F471067

General Info

Members Datasets Scaffolds Average Seq Length
633 271 1266 118

Family's Representative Sequence

Representative Sequence 3300006881|Ga0068865_101870036|Ga0068865_1018700362
Length 139
Sequence MSSVARLPKQERNPGRMSASPMPKEPSDRIELLQGTLDMLILRTLLFGAAHGHQIAKHIQRTTDDLLQVEHGSLYPALHRLERRGWIVAKWEAAAKDLKREFKYYRLTPAGKKQLLAEESKWKQMTGAIARIMWPAEES

Samples

Sample ID Description Type Environment
1 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
166 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
195 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
196 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
197 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
231 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
251 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
252 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
268 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
271 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 1.74
Rhizosphere 92.58
Stem 0
Stem Tuber 0
Unclassified 37.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068865_101870036 3300006881 Unclassified 543
2 rootH2_10194854 3300003320 Bacteria 1867
3 Ga0070676_10804560 3300005328 Unclassified 694
4 Ga0070683_100001260 3300005329 Bacteria 19270
5 Ga0070690_100099871 3300005330 Bacteria 1923
6 Ga0070690_100721155 3300005330 Unclassified 767
7 Ga0070690_101265196 3300005330 Bacteria 590
8 Ga0070670_100345696 3300005331 Unclassified 1306
9 Ga0070670_100493599 3300005331 Unclassified 1088
10 Ga0070670_100909363 3300005331 Unclassified 798
11 Ga0068869_100250128 3300005334 Bacteria 1415
12 Ga0070666_10736180 3300005335 Unclassified 724
13 Ga0070666_10891739 3300005335 Unclassified 657
14 Ga0070666_11442698 3300005335 Unclassified 514
15 Ga0070680_100357628 3300005336 Unclassified 1242
16 Ga0070680_100713151 3300005336 Unclassified 863
17 Ga0070660_100164717 3300005339 Bacteria 1788
18 Ga0070689_100196894 3300005340 Bacteria 1643
19 Ga0070689_100230009 3300005340 Unclassified 1524
20 Ga0070689_100737714 3300005340 Unclassified 862
21 Ga0070691_10000025 3300005341 Bacteria 41015
22 Ga0070661_100204987 3300005344 Bacteria 1508
23 Ga0070669_100306214 3300005353 Bacteria 1279
24 Ga0070669_100462588 3300005353 Bacteria 1047
25 Ga0070675_100003547 3300005354 Bacteria 11842
26 Ga0070675_100893777 3300005354 Bacteria 814
27 Ga0070675_101369921 3300005354 Unclassified 652
28 Ga0070674_101063211 3300005356 Unclassified 713
29 Ga0070673_100182186 3300005364 Bacteria 1799
30 Ga0070673_101288015 3300005364 Bacteria 686
31 Ga0070688_100239795 3300005365 Bacteria 1286
32 Ga0070688_100554313 3300005365 Unclassified 874
33 Ga0070659_101999775 3300005366 Unclassified 520
34 Ga0070709_10349076 3300005434 Bacteria 1093
35 Ga0070709_10919892 3300005434 Unclassified 692
36 Ga0070714_100050492 3300005435 Bacteria 3544
37 Ga0070714_100610864 3300005435 Unclassified 1048
38 Ga0070714_101066045 3300005435 Bacteria 787
39 Ga0070714_101364337 3300005435 Unclassified 692
40 Ga0070713_100022699 3300005436 Bacteria 4853
41 Ga0070713_100042226 3300005436 Unclassified 3721
42 Ga0070713_100053730 3300005436 Unclassified 3339
43 Ga0070713_100269134 3300005436 Bacteria 1560
44 Ga0070713_100393859 3300005436 Bacteria 1292
45 Ga0070711_100089601 3300005439 Bacteria 2213
