472 | Ga0495660_0141454 | 3300046810 | Bacteria | 1197 |
| 473 | Ga0495581_0029496 | 3300047315 | Bacteria | 3179 |
| 474 | Ga0495581_0036697 | 3300047315 | Bacteria | 2836 |
| 475 | Ga0495604_0000972 | 3300047317 | Bacteria | 23909 |
| 476 | Ga0495674_0009055 | 3300047319 | Bacteria | 9455 |
| 477 | Ga0495676_0004556 | 3300047321 | Bacteria | 12679 |
| 478 | Ga0495680_0003955 | 3300047322 | Bacteria | 14330 |
| 479 | Ga0495675_0019173 | 3300047444 | Bacteria | 4346 |
| 480 | Ga0495675_0150212 | 3300047444 | Bacteria | 1440 |
| 481 | Ga0495685_074652 | 3300047447 | Bacteria | 1133 |
| 482 | Ga0495684_0075695 | 3300047471 | Bacteria | 2557 |
| 483 | Ga0495593_0019912 | 3300047673 | Bacteria | 3759 |
| 484 | Ga0495593_0092449 | 3300047673 | Bacteria | 1557 |
| 485 | Ga0495602_0014347 | 3300048088 | Bacteria | 8047 |
| 486 | Ga0495602_0184344 | 3300048088 | Bacteria | 1607 |
| 487 | Ga0495615_0009871 | 3300048090 | Bacteria | 1890 |
| 488 | Ga0496100_0005463 | 3300048903 | Bacteria | 6850 |
| 489 | Ga0496100_0065103 | 3300048903 | Bacteria | 2414 |
| 490 | Ga0496101_0001025 | 3300048904 | Bacteria | 16469 |
| 491 | Ga0496102_0006587 | 3300048905 | Bacteria | 9920 |
| 492 | Ga0496102_0010694 | 3300048905 | Bacteria | 7904 |
| 493 | Ga0496103_0008670 | 3300048906 | Bacteria | 6039 |
| 494 | Ga0496104_0002070 | 3300048907 | Bacteria | 17419 |
| 495 | Ga0496104_0003048 | 3300048907 | Bacteria | 14438 |
| 496 | Ga0496104_0004791 | 3300048907 | Bacteria | 11784 |
| 497 | Ga0496105_0005922 | 3300048908 | Bacteria | 9329 |
| 498 | Ga0496105_0441541 | 3300048908 | Bacteria | 1028 |
| 499 | Ga0496106_0037412 | 3300048909 | Bacteria | 3631 |
| 500 | Ga0496106_0272003 | 3300048909 | Bacteria | 1356 |
| 501 | Ga0496107_0007469 | 3300048910 | Bacteria | 7535 |
| 502 | Ga0496108_0000256 | 3300048911 | Bacteria | 46076 |
| 503 | Ga0496108_0002364 | 3300048911 | Bacteria | 15107 |
| 504 | Ga0496108_0141800 | 3300048911 | Bacteria | 2070 |
| 505 | Ga0496109_0001401 | 3300048912 | Bacteria | 19982 |
| 506 | Ga0496109_0002461 | 3300048912 | Bacteria | 15523 |
| 507 | Ga0496109_0022323 | 3300048912 | Bacteria | 5605 |
| 508 | Ga0496109_0047344 | 3300048912 | Bacteria | 3909 |
| 509 | Ga0496110_0003528 | 3300048913 | Bacteria | 12009 |
| 510 | Ga0496110_0011641 | 3300048913 | Bacteria | 7212 |
| 511 | Ga0496110_0037760 | 3300048913 | Bacteria | 4199 |
| 512 | Ga0496110_0158270 | 3300048913 | Bacteria | 2053 |
| 513 | Ga0496111_0003518 | 3300048914 | Bacteria | 9693 |
| 514 | Ga0496111_0477043 | 3300048914 | Bacteria | 919 |
| 515 | Ga0496112_0002247 | 3300048915 | Bacteria | 15427 |
| 516 | Ga0496112_0008922 | 3300048915 | Bacteria | 9001 |
| 517 | Ga0496112_0107598 | 3300048915 | Bacteria | 2758 |
| 518 | Ga0496112_0231771 | 3300048915 | Bacteria | 1801 |
| 519 | Ga0496112_0487108 | 3300048915 | Bacteria | 1169 |
| 520 | Ga0496112_0513845 | 3300048915 | Bacteria | 1133 |
| 521 | Ga0496113_0000175 | 3300048916 | Bacteria | 28436 |
| 522 | Ga0496113_0001647 | 3300048916 | Bacteria | 12592 |
| 523 | Ga0496113_0187648 | 3300048916 | Bacteria | 1640 |
| 524 | Ga0496114_0305233 | 3300048917 | Bacteria | 1405 |
| 525 | Ga0496115_0059335 | 3300048918 | Bacteria | 3081 |
| 526 | Ga0496115_0247874 | 3300048918 | Bacteria | 1467 |
| 527 | Ga0496115_0305467 | 3300048918 | Bacteria | 1303 |
| 528 | Ga0496115_0372882 | 3300048918 | Bacteria | 1161 |
| 529 | Ga0496116_0019351 | 3300048919 | Bacteria | 5214 |
| 530 | Ga0496117_0112305 | 3300048920 | Bacteria | 1694 |
| 531 | Ga0496118_0005218 | 3300048921 | Bacteria | 14858 |
| 532 | Ga0496121_0022335 | 3300048924 | Bacteria | 6146 |
| 533 | Ga0496122_0026166 | 3300048925 | Bacteria | 5041 |
| 534 | Ga0496122_0156620 | 3300048925 | Bacteria | 1397 |
| 535 | Ga0496122_0203611 | 3300048925 | Bacteria | 1154 |
| 536 | Ga0496123_0020537 | 3300048926 | Bacteria | 5163 |
| 537 | Ga0496123_0086856 | 3300048926 | Bacteria | 1873 |
| 538 | Ga0496124_0137628 | 3300048927 | Bacteria | 1931 |
| 539 | Ga0496125_0005483 | 3300048928 | Bacteria | 14077 |
| 540 | Ga0496125_0011871 | 3300048928 | Bacteria | 8678 |
| 541 | Ga0501033_0000059 | 3300049570 | Bacteria | 105311 |
| 542 | Ga0501034_0060021 | 3300049571 | Bacteria | 3820 |
| 543 | Ga0501034_0335244 | 3300049571 | Bacteria | 1443 |
| 544 | Ga0501037_0228626 | 3300049573 | Bacteria | 1306 |
| 545 | Ga0501039_0318958 | 3300049575 | Bacteria | 1222 |
| 546 | Ga0501040_0167152 | 3300049576 | Bacteria | 1557 |
| 547 | Ga0501041_0087700 | 3300049577 | Bacteria | 1921 |
| 548 | Ga0501046_0171128 | 3300049580 | Bacteria | 1630 |
| 549 | Ga0501046_0243746 | 3300049580 | Bacteria | 1325 |
| 550 | Ga0501067_0047581 | 3300049583 | Bacteria | 2379 |
| 551 | Ga0501068_0136724 | 3300049584 | Bacteria | 1535 |
| 552 | Ga0501070_0024591 | 3300049586 | Bacteria | 5050 |
| 553 | Ga0501070_0352213 | 3300049586 | Bacteria | 1195 |
| 554 | Ga0501079_0081607 | 3300049741 | Bacteria | 2501 |
| 555 | Ga0501080_0233049 | 3300049742 | Bacteria | 1682 |
| 556 | Ga0501083_0143757 | 3300049744 | Bacteria | 1562 |
| 557 | Ga0501241_006236 | 3300049758 | Bacteria | 2199 |
| 558 | Ga0501035_0000213 | 3300049822 | Bacteria | 69670 |
| 559 | Ga0501035_0152813 | 3300049822 | Bacteria | 2002 |
| 560 | Ga0501044_0047070 | 3300049823 | Bacteria | 4462 |
| 561 | Ga0501044_0342532 | 3300049823 | Bacteria | 1416 |
| 562 | nmdc:mga03683_104487_c1 | 3300050489 | Bacteria | 1247 |
| 563 | nmdc:mga03683_87817_c1 | 3300050489 | Bacteria | 1352 |
| 564 | nmdc:mga03n38_156733_c1 | 3300050490 | Bacteria | 1150 |
| 565 | nmdc:mga03n38_47199_c1 | 3300050490 | Bacteria | 1905 |
| 566 | nmdc:mga0yw44_36112_c1 | 3300050492 | Bacteria | 2910 |
| 567 | nmdc:mga0yw44_48488_c1 | 3300050492 | Bacteria | 2561 |
| 568 | nmdc:mga0yw44_51691_c1 | 3300050492 | Bacteria | 2489 |
| 569 | nmdc:mga0yw44_91712_c1 | 3300050492 | Bacteria | 1922 |
| 570 | nmdc:mga06z11_219721_c1 | 3300050494 | Bacteria | 1110 |
| 571 | nmdc:mga05p37_28962_c1 | 3300050507 | Bacteria | 6757 |
| 572 | nmdc:mga05p37_408232_c1 | 3300050507 | Bacteria | 1584 |
| 573 | nmdc:mga05p37_528_c1 | 3300050507 | Bacteria | 42336 |
| 574 | nmdc:mga09592_124292_c1 | 3300050508 | Bacteria | 2217 |
| 575 | nmdc:mga09592_185841_c1 | 3300050508 | Bacteria | 1798 |
| 576 | nmdc:mga09592_193588_c1 | 3300050508 | Bacteria | 1760 |
| 577 | nmdc:mga09592_704_c1 | 3300050508 | Bacteria | 25621 |
| 578 | nmdc:mga0qj67_101221_c1 | 3300050509 | Bacteria | 2323 |
| 579 | nmdc:mga0qj67_139917_c1 | 3300050509 | Bacteria | 1962 |
| 580 | nmdc:mga06r32_189063_c1 | 3300050510 | Bacteria | 2046 |
| 581 | nmdc:mga06r32_241_c1 | 3300050510 | Bacteria | 44852 |
| 582 | nmdc:mga08y16_166046_c1 | 3300050511 | Bacteria | 2293 |
| 583 | nmdc:mga08y16_23292_c1 | 3300050511 | Bacteria | 6540 |
| 584 | nmdc:mga08y16_25976_c1 | 3300050511 | Bacteria | 6178 |
| 585 | nmdc:mga08y16_340596_c1 | 3300050511 | Bacteria | 1541 |
| 586 | nmdc:mga08y16_384977_c1 | 3300050511 | Bacteria | 1437 |
| 587 | nmdc:mga08y16_427_c1 | 3300050511 | Bacteria | 38825 |
| 588 | nmdc:mga08y16_83933_c1 | 3300050511 | Bacteria | 3320 |
| 589 | nmdc:mga0n895_12352_c1 | 3300050512 | Bacteria | 7657 |
| 590 | nmdc:mga0n895_12968_c2 | 3300050512 | Bacteria | 5030 |
| 591 | nmdc:mga0n895_320793_c1 | 3300050512 | Bacteria | 1570 |
| 592 | nmdc:mga0n895_7409_c1 | 3300050512 | Bacteria | 9417 |
| 593 | nmdc:mga0rr50_205386_c1 | 3300050513 | Bacteria | 1621 |
| 594 | nmdc:mga0rr50_84520_c1 | 3300050513 | Bacteria | 2457 |
| 595 | nmdc:mga0a205_25125_c1 | 3300050515 | Bacteria | 5672 |
| 596 | nmdc:mga0a205_49071_c1 | 3300050515 | Bacteria | 4073 |
| 597 | nmdc:mga0a205_5012_c1 | 3300050515 | Bacteria | 11924 |
| 598 | nmdc:mga0a205_96567_c1 | 3300050515 | Bacteria | 2854 |
| 599 | nmdc:mga0sz30_111345_c1 | 3300050516 | Bacteria | 1200 |
| 600 | Ga0495601_0001493 | 3300053077 | Bacteria | 12895 |
| 601 | Ga0495601_0015849 | 3300053077 | Bacteria | 4561 |
| 602 | Ga0495601_0019807 | 3300053077 | Bacteria | 4107 |
| 603 | Ga0495601_0060880 | 3300053077 | Bacteria | 2396 |
| 604 | Ga0495612_0001332 | 3300053078 | Bacteria | 10178 |
| 605 | Ga0495612_0009950 | 3300053078 | Bacteria | 3850 |
| 606 | Ga0495595_0000657 | 3300053084 | Bacteria | 13138 |
| 607 | Ga0495595_0008331 | 3300053084 | Bacteria | 4255 |
| 608 | Ga0495619_0000426 | 3300053085 | Bacteria | 28605 |
| 609 | Ga0495619_0002191 | 3300053085 | Bacteria | 12937 |
| 610 | Ga0495619_0004170 | 3300053085 | Bacteria | 9234 |
| 611 | Ga0495619_0038587 | 3300053085 | Bacteria | 3116 |
| 612 | Ga0500643_039304 | 3300053087 | Bacteria | 1398 |
| 613 | Ga0500644_0001423 | 3300053088 | Bacteria | 6351 |
| 614 | Ga0500569_014997 | 3300053109 | Bacteria | 1932 |
| 615 | Ga0500569_027884 | 3300053109 | Bacteria | 1561 |
| 616 | Ga0500658_0144937 | 3300053134 | Bacteria | 1067 |
| 617 | Ga0500568_0008666 | 3300053139 | Bacteria | 4882 |
| 618 | Ga0500616_0010830 | 3300053153 | Bacteria | 5435 |
| 619 | Ga0500622_0000206 | 3300053156 | Bacteria | 62842 |
| 620 | Ga0500622_0006538 | 3300053156 | Bacteria | 6736 |
| 621 | Ga0500627_0086767 | 3300053158 | Bacteria | 1399 |
| 622 | Ga0500634_0080943 | 3300053161 | Unclassified | 1674 |
| 623 | Ga0500636_0001934 | 3300053177 | Bacteria | 11375 |
| 624 | Ga0500645_000051 | 3300053730 | Bacteria | 98521 |
| 625 | Ga0501082_0000205 | 3300060353 | Bacteria | 51540 |
| 626 | Ga0501082_0066377 | 3300060353 | Bacteria | 3107 |
| 627 | Ga0530510_0032448 | 3300061734 | Bacteria | 3758 |
| 628 | Ga0530510_0336436 | 3300061734 | Bacteria | 1133 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049570 | Ga0501033_0000059 | Ga0501033_0000059_62303_63163 | 257 |
| 2 | 3300049583 | Ga0501067_0047581 | Ga0501067_0047581_1574_2347 | 257 |
| 3 | 3300049822 | Ga0501035_0000213 | Ga0501035_0000213_43321_44181 | 257 |
| 4 | 3300035242 | Ga0373962_0061586 | Ga0373962_0061586_303_1079 | 258 |
| 5 | 3300053161 | Ga0500634_0080943 | Ga0500634_0080943_418_1293 | 260 |
| 6 | 3300049758 | Ga0501241_006236 | Ga0501241_006236_496_1353 | 262 |
| 7 | 3300005328 | Ga0070676_10001102 | Ga0070676_1000110214 | 263 |
| 8 | 3300005331 | Ga0070670_100002568 | Ga0070670_1000025689 | 263 |
| 9 | 3300005334 | Ga0068869_100000152 | Ga0068869_10000015217 | 263 |
| 10 | 3300005347 | Ga0070668_100003108 | Ga0070668_10000310810 | 263 |
| 11 | 3300005353 | Ga0070669_100004064 | Ga0070669_10000406410 | 263 |
| 12 | 3300005364 | Ga0070673_100035055 | Ga0070673_1000350555 | 263 |
| 13 | 3300005367 | Ga0070667_100002820 | Ga0070667_1000028203 | 263 |
| 14 | 3300005455 | Ga0070663_100139203 | Ga0070663_1001392031 | 263 |
| 15 | 3300005459 | Ga0068867_100015097 | Ga0068867_1000150973 | 263 |
| 16 | 3300005545 | Ga0070695_100044773 | Ga0070695_1000447731 | 263 |
| 17 | 3300005577 | Ga0068857_100014270 | Ga0068857_1000142708 | 263 |
| 18 | 3300005578 | Ga0068854_100130973 | Ga0068854_1001309732 | 263 |
| 19 | 3300005617 | Ga0068859_100068581 | Ga0068859_1000685813 | 263 |
| 20 | 3300005618 | Ga0068864_100003353 | Ga0068864_1000033533 | 263 |
| 21 | 3300005719 | Ga0068861_100021528 | Ga0068861_1000215283 | 263 |
| 22 | 3300005840 | Ga0068870_10004685 | Ga0068870_100046852 | 263 |
| 23 | 3300005841 | Ga0068863_100000894 | Ga0068863_10000089413 | 263 |
| 24 | 3300005842 | Ga0068858_100161103 | Ga0068858_1001611031 | 263 |
| 25 | 3300005843 | Ga0068860_100008238 | Ga0068860_10000823810 | 263 |
| 26 | 3300005844 | Ga0068862_100001435 | Ga0068862_1000014353 | 263 |
| 27 | 3300006844 | Ga0075428_100001309 | Ga0075428_10000130927 | 263 |
| 28 | 3300006846 | Ga0075430_100067822 | Ga0075430_1000678222 | 263 |
| 29 | 3300006847 | Ga0075431_100000481 | Ga0075431_10000048116 | 263 |
| 30 | 3300006880 | Ga0075429_100004654 | Ga0075429_1000046548 | 263 |
| 31 | 3300006881 | Ga0068865_100156227 | Ga0068865_1001562271 | 263 |
| 32 | 3300006931 | Ga0097620_100068573 | Ga0097620_1000685733 | 263 |
| 33 | 3300009094 | Ga0111539_10002444 | Ga0111539_1000244410 | 263 |
| 34 | 3300009101 | Ga0105247_10006956 | Ga0105247_100069562 | 263 |
| 35 | 3300009147 | Ga0114129_10001244 | Ga0114129_1000124419 | 263 |
| 36 | 3300009148 | Ga0105243_10143768 | Ga0105243_101437681 | 263 |
| 37 | 3300009177 | Ga0105248_10028785 | Ga0105248_100287854 | 263 |
| 38 | 3300014325 | Ga0163163_10023407 | Ga0163163_100234072 | 263 |
| 39 | 3300014968 | Ga0157379_10008008 | Ga0157379_100080081 | 263 |
| 40 | 3300025900 | Ga0207710_10065845 | Ga0207710_100658451 | 263 |
| 41 | 3300025908 | Ga0207643_10006014 | Ga0207643_100060143 | 263 |
| 42 | 3300025923 | Ga0207681_10004880 | Ga0207681_100048802 | 263 |
| 43 | 3300025938 | Ga0207704_10086677 | Ga0207704_100866771 | 263 |
| 44 | 3300025942 | Ga0207689_10000946 | Ga0207689_1000094616 | 263 |
| 45 | 3300025949 | Ga0207667_10145792 | Ga0207667_101457923 | 263 |
| 46 | 3300025960 | Ga0207651_10005933 | Ga0207651_100059334 | 263 |
| 47 | 3300025972 | Ga0207668_10013196 | Ga0207668_100131965 | 263 |
| 48 | 3300025986 | Ga0207658_10014338 | Ga0207658_100143382 | 263 |
| 49 | 3300026035 | Ga0207703_10000292 | Ga0207703_1000029247 | 263 |
| 50 | 3300026067 | Ga0207678_10154229 | Ga0207678_101542292 | 263 |
| 51 | 3300026088 | Ga0207641_10001732 | Ga0207641_1000173211 | 263 |
| 52 | 3300026089 | Ga0207648_10001002 | Ga0207648_1000100216 | 263 |
| 53 | 3300026095 | Ga0207676_10001008 | Ga0207676_100010086 | 263 |
| 54 | 3300026116 | Ga0207674_10015916 | Ga0207674_100159163 | 263 |
| 55 | 3300026118 | Ga0207675_100001191 | Ga0207675_10000119119 | 263 |
| 56 | 3300027907 | Ga0207428_10006807 | Ga0207428_1000680710 | 263 |
| 57 | 3300028380 | Ga0268265_10001824 | Ga0268265_1000182414 | 263 |
| 58 | 3300028381 | Ga0268264_10000854 | Ga0268264_1000085414 | 263 |
| 59 | 3300028794 | Ga0307515_10011947 | Ga0307515_100119477 | 263 |
| 60 | 3300048905 | Ga0496102_0006587 | Ga0496102_0006587_4649_5509 | 263 |
| 61 | 3300048906 | Ga0496103_0008670 | Ga0496103_0008670_3952_4812 | 263 |
| 62 | 3300048912 | Ga0496109_0022323 | Ga0496109_0022323_33_893 | 263 |
| 63 | 3300050507 | nmdc:mga05p37_528_c1 | nmdc:mga05p37_528_c1_36609_37469 | 263 |
| 64 | 3300050508 | nmdc:mga09592_704_c1 | nmdc:mga09592_704_c1_20105_20965 | 263 |
| 65 | 3300050509 | nmdc:mga0qj67_101221_c1 | nmdc:mga0qj67_101221_c1_1098_1958 | 263 |
| 66 | 3300050510 | nmdc:mga06r32_241_c1 | nmdc:mga06r32_241_c1_33472_34332 | 263 |
| 67 | 3300050511 | nmdc:mga08y16_427_c1 | nmdc:mga08y16_427_c1_8358_9218 | 263 |
| 68 | 3300005543 | Ga0070672_100259984 | Ga0070672_1002599842 | 265 |
| 69 | 3300031548 | Ga0307408_100341803 | Ga0307408_1003418032 | 265 |