46 Ga0070711_100127778 3300005439 Bacteria 1889
47 Ga0070711_100213962 3300005439 Bacteria 1494
48 Ga0070711_100255677 3300005439 Bacteria 1376
49 Ga0070711_101530522 3300005439 Bacteria 582
50 Ga0070705_100277991 3300005440 Unclassified 1189
51 Ga0070700_100310313 3300005441 Unclassified 1155
52 Ga0070694_100152174 3300005444 Bacteria 1690
53 Ga0070694_100162860 3300005444 Unclassified 1638
54 Ga0070694_100946674 3300005444 Bacteria 713
55 Ga0070694_101124586 3300005444 Bacteria 656
56 Ga0070694_101365479 3300005444 Unclassified 597
57 Ga0070708_100007058 3300005445 Bacteria 8963
58 Ga0070708_100222976 3300005445 Bacteria 1768
59 Ga0070708_100933682 3300005445 Bacteria 814
60 Ga0070663_100699819 3300005455 Unclassified 861
61 Ga0070663_101921115 3300005455 Unclassified 532
62 Ga0070681_10017510 3300005458 Bacteria 7161
63 Ga0070681_10053985 3300005458 Unclassified 4004
64 Ga0070681_10056692 3300005458 Bacteria 3899
65 Ga0070681_10248656 3300005458 Bacteria 1691
66 Ga0068867_100630580 3300005459 Unclassified 938
67 Ga0070685_10331778 3300005466 Unclassified 1034
68 Ga0070685_10561674 3300005466 Unclassified 816
69 Ga0070706_100018931 3300005467 Bacteria 6351
70 Ga0070706_100651397 3300005467 Bacteria 978
71 Ga0070706_101300254 3300005467 Bacteria 667
72 Ga0070707_100190668 3300005468 Unclassified 1999
73 Ga0070707_100403596 3300005468 Bacteria 1327
74 Ga0070707_101505804 3300005468 Bacteria 640
75 Ga0070698_100040425 3300005471 Bacteria 4792
76 Ga0070698_101213402 3300005471 Unclassified 704
77 Ga0070699_100238580 3300005518 Bacteria 1622
78 Ga0070699_100503024 3300005518 Bacteria 1101
79 Ga0070699_100907987 3300005518 Unclassified 807
80 Ga0070699_102192889 3300005518 Unclassified 504
81 Ga0070679_100112556 3300005530 Bacteria 2707
82 Ga0070679_100126019 3300005530 Unclassified 2543
83 Ga0070679_100287336 3300005530 Bacteria 1596
84 Ga0070679_100352577 3300005530 Bacteria 1419
85 Ga0070684_100000569 3300005535 Bacteria 25491
86 Ga0070684_100034261 3300005535 Bacteria 4341
87 Ga0070684_100187288 3300005535 Unclassified 1882
88 Ga0070684_100605058 3300005535 Bacteria 1019
89 Ga0070697_100007205 3300005536 Bacteria 8648
90 Ga0070697_100067722 3300005536 Bacteria 2921
91 Ga0070697_102092720 3300005536 Unclassified 507
92 Ga0068853_100051174 3300005539 Bacteria 3555
93 Ga0068853_100950661 3300005539 Unclassified 826
94 Ga0070672_100883180 3300005543 Unclassified 789
95 Ga0070672_100894895 3300005543 Bacteria 784
96 Ga0070695_100020986 3300005545 Bacteria 3993
97 Ga0070695_100197330 3300005545 Unclassified 1436
98 Ga0070696_100001913 3300005546 Bacteria 13699
99 Ga0070696_100520330 3300005546 Unclassified 949
100 Ga0070696_100961231 3300005546 Bacteria 712
101 Ga0070693_100005864 3300005547 Bacteria 5934
102 Ga0070665_100772731 3300005548 Bacteria 974
103 Ga0070665_101798652 3300005548 Unclassified 619
104 Ga0070704_100003082 3300005549 Bacteria 9487
105 Ga0070704_100209708 3300005549 Unclassified 1578
106 Ga0070704_100961409 3300005549 Unclassified 771
107 Ga0068855_100007973 3300005563 Bacteria 12794
108 Ga0068855_100288423 3300005563 Bacteria 1820
109 Ga0068855_100610681 3300005563 Bacteria 1175
110 Ga0068855_101525512 3300005563 Bacteria 685
111 Ga0068855_101846268 3300005563 Unclassified 613
112 Ga0068857_100000789 3300005577 Bacteria 23683
113 Ga0068857_100003905 3300005577 Bacteria 12548
114 Ga0068857_100460541 3300005577 Unclassified 1190
115 Ga0068857_100897540 3300005577 Unclassified 850
116 Ga0068854_101099976 3300005578 Bacteria 708
117 Ga0068856_100220358 3300005614 Bacteria 1912
118 Ga0068856_100323456 3300005614 Bacteria 1560
119 Ga0068852_100003718 3300005616 Bacteria 10695
120 Ga0068852_100603913 3300005616 Unclassified 1102
121 Ga0068852_101347040 3300005616 Unclassified 736
122 Ga0068852_102155899 3300005616 Bacteria 579
123 Ga0068859_100009499 3300005617 Bacteria 9822
124 Ga0068859_100194201 3300005617 Bacteria 2114
125 Ga0068859_100672172 3300005617 Bacteria 1127
126 Ga0068864_100312780 3300005618 Bacteria 1473
127 Ga0068864_100780511 3300005618 Unclassified 938
128 Ga0068866_11057376 3300005718 Unclassified 579
129 Ga0068861_101159079 3300005719 Unclassified 745
130 Ga0068851_10013902 3300005834 Bacteria 3814
131 Ga0068870_10018219 3300005840 Unclassified 3387
132 Ga0068870_10055592 3300005840 Bacteria 2109
133 Ga0068863_101328052 3300005841 Unclassified 726
134 Ga0068863_102135540 3300005841 Bacteria 570
135 Ga0068863_102396326 3300005841 Unclassified 537
136 Ga0068858_100636002 3300005842 Bacteria 1036
137 Ga0068858_101300574 3300005842 Unclassified 716
138 Ga0068860_100033059 3300005843 Bacteria 4966
139 Ga0068860_100129690 3300005843 Bacteria 2419
140 Ga0068860_101060468 3300005843 Unclassified 829
141 Ga0068860_101549029 3300005843 Unclassified 685
142 Ga0068860_102265354 3300005843 Unclassified 564
143 Ga0068862_100089758 3300005844 Bacteria 2675
144 Ga0068862_100994727 3300005844 Viruses 829
145 Ga0070717_10070005 3300006028 Bacteria 2923
146 Ga0070717_10261672 3300006028 Unclassified 1531
147 Ga0070717_10644872 3300006028 Unclassified 961
148 Ga0070717_11058031 3300006028 Unclassified 739
149 Ga0070717_11447466 3300006028 Bacteria 624
150 Ga0075432_10362058 3300006058 Unclassified 617
151 Ga0070716_100184389 3300006173 Bacteria 1373
152 Ga0070712_100004714 3300006175 Bacteria 8433
153 Ga0070712_100005089 3300006175 Bacteria 8141
154 Ga0070712_100110180 3300006175 Bacteria 2053
155 Ga0075367_10390649 3300006178 Bacteria 880
156 Ga0097621_101451667 3300006237 Unclassified 650
157 Ga0068871_100050175 3300006358 Bacteria 3375
158 Ga0068871_100317028 3300006358 Bacteria 1372
159 Ga0068871_102054595 3300006358 Unclassified 544
160 Ga0075428_100050137 3300006844 Bacteria 4579
161 Ga0075428_100092439 3300006844 Bacteria 3298
162 Ga0075428_100460354 3300006844 Bacteria 1362
163 Ga0075430_100022574 3300006846 Bacteria 5355
164 Ga0075430_100023589 3300006846 Bacteria 5239
165 Ga0075430_100353848 3300006846 Bacteria 1213
166 Ga0075430_101617579 3300006846 Unclassified 532
167 Ga0075431_100013268 3300006847 Bacteria 8324
168 Ga0075431_100068753 3300006847 Bacteria 3655
169 Ga0075431_100218568 3300006847 Unclassified 1944
170 Ga0075431_100300893 3300006847 Unclassified 1620
171 Ga0075434_100070284 3300006871 Bacteria 3491
172 Ga0075434_100528259 3300006871 Bacteria 1200
173 Ga0075434_100787848 3300006871 Bacteria 967
174 Ga0075429_100043178 3300006880 Bacteria 3922
175 Ga0075429_100348636 3300006880 Unclassified 1296
176 Ga0075429_100762343 3300006880 Bacteria 848
177 Ga0068865_100207038 3300006881 Unclassified 1526