| 70 | 3300032004 | Ga0307414_10318480 | Ga0307414_103184801 | 265 |
| 71 | 3300032005 | Ga0307411_10288430 | Ga0307411_102884302 | 265 |
| 72 | 3300049823 | Ga0501044_0342532 | Ga0501044_0342532_177_1037 | 265 |
| 73 | 3300013297 | Ga0157378_10095706 | Ga0157378_100957062 | 266 |
| 74 | 3300014325 | Ga0163163_10010522 | Ga0163163_100105224 | 266 |
| 75 | 3300013104 | Ga0157370_10144693 | Ga0157370_101446932 | 271 |
| 76 | 3300013297 | Ga0157378_10073746 | Ga0157378_100737463 | 273 |
| 77 | 3300049586 | Ga0501070_0352213 | Ga0501070_0352213_173_1033 | 273 |
| 78 | 3300005356 | Ga0070674_100015585 | Ga0070674_1000155852 | 274 |
| 79 | 3300005367 | Ga0070667_100027156 | Ga0070667_1000271562 | 274 |
| 80 | 3300005456 | Ga0070678_100003193 | Ga0070678_10000319311 | 274 |
| 81 | 3300005459 | Ga0068867_100417150 | Ga0068867_1004171501 | 274 |
| 82 | 3300005548 | Ga0070665_100000982 | Ga0070665_10000098232 | 274 |
| 83 | 3300025903 | Ga0207680_10010358 | Ga0207680_100103582 | 274 |
| 84 | 3300026035 | Ga0207703_10563959 | Ga0207703_105639591 | 274 |
| 85 | 3300026121 | Ga0207683_10016614 | Ga0207683_100166144 | 274 |
| 86 | 3300028379 | Ga0268266_10107834 | Ga0268266_101078342 | 274 |
| 87 | 3300050513 | nmdc:mga0rr50_205386_c1 | nmdc:mga0rr50_205386_c1_14_838 | 274 |
| 88 | 3300053158 | Ga0500627_0086767 | Ga0500627_0086767_554_1378 | 274 |
| 89 | 3300013297 | Ga0157378_10258259 | Ga0157378_102582592 | 275 |
| 90 | 3300014969 | Ga0157376_10032604 | Ga0157376_100326044 | 275 |
| 91 | 3300049571 | Ga0501034_0060021 | Ga0501034_0060021_2823_3683 | 276 |
| 92 | 3300006852 | Ga0075433_10021177 | Ga0075433_100211775 | 277 |
| 93 | 3300006871 | Ga0075434_100021500 | Ga0075434_1000215002 | 277 |
| 94 | 3300009094 | Ga0111539_10067267 | Ga0111539_100672674 | 277 |
| 95 | 3300027907 | Ga0207428_10277303 | Ga0207428_102773031 | 277 |
| 96 | 3300050511 | nmdc:mga08y16_25976_c1 | nmdc:mga08y16_25976_c1_2162_3022 | 277 |
| 97 | 3300050512 | nmdc:mga0n895_7409_c1 | nmdc:mga0n895_7409_c1_1775_2635 | 277 |
| 98 | 3300050515 | nmdc:mga0a205_25125_c1 | nmdc:mga0a205_25125_c1_3849_4709 | 277 |
| 99 | iso_pu_bacteria | 2558860983 | 2561468497 | 280 |
| 100 | iso_pu_bacteria | 2775506901 | 2776260515 | 280 |
| 101 | iso_pu_bacteria | 2775507049 | 2776911776 | 280 |
| 102 | iso_pu_bacteria | 2802429605 | 2805931320 | 280 |
| 103 | iso_pu_bacteria | 2894232714 | 2894233269 | 280 |
| 104 | 3300003856 | Ga0058692_1000687 | Ga0058692_10006879 | 284 |
| 105 | 3300003856 | Ga0058692_1012959 | Ga0058692_10129592 | 284 |
| 106 | 3300005327 | Ga0070658_10516307 | Ga0070658_105163071 | 284 |
| 107 | 3300005331 | Ga0070670_100158384 | Ga0070670_1001583842 | 284 |
| 108 | 3300005335 | Ga0070666_10017401 | Ga0070666_100174014 | 284 |
| 109 | 3300005347 | Ga0070668_100002160 | Ga0070668_10000216010 | 284 |
| 110 | 3300005355 | Ga0070671_100000803 | Ga0070671_1000008034 | 284 |
| 111 | 3300005356 | Ga0070674_100000274 | Ga0070674_10000027411 | 284 |
| 112 | 3300005367 | Ga0070667_100126214 | Ga0070667_1001262141 | 284 |
| 113 | 3300005459 | Ga0068867_100001459 | Ga0068867_10000145916 | 284 |
| 114 | 3300005539 | Ga0068853_100008837 | Ga0068853_10000883710 | 284 |
| 115 | 3300005543 | Ga0070672_100000202 | Ga0070672_10000020216 | 284 |
| 116 | 3300005616 | Ga0068852_100002427 | Ga0068852_1000024278 | 284 |
| 117 | 3300005617 | Ga0068859_100253316 | Ga0068859_1002533162 | 284 |
| 118 | 3300005618 | Ga0068864_100017389 | Ga0068864_1000173896 | 284 |
| 119 | 3300005719 | Ga0068861_100047283 | Ga0068861_1000472832 | 284 |
| 120 | 3300005842 | Ga0068858_100042333 | Ga0068858_1000423332 | 284 |
| 121 | 3300005843 | Ga0068860_100038831 | Ga0068860_1000388314 | 284 |
| 122 | 3300006237 | Ga0097621_100016521 | Ga0097621_1000165212 | 284 |
| 123 | 3300006358 | Ga0068871_100106999 | Ga0068871_1001069992 | 284 |
| 124 | 3300006931 | Ga0097620_100253315 | Ga0097620_1002533152 | 284 |
| 125 | 3300009094 | Ga0111539_11106651 | Ga0111539_111066511 | 284 |
| 126 | 3300009148 | Ga0105243_10302999 | Ga0105243_103029992 | 284 |
| 127 | 3300011119 | Ga0105246_10184631 | Ga0105246_101846312 | 284 |
| 128 | 3300013308 | Ga0157375_10001479 | Ga0157375_1000147916 | 284 |
| 129 | 3300013308 | Ga0157375_10020299 | Ga0157375_100202998 | 284 |
| 130 | 3300017792 | Ga0163161_10109152 | Ga0163161_101091522 | 284 |
| 131 | 3300021388 | Ga0213875_10001420 | Ga0213875_100014203 | 284 |
| 132 | 3300025893 | Ga0207682_10001271 | Ga0207682_100012719 | 284 |
| 133 | 3300025901 | Ga0207688_10010921 | Ga0207688_100109214 | 284 |
| 134 | 3300025907 | Ga0207645_10000242 | Ga0207645_100002424 | 284 |
| 135 | 3300025909 | Ga0207705_10260400 | Ga0207705_102604002 | 284 |
| 136 | 3300025926 | Ga0207659_10109731 | Ga0207659_101097312 | 284 |
| 137 | 3300025931 | Ga0207644_10003418 | Ga0207644_1000341811 | 284 |
| 138 | 3300025937 | Ga0207669_10002721 | Ga0207669_100027218 | 284 |
| 139 | 3300025938 | Ga0207704_10006650 | Ga0207704_100066507 | 284 |
| 140 | 3300025940 | Ga0207691_10000084 | Ga0207691_1000008440 | 284 |
| 141 | 3300025941 | Ga0207711_10252352 | Ga0207711_102523522 | 284 |
| 142 | 3300025960 | Ga0207651_10130394 | Ga0207651_101303942 | 284 |
| 143 | 3300026035 | Ga0207703_10029948 | Ga0207703_100299482 | 284 |
| 144 | 3300026041 | Ga0207639_10009290 | Ga0207639_100092909 | 284 |
| 145 | 3300026075 | Ga0207708_10140114 | Ga0207708_101401142 | 284 |
| 146 | 3300026089 | Ga0207648_10002006 | Ga0207648_1000200616 | 284 |
| 147 | 3300026095 | Ga0207676_10080947 | Ga0207676_100809472 | 284 |
| 148 | 3300026118 | Ga0207675_100016216 | Ga0207675_1000162162 | 284 |
| 149 | 3300026121 | Ga0207683_10000003 | Ga0207683_10000003137 | 284 |
| 150 | 3300027312 | Ga0209371_1000064 | Ga0209371_100006438 | 284 |
| 151 | 3300027312 | Ga0209371_1000163 | Ga0209371_100016384 | 284 |
| 152 | 3300027312 | Ga0209371_1002971 | Ga0209371_10029715 | 284 |
| 153 | 3300028379 | Ga0268266_10064760 | Ga0268266_100647604 | 284 |
| 154 | 3300028381 | Ga0268264_10025144 | Ga0268264_100251442 | 284 |
| 155 | 3300028794 | Ga0307515_10106705 | Ga0307515_101067052 | 284 |
| 156 | 3300030500 | Ga0268256_1000028 | Ga0268256_1000028198 | 284 |
| 157 | 3300030500 | Ga0268256_1002480 | Ga0268256_10024806 | 284 |
| 158 | 3300031995 | Ga0307409_100252442 | Ga0307409_1002524422 | 284 |
| 159 | 3300032005 | Ga0307411_10197171 | Ga0307411_101971712 | 284 |
| 160 | 3300039437 | Ga0436365_1280225 | Ga0436365_1280225_58_912 | 284 |
| 161 | 3300039453 | Ga0436362_0430762 | Ga0436362_0430762_1286_2140 | 284 |
| 162 | 3300046522 | Ga0495643_0054560 | Ga0495643_0054560_1247_2101 | 284 |
| 163 | 3300046691 | Ga0495670_0143255 | Ga0495670_0143255_370_1224 | 284 |
| 164 | 3300049571 | Ga0501034_0335244 | Ga0501034_0335244_254_1108 | 284 |
| 165 | 3300049573 | Ga0501037_0228626 | Ga0501037_0228626_205_1059 | 284 |
| 166 | 3300049822 | Ga0501035_0152813 | Ga0501035_0152813_762_1616 | 284 |
| 167 | 3300050511 | nmdc:mga08y16_340596_c1 | nmdc:mga08y16_340596_c1_19_873 | 284 |
| 168 | 3300053109 | Ga0500569_014997 | Ga0500569_014997_749_1603 | 284 |
| 169 | 3300053109 | Ga0500569_027884 | Ga0500569_027884_380_1234 | 284 |
| 170 | 3300053134 | Ga0500658_0144937 | Ga0500658_0144937_65_919 | 284 |