178 Ga0068865_101563967 3300006881 Bacteria 592
179 Ga0075436_100096773 3300006914 Bacteria 2053
180 Ga0075436_100716284 3300006914 Bacteria 742
181 Ga0097620_100009498 3300006931 Bacteria 9822
182 Ga0097620_100194200 3300006931 Bacteria 2114
183 Ga0097620_100672142 3300006931 Bacteria 1127
184 Ga0097620_103085024 3300006931 Bacteria 508
185 Ga0075435_100567650 3300007076 Unclassified 983
186 Ga0075435_100608032 3300007076 Bacteria 948
187 Ga0099794_10343105 3300007265 Unclassified 776
188 Ga0105240_10002088 3300009093 Bacteria 32712
189 Ga0105240_10053001 3300009093 Bacteria 5096
190 Ga0105240_10071936 3300009093 Bacteria 4275
191 Ga0105240_10076145 3300009093 Unclassified 4137
192 Ga0105240_10411563 3300009093 Bacteria 1521
193 Ga0105240_10449933 3300009093 Bacteria 1441
194 Ga0105240_10526071 3300009093 Bacteria 1312
195 Ga0105240_11230027 3300009093 Bacteria 792
196 Ga0111539_10006899 3300009094 Bacteria 14589
197 Ga0111539_10123500 3300009094 Bacteria 3034
198 Ga0105245_10009716 3300009098 Bacteria 8389
199 Ga0105245_10396319 3300009098 Bacteria 1378
200 Ga0105245_10829049 3300009098 Bacteria 964
201 Ga0105245_11098783 3300009098 Bacteria 841
202 Ga0105245_12762141 3300009098 Unclassified 544
203 Ga0114129_10068086 3300009147 Bacteria 4965
204 Ga0114129_10149271 3300009147 Bacteria 3199
205 Ga0114129_10257092 3300009147 Bacteria 2342
206 Ga0114129_10593857 3300009147 Bacteria 1435
207 Ga0114129_10638722 3300009147 Bacteria 1375
208 Ga0114129_11190610 3300009147 Unclassified 950
209 Ga0105243_10217118 3300009148 Bacteria 1688
210 Ga0105243_12410007 3300009148 Bacteria 565
211 Ga0105241_10029048 3300009174 Bacteria 4122
212 Ga0105241_10060179 3300009174 Bacteria 2921
213 Ga0105241_11020972 3300009174 Unclassified 775
214 Ga0105241_11364689 3300009174 Bacteria 677
215 Ga0105242_10011977 3300009176 Bacteria 6676
216 Ga0105242_10344449 3300009176 Unclassified 1374
217 Ga0105242_10805309 3300009176 Bacteria 930
218 Ga0105242_12278854 3300009176 Bacteria 588
219 Ga0105248_10106284 3300009177 Unclassified 3165
220 Ga0105248_10149760 3300009177 Bacteria 2633
221 Ga0105248_10309363 3300009177 Bacteria 1779
222 Ga0105248_10625218 3300009177 Unclassified 1215
223 Ga0105248_12703570 3300009177 Bacteria 566
224 Ga0105237_10012917 3300009545 Bacteria 8774
225 Ga0105237_10015531 3300009545 Bacteria 7921
226 Ga0105237_10024504 3300009545 Bacteria 6172
227 Ga0105237_10780600 3300009545 Unclassified 962
228 Ga0105237_10785625 3300009545 Unclassified 959
229 Ga0105237_11417974 3300009545 Bacteria 701
230 Ga0105237_11617205 3300009545 Unclassified 655
231 Ga0105237_11901980 3300009545 Bacteria 603
232 Ga0105238_10025924 3300009551 Bacteria 5976
233 Ga0105238_10063743 3300009551 Bacteria 3686
234 Ga0105238_10860593 3300009551 Bacteria 924
235 Ga0105238_11028068 3300009551 Unclassified 845
236 Ga0105249_10052984 3300009553 Unclassified 3707
237 Ga0105249_10083925 3300009553 Bacteria 2966
238 Ga0105249_10202712 3300009553 Unclassified 1942
239 Ga0105249_10627930 3300009553 Bacteria 1131
240 Ga0099796_10413276 3300010159 Unclassified 594
241 Ga0105239_10000502 3300010375 Bacteria 56682
242 Ga0105239_10177867 3300010375 Unclassified 2380
243 Ga0105239_10183307 3300010375 Unclassified 2343
244 Ga0105239_10336075 3300010375 Bacteria 1704