| 171 | 3300053153 | Ga0500616_0010830 | Ga0500616_0010830_3257_4111 | 284 |
| 172 | 3300053156 | Ga0500622_0006538 | Ga0500622_0006538_4452_5306 | 284 |
| 173 | 3300053177 | Ga0500636_0001934 | Ga0500636_0001934_1295_2149 | 284 |
| 174 | 3300003771 | Ga0055526_1000231 | Ga0055526_100023122 | 285 |
| 175 | 3300013250 | Ga0171462_1027 | Ga0171462_102730 | 285 |
| 176 | 3300025295 | Ga0209564_1000023 | Ga0209564_1000023388 | 285 |
| 177 | 3300025299 | Ga0209256_1000234 | Ga0209256_100023424 | 285 |
| 178 | 3300044694 | Ga0466963_0150527 | Ga0466963_0150527_109_969 | 285 |
| 179 | 3300048903 | Ga0496100_0005463 | Ga0496100_0005463_5300_6208 | 285 |
| 180 | 3300048904 | Ga0496101_0001025 | Ga0496101_0001025_4880_5788 | 285 |
| 181 | 3300048905 | Ga0496102_0010694 | Ga0496102_0010694_1877_2785 | 285 |
| 182 | 3300048907 | Ga0496104_0004791 | Ga0496104_0004791_9300_10208 | 285 |
| 183 | 3300048908 | Ga0496105_0441541 | Ga0496105_0441541_28_885 | 285 |
| 184 | 3300048910 | Ga0496107_0007469 | Ga0496107_0007469_1331_2239 | 285 |
| 185 | 3300048911 | Ga0496108_0002364 | Ga0496108_0002364_13453_14361 | 285 |
| 186 | 3300048912 | Ga0496109_0001401 | Ga0496109_0001401_2239_3096 | 285 |
| 187 | 3300048912 | Ga0496109_0002461 | Ga0496109_0002461_5286_6194 | 285 |
| 188 | 3300048913 | Ga0496110_0003528 | Ga0496110_0003528_4969_5877 | 285 |
| 189 | 3300048913 | Ga0496110_0011641 | Ga0496110_0011641_3951_4808 | 285 |
| 190 | 3300048914 | Ga0496111_0003518 | Ga0496111_0003518_5244_6152 | 285 |
| 191 | 3300048915 | Ga0496112_0008922 | Ga0496112_0008922_1066_1974 | 285 |
| 192 | 3300048916 | Ga0496113_0001647 | Ga0496113_0001647_11074_11982 | 285 |
| 193 | 3300048925 | Ga0496122_0156620 | Ga0496122_0156620_351_1208 | 285 |
| 194 | 3300048925 | Ga0496122_0203611 | Ga0496122_0203611_283_1140 | 285 |
| 195 | 3300048926 | Ga0496123_0086856 | Ga0496123_0086856_938_1795 | 285 |
| 196 | 3300002739 | JGI25158J39367_1000708 | JGI25158J39367_10007082 | 286 |
| 197 | 3300002773 | JGI25152J39213_1006388 | JGI25152J39213_10063882 | 286 |
| 198 | 3300002773 | JGI25152J39213_1008113 | JGI25152J39213_10081132 | 286 |
| 199 | 3300002773 | JGI25152J39213_1010246 | JGI25152J39213_10102462 | 286 |
| 200 | 3300002774 | JGI25150J39212_1006776 | JGI25150J39212_10067762 | 286 |
| 201 | 3300002987 | JGI25159J45721_1000233 | JGI25159J45721_100023326 | 286 |
| 202 | 3300003203 | JGI25406J46586_10037443 | JGI25406J46586_100374431 | 286 |
| 203 | 3300003215 | JGI25153J46596_10009427 | JGI25153J46596_100094272 | 286 |
| 204 | 3300003215 | JGI25153J46596_10012455 | JGI25153J46596_100124555 | 286 |
| 205 | 3300003354 | JGI25160J50197_1004561 | JGI25160J50197_10045612 | 286 |
| 206 | 3300003374 | JGI25161J50226_1000079 | JGI25161J50226_100007967 | 286 |
| 207 | 3300003771 | Ga0055526_1003394 | Ga0055526_10033943 | 286 |
| 208 | 3300003775 | Ga0055524_1001230 | Ga0055524_10012309 | 286 |
| 209 | 3300003792 | Ga0055540_1004428 | Ga0055540_10044285 | 286 |
| 210 | 3300004625 | Ga0055543_1000031 | Ga0055543_100003152 | 286 |
| 211 | 3300005262 | Ga0065165_1013656 | Ga0065165_10136563 | 286 |
| 212 | 3300005328 | Ga0070676_10200924 | Ga0070676_102009242 | 286 |
| 213 | 3300005331 | Ga0070670_100005641 | Ga0070670_1000056413 | 286 |
| 214 | 3300005333 | Ga0070677_10008646 | Ga0070677_100086461 | 286 |
| 215 | 3300005334 | Ga0068869_100037437 | Ga0068869_1000374372 | 286 |
| 216 | 3300005337 | Ga0070682_100341303 | Ga0070682_1003413031 | 286 |
| 217 | 3300005339 | Ga0070660_100197583 | Ga0070660_1001975832 | 286 |
| 218 | 3300005340 | Ga0070689_100085509 | Ga0070689_1000855092 | 286 |
| 219 | 3300005340 | Ga0070689_100426000 | Ga0070689_1004260002 | 286 |
| 220 | 3300005341 | Ga0070691_10074316 | Ga0070691_100743161 | 286 |
| 221 | 3300005343 | Ga0070687_100012742 | Ga0070687_1000127424 | 286 |
| 222 | 3300005347 | Ga0070668_100120494 | Ga0070668_1001204942 | 286 |
| 223 | 3300005353 | Ga0070669_100020654 | Ga0070669_1000206543 | 286 |
| 224 | 3300005353 | Ga0070669_100135810 | Ga0070669_1001358102 | 286 |
| 225 | 3300005354 | Ga0070675_100271435 | Ga0070675_1002714352 | 286 |
| 226 | 3300005355 | Ga0070671_100163002 | Ga0070671_1001630022 | 286 |
| 227 | 3300005356 | Ga0070674_100023054 | Ga0070674_1000230543 | 286 |
| 228 | 3300005364 | Ga0070673_100141932 | Ga0070673_1001419322 | 286 |
| 229 | 3300005367 | Ga0070667_100481237 | Ga0070667_1004812372 | 286 |
| 230 | 3300005434 | Ga0070709_10113379 | Ga0070709_101133792 | 286 |
| 231 | 3300005435 | Ga0070714_100007015 | Ga0070714_1000070156 | 286 |
| 232 | 3300005435 | Ga0070714_100237339 | Ga0070714_1002373392 | 286 |
| 233 | 3300005436 | Ga0070713_100066957 | Ga0070713_1000669573 | 286 |
| 234 | 3300005438 | Ga0070701_10101595 | Ga0070701_101015951 | 286 |
| 235 | 3300005445 | Ga0070708_100068532 | Ga0070708_1000685322 | 286 |
| 236 | 3300005456 | Ga0070678_100367367 | Ga0070678_1003673672 | 286 |
| 237 | 3300005457 | Ga0070662_100069348 | Ga0070662_1000693483 | 286 |
| 238 | 3300005459 | Ga0068867_100046200 | Ga0068867_1000462003 | 286 |
| 239 | 3300005466 | Ga0070685_10015815 | Ga0070685_100158152 | 286 |
| 240 | 3300005518 | Ga0070699_100055573 | Ga0070699_1000555732 | 286 |
| 241 | 3300005535 | Ga0070684_100068444 | Ga0070684_1000684442 | 286 |
| 242 | 3300005536 | Ga0070697_100288301 | Ga0070697_1002883012 | 286 |
| 243 | 3300005539 | Ga0068853_100033048 | Ga0068853_1000330481 | 286 |
| 244 | 3300005543 | Ga0070672_100078159 | Ga0070672_1000781592 | 286 |
| 245 | 3300005548 | Ga0070665_100224300 | Ga0070665_1002243002 | 286 |
| 246 | 3300005548 | Ga0070665_100231409 | Ga0070665_1002314091 | 286 |
| 247 | 3300005549 | Ga0070704_100108511 | Ga0070704_1001085112 | 286 |
| 248 | 3300005564 | Ga0070664_100056757 | Ga0070664_1000567572 | 286 |
| 249 | 3300005577 | Ga0068857_100643060 | Ga0068857_1006430601 | 286 |
| 250 | 3300005578 | Ga0068854_100199582 | Ga0068854_1001995822 | 286 |
| 251 | 3300005615 | Ga0070702_100024230 | Ga0070702_1000242302 | 286 |
| 252 | 3300005617 | Ga0068859_100139254 | Ga0068859_1001392542 | 286 |
| 253 | 3300005618 | Ga0068864_100158740 | Ga0068864_1001587402 | 286 |
| 254 | 3300005834 | Ga0068851_10043974 | Ga0068851_100439742 | 286 |
| 255 | 3300005841 | Ga0068863_100030297 | Ga0068863_1000302973 | 286 |
| 256 | 3300005841 | Ga0068863_100199696 | Ga0068863_1001996962 | 286 |
| 257 | 3300005842 | Ga0068858_100420897 | Ga0068858_1004208972 | 286 |
| 258 | 3300005843 | Ga0068860_100169022 | Ga0068860_1001690223 | 286 |
| 259 | 3300005844 | Ga0068862_100012376 | Ga0068862_1000123767 | 286 |
| 260 | 3300005844 | Ga0068862_100171736 | Ga0068862_1001717362 | 286 |
| 261 | 3300005937 | Ga0081455_10014294 | Ga0081455_100142948 | 286 |
| 262 | 3300005937 | Ga0081455_10027925 | Ga0081455_100279251 | 286 |
| 263 | 3300005937 | Ga0081455_10048549 | Ga0081455_100485491 | 286 |
| 264 | 3300005981 | Ga0081538_10000697 | Ga0081538_1000069719 | 286 |
| 265 | 3300005981 | Ga0081538_10014451 | Ga0081538_100144516 | 286 |
| 266 | 3300005983 | Ga0081540_1001984 | Ga0081540_10019845 | 286 |
| 267 | 3300005985 | Ga0081539_10002187 | Ga0081539_100021875 | 286 |
| 268 | 3300006028 | Ga0070717_10041594 | Ga0070717_100415943 | 286 |
| 269 | 3300006038 | Ga0075365_10007019 | Ga0075365_100070193 | 286 |
| 270 | 3300006038 | Ga0075365_10279633 | Ga0075365_102796332 | 286 |
| 271 | 3300006042 | Ga0075368_10037922 | Ga0075368_100379222 | 286 |
| 272 | 3300006048 | Ga0075363_100021301 | Ga0075363_1000213012 | 286 |
| 273 | 3300006051 | Ga0075364_10005843 | Ga0075364_100058434 | 286 |
| 274 | 3300006163 | Ga0070715_10000633 | Ga0070715_100006335 | 286 |
| 275 | 3300006175 | Ga0070712_100002594 | Ga0070712_1000025946 | 286 |
| 276 | 3300006175 | Ga0070712_100008343 | Ga0070712_1000083432 | 286 |
| 277 | 3300006175 | Ga0070712_100046579 | Ga0070712_1000465793 | 286 |
| 278 | 3300006177 | Ga0075362_10002160 | Ga0075362_100021604 | 286 |
| 279 | 3300006177 | Ga0075362_10115924 | Ga0075362_101159242 | 286 |
| 280 | 3300006195 | Ga0075366_10061453 | Ga0075366_100614532 | 286 |
| 281 | 3300006237 | Ga0097621_100092828 | Ga0097621_1000928282 | 286 |
| 282 | 3300006358 | Ga0068871_100083825 | Ga0068871_1000838252 | 286 |
| 283 | 3300006844 | Ga0075428_100126415 | Ga0075428_1001264152 | 286 |
| 284 | 3300006847 | Ga0075431_100438732 | Ga0075431_1004387322 | 286 |
| 285 | 3300006847 | Ga0075431_100700148 | Ga0075431_1007001481 | 286 |
| 286 | 3300006871 | Ga0075434_100003619 | Ga0075434_1000036193 | 286 |
| 287 | 3300006871 | Ga0075434_100496375 | Ga0075434_1004963752 | 286 |
| 288 | 3300006880 | Ga0075429_100224127 | Ga0075429_1002241272 | 286 |
| 289 | 3300006931 | Ga0097620_100139255 | Ga0097620_1001392552 | 286 |
| 290 | 3300007076 | Ga0075435_100020522 | Ga0075435_1000205225 | 286 |
| 291 | 3300007265 | Ga0099794_10041774 | Ga0099794_100417741 | 286 |
| 292 | 3300009036 | Ga0105244_10032024 | Ga0105244_100320242 | 286 |
| 293 | 3300009093 | Ga0105240_10306224 | Ga0105240_103062242 | 286 |
| 294 | 3300009094 | Ga0111539_10012307 | Ga0111539_100123075 | 286 |
| 295 | 3300009094 | Ga0111539_10098515 | Ga0111539_100985152 | 286 |
| 296 | 3300009094 | Ga0111539_10400919 | Ga0111539_104009192 | 286 |
| 297 | 3300009094 | Ga0111539_10430116 | Ga0111539_104301162 | 286 |
| 298 | 3300009098 | Ga0105245_10063592 | Ga0105245_100635922 | 286 |
| 299 | 3300009101 | Ga0105247_10069980 | Ga0105247_100699802 | 286 |
| 300 | 3300009147 | Ga0114129_10265891 | Ga0114129_102658912 | 286 |
| 301 | 3300009147 | Ga0114129_10494395 | Ga0114129_104943951 | 286 |
| 302 | 3300009147 | Ga0114129_10729392 | Ga0114129_107293921 | 286 |
| 303 | 3300009148 | Ga0105243_10227222 | Ga0105243_102272222 | 286 |
| 304 | 3300009177 | Ga0105248_10883544 | Ga0105248_108835441 | 286 |
| 305 | 3300009177 | Ga0105248_10889784 | Ga0105248_108897841 | 286 |
| 306 | 3300009551 | Ga0105238_10102421 | Ga0105238_101024212 | 286 |
| 307 | 3300013297 | Ga0157378_10161676 | Ga0157378_101616762 | 286 |
| 308 | 3300013297 | Ga0157378_10542255 | Ga0157378_105422552 | 286 |
| 309 | 3300013306 | Ga0163162_10051729 | Ga0163162_100517293 | 286 |
| 310 | 3300013308 | Ga0157375_10415128 | Ga0157375_104151282 | 286 |
| 311 | 3300014325 | Ga0163163_10083633 | Ga0163163_100836334 | 286 |
| 312 | 3300014325 | Ga0163163_10215798 | Ga0163163_102157982 | 286 |
| 313 | 3300014326 | Ga0157380_10184102 | Ga0157380_101841022 | 286 |
| 314 | 3300014326 | Ga0157380_10882148 | Ga0157380_108821481 | 286 |
| 315 | 3300014745 | Ga0157377_10050622 | Ga0157377_100506221 | 286 |
| 316 | 3300014968 | Ga0157379_10250652 | Ga0157379_102506522 | 286 |
| 317 | 3300014969 | Ga0157376_10110941 | Ga0157376_101109412 | 286 |
| 318 | 3300017792 | Ga0163161_10077002 | Ga0163161_100770023 | 286 |
| 319 | 3300021384 | Ga0213876_10050262 | Ga0213876_100502622 | 286 |
| 320 | 3300025208 | Ga0209436_100094 | Ga0209436_1000945 | 286 |
| 321 | 3300025245 | Ga0207425_1001536 | Ga0207425_10015364 | 286 |
| 322 | 3300025245 | Ga0207425_1021386 | Ga0207425_10213862 | 286 |
| 323 | 3300025258 | Ga0209129_1000862 | Ga0209129_100086213 | 286 |
| 324 | 3300025258 | Ga0209129_1007118 | Ga0209129_10071184 | 286 |
| 325 | 3300025273 | Ga0209673_1033222 | Ga0209673_10332222 | 286 |
| 326 | 3300025284 | Ga0209130_1000023 | Ga0209130_1000023287 | 286 |
| 327 | 3300025294 | Ga0209025_1014429 | Ga0209025_10144292 | 286 |
| 328 | 3300025295 | Ga0209564_1003021 | Ga0209564_10030218 | 286 |
| 329 | 3300025297 | Ga0209758_1000422 | Ga0209758_100042260 | 286 |
| 330 | 3300025297 | Ga0209758_1005087 | Ga0209758_10050872 | 286 |
| 331 | 3300025297 | Ga0209758_1046377 | Ga0209758_10463772 | 286 |
| 332 | 3300025297 | Ga0209758_1047686 | Ga0209758_10476862 | 286 |
| 333 | 3300025302 | Ga0207426_1000087 | Ga0207426_100008775 | 286 |
| 334 | 3300025303 | Ga0209051_1005845 | Ga0209051_10058452 | 286 |
| 335 | 3300025893 | Ga0207682_10005559 | Ga0207682_100055592 | 286 |
| 336 | 3300025900 | Ga0207710_10146899 | Ga0207710_101468992 | 286 |
| 337 | 3300025901 | Ga0207688_10006266 | Ga0207688_100062663 | 286 |
| 338 | 3300025904 | Ga0207647_10044939 | Ga0207647_100449392 | 286 |
| 339 | 3300025907 | Ga0207645_10039127 | Ga0207645_100391273 | 286 |
| 340 | 3300025907 | Ga0207645_10089906 | Ga0207645_100899062 | 286 |
| 341 | 3300025908 | Ga0207643_10023880 | Ga0207643_100238802 | 286 |
| 342 | 3300025908 | Ga0207643_10164289 | Ga0207643_101642892 | 286 |
| 343 | 3300025910 | Ga0207684_10011372 | Ga0207684_100113728 | 286 |
| 344 | 3300025911 | Ga0207654_10277529 | Ga0207654_102775292 | 286 |
| 345 | 3300025914 | Ga0207671_10488344 | Ga0207671_104883441 | 286 |
| 346 | 3300025915 | Ga0207693_10000855 | Ga0207693_1000085518 | 286 |
| 347 | 3300025915 | Ga0207693_10007507 | Ga0207693_100075074 | 286 |
| 348 | 3300025915 | Ga0207693_10069366 | Ga0207693_100693662 | 286 |
| 349 | 3300025915 | Ga0207693_10102320 | Ga0207693_101023202 | 286 |
| 350 | 3300025915 | Ga0207693_10184416 | Ga0207693_101844162 | 286 |
| 351 | 3300025918 | Ga0207662_10009537 | Ga0207662_100095374 | 286 |
| 352 | 3300025919 | Ga0207657_10045501 | Ga0207657_100455014 | 286 |
| 353 | 3300025923 | Ga0207681_10088247 | Ga0207681_100882472 | 286 |
| 354 | 3300025924 | Ga0207694_10263094 | Ga0207694_102630941 | 286 |
| 355 | 3300025925 | Ga0207650_10062197 | Ga0207650_100621972 | 286 |
| 356 | 3300025925 | Ga0207650_10218648 | Ga0207650_102186481 | 286 |
| 357 | 3300025926 | Ga0207659_10338537 | Ga0207659_103385372 | 286 |
| 358 | 3300025928 | Ga0207700_10209837 | Ga0207700_102098372 | 286 |
| 359 | 3300025933 | Ga0207706_10008768 | Ga0207706_100087684 | 286 |
| 360 | 3300025933 | Ga0207706_10038152 | Ga0207706_100381522 | 286 |
| 361 | 3300025937 | Ga0207669_10034073 | Ga0207669_100340731 | 286 |
| 362 | 3300025937 | Ga0207669_10258778 | Ga0207669_102587781 | 286 |
| 363 | 3300025938 | Ga0207704_10205458 | Ga0207704_102054582 | 286 |
| 364 | 3300025940 | Ga0207691_10095536 | Ga0207691_100955362 | 286 |
| 365 | 3300025942 | Ga0207689_10005950 | Ga0207689_100059509 | 286 |
| 366 | 3300025960 | Ga0207651_10288740 | Ga0207651_102887402 | 286 |
| 367 | 3300025961 | Ga0207712_10280986 | Ga0207712_102809861 | 286 |
| 368 | 3300025972 | Ga0207668_10161101 | Ga0207668_101611012 | 286 |
| 369 | 3300025981 | Ga0207640_10505692 | Ga0207640_105056921 | 286 |
| 370 | 3300025986 | Ga0207658_10377136 | Ga0207658_103771361 | 286 |
| 371 | 3300026067 | Ga0207678_10049460 | Ga0207678_100494604 | 286 |
| 372 | 3300026078 | Ga0207702_10194210 | Ga0207702_101942101 | 286 |
| 373 | 3300026088 | Ga0207641_10234444 | Ga0207641_102344442 | 286 |