245 Ga0105239_10548332 3300010375 Bacteria 1317
246 Ga0105239_10677787 3300010375 Bacteria 1178
247 Ga0105239_11094877 3300010375 Unclassified 917
248 Ga0105246_10003731 3300011119 Bacteria 9226
249 Ga0105246_10255962 3300011119 Bacteria 1392
250 Ga0105246_10826395 3300011119 Unclassified 824
251 Ga0105246_10983209 3300011119 Unclassified 763
252 Ga0105246_11148564 3300011119 Bacteria 712
253 Ga0157313_1040352 3300012503 Bacteria 570
254 Ga0157373_10216961 3300013100 Bacteria 1349
255 Ga0157373_10248202 3300013100 Bacteria 1259
256 Ga0157371_10336482 3300013102 Bacteria 1097
257 Ga0157370_10019384 3300013104 Bacteria 6825
258 Ga0157370_10097759 3300013104 Bacteria 2754
259 Ga0157370_10162460 3300013104 Unclassified 2078
260 Ga0157370_10320792 3300013104 Bacteria 1429
261 Ga0157370_10454868 3300013104 Bacteria 1177
262 Ga0157369_10002403 3300013105 Bacteria 22497
263 Ga0157369_10009602 3300013105 Bacteria 11065
264 Ga0157369_10028745 3300013105 Bacteria 6149
265 Ga0157369_10103281 3300013105 Bacteria 3036
266 Ga0157369_10261716 3300013105 Unclassified 1804
267 Ga0157369_10583662 3300013105 Bacteria 1154
268 Ga0157369_10600390 3300013105 Bacteria 1136
269 Ga0157374_10006661 3300013296 Bacteria 9814
270 Ga0157374_10528474 3300013296 Unclassified 1186
271 Ga0157374_10698198 3300013296 Bacteria 1028
272 Ga0157374_12245861 3300013296 Unclassified 573
273 Ga0157378_10306266 3300013297 Bacteria 1539
274 Ga0163162_10085836 3300013306 Bacteria 3225
275 Ga0163162_10540450 3300013306 Unclassified 1294
276 Ga0163162_10872647 3300013306 Unclassified 1014
277 Ga0163162_11286883 3300013306 Unclassified 831
278 Ga0163162_11763355 3300013306 Bacteria 707
279 Ga0163162_13039561 3300013306 Unclassified 539
280 Ga0157372_10031550 3300013307 Bacteria 5801
281 Ga0157372_10165279 3300013307 Bacteria 2559
282 Ga0157372_10172509 3300013307 Unclassified 2502
283 Ga0157372_11012561 3300013307 Bacteria 962
284 Ga0157372_12035172 3300013307 Bacteria 660
285 Ga0157372_12488056 3300013307 Unclassified 594
286 Ga0157375_10010846 3300013308 Bacteria 8030
287 Ga0157375_10161667 3300013308 Unclassified 2381
288 Ga0157375_12584003 3300013308 Unclassified 607
289 Ga0157375_12790456 3300013308 Bacteria 584
290 Ga0163163_10008287 3300014325 Bacteria 9224
291 Ga0163163_10059635 3300014325 Bacteria 3776
292 Ga0163163_10071061 3300014325 Bacteria 3467
293 Ga0163163_10310696 3300014325 Bacteria 1629
294 Ga0157379_10254358 3300014968 Bacteria 1595
295 Ga0157379_10590022 3300014968 Bacteria 1036
296 Ga0157379_11340366 3300014968 Bacteria 692
297 Ga0157379_12558199 3300014968 Unclassified 511
298 Ga0157376_10521280 3300014969 Bacteria 1171
299 Ga0157376_10638678 3300014969 Bacteria 1064
300 Ga0157376_11432494 3300014969 Unclassified 723
301 Ga0157376_11476840 3300014969 Unclassified 712
302 Ga0157376_11514614 3300014969 Bacteria 704
303 Ga0213876_10051555 3300021384 Unclassified 2175
304 Ga0213875_10051130 3300021388 Bacteria 1936
305 Ga0213875_10051175 3300021388 Bacteria 1935
306 Ga0213875_10073377 3300021388 Bacteria 1597
307 Ga0213875_10472007 3300021388 Unclassified 601
308 Ga0228598_1000296 3300024227 Bacteria 9671
309 Ga0207656_10099644 3300025321 Bacteria 1330
310 Ga0207692_10451851 3300025898 Unclassified 809
311 Ga0207680_10230202 3300025903 Unclassified 1274