| 374 | 3300026088 | Ga0207641_10255903 | Ga0207641_102559032 | 286 |
| 375 | 3300026089 | Ga0207648_10000840 | Ga0207648_1000084029 | 286 |
| 376 | 3300026089 | Ga0207648_10037903 | Ga0207648_100379034 | 286 |
| 377 | 3300026095 | Ga0207676_10029108 | Ga0207676_100291082 | 286 |
| 378 | 3300026116 | Ga0207674_10032353 | Ga0207674_100323532 | 286 |
| 379 | 3300026116 | Ga0207674_10138180 | Ga0207674_101381802 | 286 |
| 380 | 3300026118 | Ga0207675_100002492 | Ga0207675_10000249210 | 286 |
| 381 | 3300026121 | Ga0207683_10007445 | Ga0207683_100074459 | 286 |
| 382 | 3300027671 | Ga0209588_1027072 | Ga0209588_10270722 | 286 |
| 383 | 3300027907 | Ga0207428_10052817 | Ga0207428_100528172 | 286 |
| 384 | 3300028380 | Ga0268265_10194524 | Ga0268265_101945242 | 286 |
| 385 | 3300028381 | Ga0268264_10050111 | Ga0268264_100501112 | 286 |
| 386 | 3300028381 | Ga0268264_10129119 | Ga0268264_101291192 | 286 |
| 387 | 3300028381 | Ga0268264_10228348 | Ga0268264_102283482 | 286 |
| 388 | 3300028800 | Ga0265338_10009857 | Ga0265338_100098577 | 286 |
| 389 | 3300030760 | Ga0265762_1012367 | Ga0265762_10123672 | 286 |
| 390 | 3300031241 | Ga0265325_10014195 | Ga0265325_100141952 | 286 |
| 391 | 3300031242 | Ga0265329_10021321 | Ga0265329_100213212 | 286 |
| 392 | 3300031247 | Ga0265340_10050215 | Ga0265340_100502152 | 286 |
| 393 | 3300031249 | Ga0265339_10000067 | Ga0265339_1000006791 | 286 |
| 394 | 3300031249 | Ga0265339_10069992 | Ga0265339_100699922 | 286 |
| 395 | 3300031249 | Ga0265339_10152998 | Ga0265339_101529981 | 286 |
| 396 | 3300031344 | Ga0265316_10057397 | Ga0265316_100573972 | 286 |
| 397 | 3300031344 | Ga0265316_10302160 | Ga0265316_103021602 | 286 |
| 398 | 3300031456 | Ga0307513_10291226 | Ga0307513_102912262 | 286 |
| 399 | 3300031595 | Ga0265313_10000054 | Ga0265313_10000054101 | 286 |
| 400 | 3300031711 | Ga0265314_10014038 | Ga0265314_100140384 | 286 |
| 401 | 3300034816 | Ga0373930_0033775 | Ga0373930_0033775_47_907 | 286 |
| 402 | 3300035086 | Ga0373934_0000167 | Ga0373934_0000167_5043_5903 | 286 |
| 403 | 3300035086 | Ga0373934_0011751 | Ga0373934_0011751_1991_2851 | 286 |
| 404 | 3300035086 | Ga0373934_0026423 | Ga0373934_0026423_1362_2222 | 286 |
| 405 | 3300035089 | Ga0373944_0012413 | Ga0373944_0012413_749_1609 | 286 |
| 406 | 3300035111 | Ga0373923_0056335 | Ga0373923_0056335_148_1008 | 286 |
| 407 | 3300035113 | Ga0373936_0006658 | Ga0373936_0006658_2630_3490 | 286 |
| 408 | 3300035116 | Ga0373945_0000969 | Ga0373945_0000969_858_1718 | 286 |
| 409 | 3300035116 | Ga0373945_0006884 | Ga0373945_0006884_2659_3519 | 286 |
| 410 | 3300035117 | Ga0373953_0135373 | Ga0373953_0135373_112_972 | 286 |
| 411 | 3300035118 | Ga0373954_0003678 | Ga0373954_0003678_624_1484 | 286 |
| 412 | 3300035118 | Ga0373954_0042470 | Ga0373954_0042470_25_885 | 286 |
| 413 | 3300035118 | Ga0373954_0063796 | Ga0373954_0063796_95_955 | 286 |
| 414 | 3300035119 | Ga0373956_0000005 | Ga0373956_0000005_50647_51507 | 286 |
| 415 | 3300035119 | Ga0373956_0017636 | Ga0373956_0017636_644_1504 | 286 |
| 416 | 3300035120 | Ga0373957_0001547 | Ga0373957_0001547_3303_4163 | 286 |
| 417 | 3300035121 | Ga0373960_0090861 | Ga0373960_0090861_23_883 | 286 |
| 418 | 3300035170 | Ga0373943_0000185 | Ga0373943_0000185_17285_18145 | 286 |
| 419 | 3300035170 | Ga0373943_0029216 | Ga0373943_0029216_1260_2120 | 286 |
| 420 | 3300035171 | Ga0373946_0000642 | Ga0373946_0000642_10137_10997 | 286 |
| 421 | 3300035171 | Ga0373946_0020381 | Ga0373946_0020381_1545_2405 | 286 |
| 422 | 3300035171 | Ga0373946_0053302 | Ga0373946_0053302_71_931 | 286 |
| 423 | 3300035172 | Ga0373955_0001424 | Ga0373955_0001424_8541_9401 | 286 |
| 424 | 3300035172 | Ga0373955_0002275 | Ga0373955_0002275_2090_2950 | 286 |
| 425 | 3300035172 | Ga0373955_0021411 | Ga0373955_0021411_1649_2509 | 286 |
| 426 | 3300035172 | Ga0373955_0094832 | Ga0373955_0094832_834_1694 | 286 |
| 427 | 3300035207 | Ga0373942_0003621 | Ga0373942_0003621_214_1074 | 286 |
| 428 | 3300035410 | Ga0373924_0017153 | Ga0373924_0017153_635_1495 | 286 |
| 429 | 3300035410 | Ga0373924_0024311 | Ga0373924_0024311_605_1465 | 286 |
| 430 | 3300035410 | Ga0373924_0035283 | Ga0373924_0035283_187_1047 | 286 |
| 431 | 3300035691 | Ga0373931_0145414 | Ga0373931_0145414_471_1331 | 286 |
| 432 | 3300035695 | Ga0373927_0000434 | Ga0373927_0000434_21067_21927 | 286 |
| 433 | 3300035695 | Ga0373927_0041103 | Ga0373927_0041103_816_1676 | 286 |
| 434 | 3300035695 | Ga0373927_0088315 | Ga0373927_0088315_315_1175 | 286 |
| 435 | 3300035724 | Ga0373933_0000447 | Ga0373933_0000447_9214_10074 | 286 |
| 436 | 3300035724 | Ga0373933_0000883 | Ga0373933_0000883_11050_11910 | 286 |
| 437 | 3300035724 | Ga0373933_0003022 | Ga0373933_0003022_3956_4816 | 286 |
| 438 | 3300035725 | Ga0373947_0000583 | Ga0373947_0000583_10124_10984 | 286 |
| 439 | 3300035725 | Ga0373947_0019759 | Ga0373947_0019759_2445_3305 | 286 |
| 440 | 3300036401 | Ga0373937_0000912 | Ga0373937_0000912_4464_5324 | 286 |
| 441 | 3300036401 | Ga0373937_0004251 | Ga0373937_0004251_501_1361 | 286 |
| 442 | 3300036401 | Ga0373937_0009273 | Ga0373937_0009273_3172_4032 | 286 |
| 443 | 3300037068 | Ga0373925_0328633 | Ga0373925_0328633_271_1131 | 286 |
| 444 | 3300037068 | Ga0373925_0368428 | Ga0373925_0368428_82_942 | 286 |
| 445 | 3300037312 | Ga0395899_0264174 | Ga0395899_0264174_144_1004 | 286 |
| 446 | 3300037418 | Ga0395900_0334282 | Ga0395900_0334282_251_1111 | 286 |
| 447 | 3300037466 | Ga0395898_0109219 | Ga0395898_0109219_858_1718 | 286 |
| 448 | 3300037853 | Ga0436364_0125248 | Ga0436364_0125248_132_992 | 286 |
| 449 | 3300037853 | Ga0436364_1334518 | Ga0436364_1334518_495_1355 | 286 |
| 450 | 3300038443 | Ga0395901_0083724 | Ga0395901_0083724_1991_2851 | 286 |
| 451 | 3300038443 | Ga0395901_0461538 | Ga0395901_0461538_106_966 | 286 |
| 452 | 3300039437 | Ga0436365_0523999 | Ga0436365_0523999_1224_2084 | 286 |
| 453 | 3300039447 | Ga0436361_0089618 | Ga0436361_0089618_35_895 | 286 |
| 454 | 3300039447 | Ga0436361_1189219 | Ga0436361_1189219_2065_2925 | 286 |
| 455 | 3300041408 | Ga0439453_0008905 | Ga0439453_0008905_737_1597 | 286 |
| 456 | 3300041413 | Ga0439465_0004447 | Ga0439465_0004447_3398_4258 | 286 |
| 457 | 3300041413 | Ga0439465_0017288 | Ga0439465_0017288_643_1503 | 286 |
| 458 | 3300041512 | Ga0451853_2675021 | Ga0451853_2675021_139_999 | 286 |
| 459 | 3300042003 | Ga0439443_003461 | Ga0439443_003461_1044_1904 | 286 |
| 460 | 3300042010 | Ga0439452_026510 | Ga0439452_026510_187_1047 | 286 |
| 461 | 3300042015 | Ga0439462_0010941 | Ga0439462_0010941_919_1797 | 286 |
| 462 | 3300042015 | Ga0439462_0032598 | Ga0439462_0032598_351_1229 | 286 |
| 463 | 3300042156 | Ga0439446_0052905 | Ga0439446_0052905_328_1188 | 286 |
| 464 | 3300042436 | Ga0439435_0029550 | Ga0439435_0029550_284_1144 | 286 |
| 465 | 3300044684 | Ga0466966_0162429 | Ga0466966_0162429_324_1184 | 286 |
| 466 | 3300044694 | Ga0466963_0053084 | Ga0466963_0053084_1612_2472 | 286 |
| 467 | 3300044712 | Ga0453684_0386395 | Ga0453684_0386395_258_1121 | 286 |
| 468 | 3300045976 | Ga0466967_0138012 | Ga0466967_0138012_192_1052 | 286 |
| 469 | 3300046452 | Ga0495617_033101 | Ga0495617_033101_107_967 | 286 |
| 470 | 3300046453 | Ga0495627_021698 | Ga0495627_021698_174_1034 | 286 |