312 Ga0207647_10546027 3300025904 Unclassified 643
313 Ga0207699_10138121 3300025906 Unclassified 1599
314 Ga0207699_10373400 3300025906 Bacteria 1011
315 Ga0207643_10067494 3300025908 Unclassified 2053
316 Ga0207684_10006099 3300025910 Bacteria 11024
317 Ga0207684_10521446 3300025910 Bacteria 1018
318 Ga0207684_11402003 3300025910 Bacteria 572
319 Ga0207654_10080785 3300025911 Bacteria 1956
320 Ga0207654_10089811 3300025911 Bacteria 1870
321 Ga0207654_10690389 3300025911 Bacteria 733
322 Ga0207707_10375693 3300025912 Bacteria 1222
323 Ga0207707_10882208 3300025912 Unclassified 740
324 Ga0207695_10000808 3300025913 Bacteria 58272
325 Ga0207695_10017373 3300025913 Bacteria 8371
326 Ga0207695_10039201 3300025913 Bacteria 5093
327 Ga0207695_10154449 3300025913 Bacteria 2231
328 Ga0207695_10178334 3300025913 Bacteria 2046
329 Ga0207695_10461767 3300025913 Unclassified 1153
330 Ga0207695_11200021 3300025913 Bacteria 639
331 Ga0207671_10009726 3300025914 Bacteria 8003
332 Ga0207671_10010284 3300025914 Bacteria 7732
333 Ga0207671_10276673 3300025914 Unclassified 1323
334 Ga0207671_10902323 3300025914 Bacteria 699
335 Ga0207693_10004156 3300025915 Bacteria 12279
336 Ga0207693_10136899 3300025915 Bacteria 1926
337 Ga0207693_10221622 3300025915 Bacteria 1486
338 Ga0207663_10007962 3300025916 Bacteria 5529
339 Ga0207663_10045214 3300025916 Unclassified 2707
340 Ga0207663_10576802 3300025916 Bacteria 882
341 Ga0207660_10155932 3300025917 Unclassified 1758
342 Ga0207657_10034778 3300025919 Bacteria 4526
343 Ga0207652_10069032 3300025921 Bacteria 3068
344 Ga0207652_10155727 3300025921 Unclassified 2047
345 Ga0207652_10309759 3300025921 Bacteria 1425
346 Ga0207652_10985406 3300025921 Unclassified 741
347 Ga0207646_10296975 3300025922 Bacteria 1460
348 Ga0207646_11064309 3300025922 Unclassified 713
349 Ga0207646_11178856 3300025922 Bacteria 672
350 Ga0207681_10438126 3300025923 Bacteria 1061
351 Ga0207694_10001446 3300025924 Bacteria 20345
352 Ga0207694_10276508 3300025924 Bacteria 1378
353 Ga0207650_10421643 3300025925 Unclassified 1107
354 Ga0207650_11114050 3300025925 Unclassified 672
355 Ga0207659_10004960 3300025926 Bacteria 8068
356 Ga0207659_10603527 3300025926 Unclassified 936
357 Ga0207659_10609819 3300025926 Bacteria 931
358 Ga0207687_10123712 3300025927 Bacteria 1938
359 Ga0207687_10181462 3300025927 Unclassified 1631
360 Ga0207687_10447192 3300025927 Bacteria 1071
361 Ga0207687_11560144 3300025927 Unclassified 567
362 Ga0207700_10041597 3300025928 Unclassified 3364
363 Ga0207700_10203759 3300025928 Unclassified 1668
364 Ga0207700_10210511 3300025928 Bacteria 1643
365 Ga0207700_10249289 3300025928 Bacteria 1516
366 Ga0207700_10734596 3300025928 Unclassified 882
367 Ga0207664_10186766 3300025929 Bacteria 1782
368 Ga0207664_10331834 3300025929 Bacteria 1344
369 Ga0207644_11497867 3300025931 Unclassified 566
370 Ga0207686_10002661 3300025934 Bacteria 9688
371 Ga0207686_10052428 3300025934 Bacteria 2546
372 Ga0207709_10226018 3300025935 Bacteria 1353
373 Ga0207670_10162345 3300025936 Bacteria 1669
374 Ga0207670_10510368 3300025936 Unclassified 977
375 Ga0207669_11382002 3300025937 Unclassified 599
376 Ga0207704_10057836 3300025938 Bacteria 2384
377 Ga0207704_11425157 3300025938 Bacteria 594
378 Ga0207704_11473604 3300025938 Bacteria 584