| 471 | 3300046454 | Ga0495592_0002231 | Ga0495592_0002231_4826_5686 | 286 |
| 472 | 3300046455 | Ga0495603_0069424 | Ga0495603_0069424_699_1559 | 286 |
| 473 | 3300046459 | Ga0495629_0016538 | Ga0495629_0016538_312_1172 | 286 |
| 474 | 3300046460 | Ga0495638_0016019 | Ga0495638_0016019_1992_2852 | 286 |
| 475 | 3300046462 | Ga0495651_0000479 | Ga0495651_0000479_19039_19899 | 286 |
| 476 | 3300046462 | Ga0495651_0000878 | Ga0495651_0000878_16161_17021 | 286 |
| 477 | 3300046463 | Ga0495653_0000553 | Ga0495653_0000553_19952_20812 | 286 |
| 478 | 3300046463 | Ga0495653_0039412 | Ga0495653_0039412_2057_2917 | 286 |
| 479 | 3300046473 | Ga0495582_0037901 | Ga0495582_0037901_1167_2027 | 286 |
| 480 | 3300046474 | Ga0495605_0089502 | Ga0495605_0089502_557_1417 | 286 |
| 481 | 3300046474 | Ga0495605_0150021 | Ga0495605_0150021_49_909 | 286 |
| 482 | 3300046475 | Ga0495639_0006397 | Ga0495639_0006397_2631_3491 | 286 |
| 483 | 3300046476 | Ga0495662_0008076 | Ga0495662_0008076_3539_4399 | 286 |
| 484 | 3300046477 | Ga0495664_0001762 | Ga0495664_0001762_4085_4945 | 286 |
| 485 | 3300046499 | Ga0495594_0077678 | Ga0495594_0077678_71_931 | 286 |
| 486 | 3300046500 | Ga0495596_0024596 | Ga0495596_0024596_826_1686 | 286 |
| 487 | 3300046506 | Ga0495583_0031569 | Ga0495583_0031569_968_1828 | 286 |
| 488 | 3300046511 | Ga0495608_0000376 | Ga0495608_0000376_26438_27298 | 286 |
| 489 | 3300046512 | Ga0495610_0040813 | Ga0495610_0040813_105_965 | 286 |
| 490 | 3300046514 | Ga0495618_0046090 | Ga0495618_0046090_1025_1885 | 286 |
| 491 | 3300046515 | Ga0495620_0048516 | Ga0495620_0048516_773_1633 | 286 |
| 492 | 3300046516 | Ga0495628_0119219 | Ga0495628_0119219_876_1736 | 286 |
| 493 | 3300046517 | Ga0495630_0117972 | Ga0495630_0117972_1085_1945 | 286 |
| 494 | 3300046517 | Ga0495630_0140463 | Ga0495630_0140463_521_1381 | 286 |
| 495 | 3300046522 | Ga0495643_0212144 | Ga0495643_0212144_27_887 | 286 |
| 496 | 3300046523 | Ga0495644_0131642 | Ga0495644_0131642_53_913 | 286 |
| 497 | 3300046525 | Ga0495663_0088599 | Ga0495663_0088599_91_951 | 286 |
| 498 | 3300046526 | Ga0495666_0119974 | Ga0495666_0119974_240_1100 | 286 |
| 499 | 3300046529 | Ga0495652_0006143 | Ga0495652_0006143_7643_8503 | 286 |
| 500 | 3300046531 | Ga0495665_0013808 | Ga0495665_0013808_738_1598 | 286 |
| 501 | 3300046531 | Ga0495665_0133575 | Ga0495665_0133575_209_1069 | 286 |
| 502 | 3300046533 | Ga0495640_0016106 | Ga0495640_0016106_646_1506 | 286 |
| 503 | 3300046535 | Ga0495586_0027821 | Ga0495586_0027821_2069_2929 | 286 |
| 504 | 3300046536 | Ga0495587_0001125 | Ga0495587_0001125_9731_10591 | 286 |
| 505 | 3300046537 | Ga0495598_0089923 | Ga0495598_0089923_69_929 | 286 |
| 506 | 3300046543 | Ga0495645_0010377 | Ga0495645_0010377_2671_3531 | 286 |
| 507 | 3300046559 | Ga0495667_0000294 | Ga0495667_0000294_10278_11138 | 286 |
| 508 | 3300046559 | Ga0495667_0037649 | Ga0495667_0037649_1084_1944 | 286 |
| 509 | 3300046615 | Ga0495656_0054467 | Ga0495656_0054467_802_1662 | 286 |
| 510 | 3300046642 | Ga0495634_0033547 | Ga0495634_0033547_1409_2269 | 286 |
| 511 | 3300046648 | Ga0495611_0105323 | Ga0495611_0105323_238_1098 | 286 |
| 512 | 3300046663 | Ga0495635_0000880 | Ga0495635_0000880_17476_18336 | 286 |
| 513 | 3300046663 | Ga0495635_0005117 | Ga0495635_0005117_1832_2692 | 286 |
| 514 | 3300046663 | Ga0495635_0192986 | Ga0495635_0192986_265_1125 | 286 |
| 515 | 3300046675 | Ga0495657_0021192 | Ga0495657_0021192_2464_3324 | 286 |
| 516 | 3300046675 | Ga0495657_0133733 | Ga0495657_0133733_528_1388 | 286 |
| 517 | 3300046678 | Ga0495599_0004220 | Ga0495599_0004220_661_1521 | 286 |
| 518 | 3300046679 | Ga0495623_0001907 | Ga0495623_0001907_8451_9311 | 286 |
| 519 | 3300046681 | Ga0495647_0130526 | Ga0495647_0130526_158_1018 | 286 |
| 520 | 3300046683 | Ga0495658_0006634 | Ga0495658_0006634_1283_2143 | 286 |
| 521 | 3300046689 | Ga0495613_0032385 | Ga0495613_0032385_153_1013 | 286 |
| 522 | 3300046809 | Ga0495600_0003489 | Ga0495600_0003489_5627_6487 | 286 |
| 523 | 3300046809 | Ga0495600_0050142 | Ga0495600_0050142_949_1809 | 286 |
| 524 | 3300046809 | Ga0495600_0116845 | Ga0495600_0116845_841_1701 | 286 |
| 525 | 3300046810 | Ga0495660_0141454 | Ga0495660_0141454_98_958 | 286 |
| 526 | 3300047315 | Ga0495581_0029496 | Ga0495581_0029496_416_1276 | 286 |
| 527 | 3300047315 | Ga0495581_0036697 | Ga0495581_0036697_100_960 | 286 |
| 528 | 3300047317 | Ga0495604_0000972 | Ga0495604_0000972_8758_9618 | 286 |
| 529 | 3300047319 | Ga0495674_0009055 | Ga0495674_0009055_1260_2120 | 286 |
| 530 | 3300047321 | Ga0495676_0004556 | Ga0495676_0004556_4010_4870 | 286 |
| 531 | 3300047322 | Ga0495680_0003955 | Ga0495680_0003955_9836_10696 | 286 |
| 532 | 3300047444 | Ga0495675_0019173 | Ga0495675_0019173_2876_3736 | 286 |
| 533 | 3300047444 | Ga0495675_0150212 | Ga0495675_0150212_52_912 | 286 |
| 534 | 3300047447 | Ga0495685_074652 | Ga0495685_074652_52_912 | 286 |
| 535 | 3300047471 | Ga0495684_0075695 | Ga0495684_0075695_319_1179 | 286 |
| 536 | 3300047673 | Ga0495593_0019912 | Ga0495593_0019912_2502_3362 | 286 |
| 537 | 3300047673 | Ga0495593_0092449 | Ga0495593_0092449_16_876 | 286 |
| 538 | 3300048088 | Ga0495602_0014347 | Ga0495602_0014347_1862_2722 | 286 |
| 539 | 3300048088 | Ga0495602_0184344 | Ga0495602_0184344_583_1443 | 286 |
| 540 | 3300048090 | Ga0495615_0009871 | Ga0495615_0009871_976_1836 | 286 |
| 541 | 3300048903 | Ga0496100_0065103 | Ga0496100_0065103_1226_2086 | 286 |
| 542 | 3300048907 | Ga0496104_0002070 | Ga0496104_0002070_3011_3871 | 286 |
| 543 | 3300048907 | Ga0496104_0003048 | Ga0496104_0003048_4272_5132 | 286 |
| 544 | 3300048908 | Ga0496105_0005922 | Ga0496105_0005922_4470_5330 | 286 |
| 545 | 3300048909 | Ga0496106_0037412 | Ga0496106_0037412_899_1861 | 286 |
| 546 | 3300048909 | Ga0496106_0272003 | Ga0496106_0272003_155_1015 | 286 |
| 547 | 3300048911 | Ga0496108_0000256 | Ga0496108_0000256_1877_2737 | 286 |
| 548 | 3300048911 | Ga0496108_0141800 | Ga0496108_0141800_1200_2060 | 286 |
| 549 | 3300048912 | Ga0496109_0047344 | Ga0496109_0047344_998_1858 | 286 |
| 550 | 3300048913 | Ga0496110_0037760 | Ga0496110_0037760_616_1476 | 286 |
| 551 | 3300048913 | Ga0496110_0158270 | Ga0496110_0158270_1062_2024 | 286 |
| 552 | 3300048914 | Ga0496111_0477043 | Ga0496111_0477043_13_873 | 286 |
| 553 | 3300048915 | Ga0496112_0002247 | Ga0496112_0002247_1018_1878 | 286 |
| 554 | 3300048915 | Ga0496112_0107598 | Ga0496112_0107598_394_1254 | 286 |
| 555 | 3300048915 | Ga0496112_0231771 | Ga0496112_0231771_86_946 | 286 |
| 556 | 3300048915 | Ga0496112_0487108 | Ga0496112_0487108_247_1107 | 286 |
| 557 | 3300048915 | Ga0496112_0513845 | Ga0496112_0513845_130_990 | 286 |
| 558 | 3300048916 | Ga0496113_0000175 | Ga0496113_0000175_15678_16538 | 286 |
| 559 | 3300048916 | Ga0496113_0187648 | Ga0496113_0187648_578_1438 | 286 |
| 560 | 3300048917 | Ga0496114_0305233 | Ga0496114_0305233_105_965 | 286 |
| 561 | 3300048918 | Ga0496115_0059335 | Ga0496115_0059335_745_1605 | 286 |
| 562 | 3300048918 | Ga0496115_0247874 | Ga0496115_0247874_60_920 | 286 |
| 563 | 3300048918 | Ga0496115_0305467 | Ga0496115_0305467_23_883 | 286 |
| 564 | 3300048918 | Ga0496115_0372882 | Ga0496115_0372882_267_1127 | 286 |
| 565 | 3300048919 | Ga0496116_0019351 | Ga0496116_0019351_2665_3525 | 286 |