379 Ga0207665_10165830 3300025939 Bacteria 1592
380 Ga0207711_10198084 3300025941 Unclassified 1832
381 Ga0207711_11575853 3300025941 Bacteria 600
382 Ga0207689_10099309 3300025942 Bacteria 2392
383 Ga0207689_10203075 3300025942 Bacteria 1636
384 Ga0207689_10429451 3300025942 Bacteria 1103
385 Ga0207661_10041781 3300025944 Bacteria 3611
386 Ga0207661_10119871 3300025944 Bacteria 2238
387 Ga0207661_10185363 3300025944 Unclassified 1821
388 Ga0207661_10662633 3300025944 Unclassified 959
389 Ga0207679_10751274 3300025945 Unclassified 887
390 Ga0207679_10753832 3300025945 Unclassified 886
391 Ga0207679_11223563 3300025945 Unclassified 689
392 Ga0207679_11627033 3300025945 Bacteria 592
393 Ga0207667_10000673 3300025949 Bacteria 44277
394 Ga0207667_12022315 3300025949 Bacteria 536
395 Ga0207651_10120753 3300025960 Bacteria 1987
396 Ga0207712_10514236 3300025961 Bacteria 1025
397 Ga0207668_10525963 3300025972 Unclassified 1021
398 Ga0207668_10940563 3300025972 Bacteria 770
399 Ga0207640_11726500 3300025981 Bacteria 565
400 Ga0207658_10033734 3300025986 Bacteria 3653
401 Ga0207703_10139173 3300026035 Bacteria 2105
402 Ga0207703_10142936 3300026035 Bacteria 2078
403 Ga0207703_10941842 3300026035 Bacteria 828
404 Ga0207639_10818330 3300026041 Bacteria 868
405 Ga0207639_10880073 3300026041 Unclassified 837
406 Ga0207708_10654808 3300026075 Unclassified 894
407 Ga0207702_10037853 3300026078 Bacteria 4040
408 Ga0207702_10072707 3300026078 Bacteria 2964
409 Ga0207702_10175059 3300026078 Bacteria 1971
410 Ga0207702_11290466 3300026078 Unclassified 724
411 Ga0207641_11228405 3300026088 Unclassified 749
412 Ga0207641_11995879 3300026088 Bacteria 581
413 Ga0207648_10023321 3300026089 Bacteria 5547
414 Ga0207648_11985976 3300026089 Bacteria 543
415 Ga0207676_11012216 3300026095 Bacteria 819
416 Ga0207674_10000109 3300026116 Bacteria 94920
417 Ga0207674_10006906 3300026116 Bacteria 13298
418 Ga0207674_10229513 3300026116 Bacteria 1804
419 Ga0207674_10581577 3300026116 Unclassified 1082
420 Ga0207675_100936917 3300026118 Unclassified 883
421 Ga0207698_10178285 3300026142 Bacteria 1879
422 Ga0207698_10457956 3300026142 Bacteria 1233
423 Ga0207698_12476609 3300026142 Bacteria 529
424 Ga0207428_10019404 3300027907 Bacteria 5798
425 Ga0207428_10100717 3300027907 Bacteria 2233
426 Ga0207428_10485193 3300027907 Bacteria 899
427 Ga0268266_10108439 3300028379 Bacteria 2457
428 Ga0268266_10234383 3300028379 Bacteria 1692
429 Ga0268266_11242651 3300028379 Unclassified 720
430 Ga0268264_10156277 3300028381 Bacteria 2050
431 Ga0265323_10002130 3300028653 Bacteria 9230
432 Ga0265338_10089049 3300028800 Bacteria 2559
433 Ga0265338_11161066 3300028800 Bacteria 519
434 Ga0265762_1011299 3300030760 Bacteria 1597
435 Ga0265762_1052667 3300030760 Bacteria 821
436 Ga0265760_10140068 3300031090 Unclassified 787
437 Ga0265325_10343765 3300031241 Bacteria 660
438 Ga0265325_10368252 3300031241 Unclassified 633
439 Ga0265340_10037801 3300031247 Bacteria 2390
440 Ga0265340_10147505 3300031247 Bacteria 1074
441 Ga0265331_10069103 3300031250 Bacteria 1655
442 Ga0265331_10136048 3300031250 Bacteria 1119
443 Ga0265331_10163949 3300031250 Bacteria 1007
444 Ga0265316_10039847 3300031344 Bacteria 3770
445 Ga0265316_10452069 3300031344 Unclassified 921
446 Ga0265314_10003017 3300031711 Bacteria 16637
447 Ga0265314_10021585 3300031711 Unclassified 4945
448 Ga0265314_10348166 3300031711 Unclassified 816
449 Ga0265342_10045347 3300031712 Unclassified 2646
450 Ga0265342_10063999 3300031712 Bacteria 2160
451 Ga0307405_10340668 3300031731 Bacteria 1153
452 Ga0307405_10502669 3300031731 Unclassified 972
453 Ga0307413_10318870 3300031824 Bacteria 1186
454 Ga0307410_10669176 3300031852 Unclassified 872
455 Ga0307407_10234579 3300031903 Bacteria 1248
456 Ga0307412_10220381 3300031911 Unclassified 1454
457 Ga0307412_10345347 3300031911 Bacteria 1193
458 Ga0307416_101155000 3300032002 Unclassified 880
459 Ga0307414_11583594 3300032004 Unclassified 610
460 Ga0307411_10546843 3300032005 Bacteria 987
461 Ga0307510_10024079 3300033180 Bacteria 7042
462 Ga0307510_10055224 3300033180 Bacteria 4150
463 Ga0373954_0101165 3300035118 Unclassified 1391
464 Ga0373955_0797109 3300035172 Unclassified 581
465 Ga0373924_0548194 3300035410 Unclassified 521
466 Ga0373935_0329198 3300035692 Unclassified 1085
467 Ga0373935_1179977 3300035692 Unclassified 571
468 Ga0373927_0113843 3300035695 Bacteria 1763
469 Ga0373927_0991560 3300035695 Unclassified 554
470 Ga0373933_1165735 3300035724 Unclassified 508
471 Ga0373937_0656377 3300036401 Unclassified 995
472 Ga0373925_0293305 3300037068 Bacteria 1312
473 Ga0373925_0314770 3300037068 Bacteria 1266
474 Ga0373925_0403767 3300037068 Bacteria 1115
475 Ga0373925_1542379 3300037068 Unclassified 543
476 Ga0395900_0273630 3300037418 Bacteria 1683
477 Ga0395900_0781316 3300037418 Bacteria 884
478 Ga0395898_0067057 3300037466 Unclassified 3476
479 Ga0436364_0025059 3300037853 Bacteria 838
480 Ga0436364_0067778 3300037853 Unclassified 858
481 Ga0436364_0141740 3300037853 Bacteria 1359
482 Ga0436364_0195132 3300037853 Unclassified 2599
483 Ga0436364_0268926 3300037853 Unclassified 528
484 Ga0436364_0877711 3300037853 Bacteria 5472
485 Ga0436364_0909864 3300037853 Unclassified 2241
486 Ga0436364_0923833 3300037853 Unclassified 629
487 Ga0436364_0980994 3300037853 Bacteria 1300
488 Ga0436364_1038348 3300037853 Bacteria 2199
489 Ga0436364_1150490 3300037853 Bacteria 5923
490 Ga0436364_1191071 3300037853 Unclassified 981
491 Ga0436364_1227489 3300037853 Bacteria 11896
492 Ga0436364_1314471 3300037853 Bacteria 781
493 Ga0436364_1358164 3300037853 Bacteria 3039
494 Ga0436364_1416338 3300037853 Unclassified 3717
495 Ga0436365_0088699 3300039437 Unclassified 761
496 Ga0436365_0277722 3300039437 Unclassified 2644
497 Ga0436365_0612070 3300039437 Unclassified 847
498 Ga0436365_1179091 3300039437 Bacteria 1866
499 Ga0436365_1198862 3300039437 Unclassified 3381
500 Ga0436360_0118015 3300039438 Unclassified 596
501 Ga0436361_0271610 3300039447 Bacteria 15971
502 Ga0436363_0535897 3300039450 Unclassified 669
503 Ga0436362_0006487 3300039453 Unclassified 598
504 Ga0436362_1179268 3300039453 Unclassified 717
505 Ga0451800_1549858 3300041459 Unclassified 825
506 Ga0439441_042378 3300042001 Unclassified 916
507 Ga0466966_0336720 3300044684 Unclassified 907
508 Ga0453684_0162723 3300044712 Bacteria 2638
509 Ga0466959_0479060 3300045049 Unclassified 842
510 Ga0466959_0785445 3300045049 Unclassified 637
511 Ga0451576_0594878 3300045051 Bacteria 1163
512 Ga0451576_2296105 3300045051 Unclassified 553
513 Ga0451576_2