| 566 | 3300048920 | Ga0496117_0112305 | Ga0496117_0112305_566_1426 | 286 |
| 567 | 3300048921 | Ga0496118_0005218 | Ga0496118_0005218_8885_9745 | 286 |
| 568 | 3300048924 | Ga0496121_0022335 | Ga0496121_0022335_4812_5687 | 286 |
| 569 | 3300048925 | Ga0496122_0026166 | Ga0496122_0026166_2249_3109 | 286 |
| 570 | 3300048926 | Ga0496123_0020537 | Ga0496123_0020537_1973_2833 | 286 |
| 571 | 3300048927 | Ga0496124_0137628 | Ga0496124_0137628_45_905 | 286 |
| 572 | 3300048928 | Ga0496125_0005483 | Ga0496125_0005483_5677_6537 | 286 |
| 573 | 3300048928 | Ga0496125_0011871 | Ga0496125_0011871_172_1047 | 286 |
| 574 | 3300049575 | Ga0501039_0318958 | Ga0501039_0318958_313_1173 | 286 |
| 575 | 3300049576 | Ga0501040_0167152 | Ga0501040_0167152_494_1354 | 286 |
| 576 | 3300049577 | Ga0501041_0087700 | Ga0501041_0087700_190_1050 | 286 |
| 577 | 3300049580 | Ga0501046_0171128 | Ga0501046_0171128_217_1077 | 286 |
| 578 | 3300049580 | Ga0501046_0243746 | Ga0501046_0243746_174_1034 | 286 |
| 579 | 3300049584 | Ga0501068_0136724 | Ga0501068_0136724_404_1264 | 286 |
| 580 | 3300049586 | Ga0501070_0024591 | Ga0501070_0024591_2523_3383 | 286 |
| 581 | 3300049741 | Ga0501079_0081607 | Ga0501079_0081607_515_1375 | 286 |
| 582 | 3300049742 | Ga0501080_0233049 | Ga0501080_0233049_18_878 | 286 |
| 583 | 3300049744 | Ga0501083_0143757 | Ga0501083_0143757_663_1523 | 286 |
| 584 | 3300049823 | Ga0501044_0047070 | Ga0501044_0047070_432_1292 | 286 |
| 585 | 3300050489 | nmdc:mga03683_104487_c1 | nmdc:mga03683_104487_c1_76_936 | 286 |
| 586 | 3300050489 | nmdc:mga03683_87817_c1 | nmdc:mga03683_87817_c1_401_1261 | 286 |
| 587 | 3300050490 | nmdc:mga03n38_156733_c1 | nmdc:mga03n38_156733_c1_148_1008 | 286 |
| 588 | 3300050490 | nmdc:mga03n38_47199_c1 | nmdc:mga03n38_47199_c1_140_1000 | 286 |
| 589 | 3300050492 | nmdc:mga0yw44_36112_c1 | nmdc:mga0yw44_36112_c1_269_1129 | 286 |
| 590 | 3300050492 | nmdc:mga0yw44_48488_c1 | nmdc:mga0yw44_48488_c1_498_1358 | 286 |
| 591 | 3300050492 | nmdc:mga0yw44_51691_c1 | nmdc:mga0yw44_51691_c1_270_1130 | 286 |
| 592 | 3300050492 | nmdc:mga0yw44_91712_c1 | nmdc:mga0yw44_91712_c1_520_1380 | 286 |
| 593 | 3300050494 | nmdc:mga06z11_219721_c1 | nmdc:mga06z11_219721_c1_143_1003 | 286 |
| 594 | 3300050507 | nmdc:mga05p37_28962_c1 | nmdc:mga05p37_28962_c1_338_1264 | 286 |
| 595 | 3300050507 | nmdc:mga05p37_408232_c1 | nmdc:mga05p37_408232_c1_170_1030 | 286 |
| 596 | 3300050508 | nmdc:mga09592_124292_c1 | nmdc:mga09592_124292_c1_1178_2038 | 286 |
| 597 | 3300050508 | nmdc:mga09592_185841_c1 | nmdc:mga09592_185841_c1_762_1688 | 286 |
| 598 | 3300050508 | nmdc:mga09592_193588_c1 | nmdc:mga09592_193588_c1_481_1341 | 286 |
| 599 | 3300050509 | nmdc:mga0qj67_139917_c1 | nmdc:mga0qj67_139917_c1_723_1583 | 286 |
| 600 | 3300050510 | nmdc:mga06r32_189063_c1 | nmdc:mga06r32_189063_c1_365_1225 | 286 |
| 601 | 3300050511 | nmdc:mga08y16_166046_c1 | nmdc:mga08y16_166046_c1_229_1089 | 286 |
| 602 | 3300050511 | nmdc:mga08y16_23292_c1 | nmdc:mga08y16_23292_c1_2847_3707 | 286 |
| 603 | 3300050511 | nmdc:mga08y16_384977_c1 | nmdc:mga08y16_384977_c1_508_1368 | 286 |
| 604 | 3300050511 | nmdc:mga08y16_83933_c1 | nmdc:mga08y16_83933_c1_1470_2330 | 286 |
| 605 | 3300050512 | nmdc:mga0n895_12352_c1 | nmdc:mga0n895_12352_c1_5558_6418 | 286 |
| 606 | 3300050512 | nmdc:mga0n895_12968_c2 | nmdc:mga0n895_12968_c2_3349_4209 | 286 |
| 607 | 3300050512 | nmdc:mga0n895_320793_c1 | nmdc:mga0n895_320793_c1_359_1219 | 286 |
| 608 | 3300050513 | nmdc:mga0rr50_84520_c1 | nmdc:mga0rr50_84520_c1_620_1582 | 286 |
| 609 | 3300050515 | nmdc:mga0a205_49071_c1 | nmdc:mga0a205_49071_c1_1897_2757 | 286 |
| 610 | 3300050515 | nmdc:mga0a205_5012_c1 | nmdc:mga0a205_5012_c1_7171_8031 | 286 |
| 611 | 3300050515 | nmdc:mga0a205_96567_c1 | nmdc:mga0a205_96567_c1_843_1703 | 286 |
| 612 | 3300050516 | nmdc:mga0sz30_111345_c1 | nmdc:mga0sz30_111345_c1_185_1045 | 286 |
| 613 | 3300053077 | Ga0495601_0001493 | Ga0495601_0001493_4147_5007 | 286 |
| 614 | 3300053077 | Ga0495601_0015849 | Ga0495601_0015849_3391_4251 | 286 |
| 615 | 3300053077 | Ga0495601_0019807 | Ga0495601_0019807_2346_3206 | 286 |
| 616 | 3300053077 | Ga0495601_0060880 | Ga0495601_0060880_835_1695 | 286 |
| 617 | 3300053078 | Ga0495612_0001332 | Ga0495612_0001332_304_1164 | 286 |
| 618 | 3300053078 | Ga0495612_0009950 | Ga0495612_0009950_1505_2365 | 286 |
| 619 | 3300053084 | Ga0495595_0000657 | Ga0495595_0000657_348_1208 | 286 |
| 620 | 3300053084 | Ga0495595_0008331 | Ga0495595_0008331_2480_3340 | 286 |
| 621 | 3300053085 | Ga0495619_0000426 | Ga0495619_0000426_18038_18898 | 286 |
| 622 | 3300053085 | Ga0495619_0002191 | Ga0495619_0002191_2618_3478 | 286 |
| 623 | 3300053085 | Ga0495619_0004170 | Ga0495619_0004170_2510_3370 | 286 |
| 624 | 3300053085 | Ga0495619_0038587 | Ga0495619_0038587_33_893 | 286 |
| 625 | 3300053087 | Ga0500643_039304 | Ga0500643_039304_368_1228 | 286 |
| 626 | 3300053088 | Ga0500644_0001423 | Ga0500644_0001423_4578_5438 | 286 |
| 627 | 3300053139 | Ga0500568_0008666 | Ga0500568_0008666_2140_3000 | 286 |
| 628 | 3300053156 | Ga0500622_0000206 | Ga0500622_0000206_2161_3021 | 286 |
| 629 | 3300053730 | Ga0500645_000051 | Ga0500645_000051_3955_4815 | 286 |
| 630 | 3300060353 | Ga0501082_0000205 | Ga0501082_0000205_17546_18406 | 286 |
| 631 | 3300060353 | Ga0501082_0066377 | Ga0501082_0066377_148_1008 | 286 |
| 632 | 3300061734 | Ga0530510_0032448 | Ga0530510_0032448_505_1365 | 286 |
| 633 | 3300061734 | Ga0530510_0336436 | Ga0530510_0336436_235_1095 | 286 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1l7v-assembly1.cif.gz_B | bacterial abc transporter involved in b12 uptake | 0.5615 | 5 | 274 |
| 1l7v-assembly1.cif.gz_B | bacterial abc transporter involved in b12 uptake | 0.5303 | 5 | 274 |
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.5168 | 2 | 274 |
| 4dbl-assembly2.cif.gz_F | crystal structure of e159q mutant of btucdf | 0.5156 | 7 | 273 |
| 4dbl-assembly2.cif.gz_F | crystal structure of e159q mutant of btucdf | 0.484 | 7 | 273 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8844 | 5 | 272 | 1.10.3470.10 |
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8403 | 5 | 272 | 1.10.3470.10 |
| af_Q58665_14_295_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8373 | 5 | 273 | 1.10.3470.10 |
| af_P77672_36_301_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8146 | 1 | 272 | 1.10.3470.10 |
| af_P0AGI1_45_314_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8121 | 5 | 270 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A060ICN4-F1-model_v4 | High-affinity branched-chain amino acid ABC transporter permease protein | 0.9839 | 1 | 246 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A3C0Y9Y6-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9761 | 1 | 260 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A522GJA6-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9733 | 2 | 284 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A127F4L3-F1-model_v4 | Branched-chain amino acid ABC transport system permease | 0.9724 | 4 | 284 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A537X4V6-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9717 | 44 | 279 |
GO:0005886
GO:0006865 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar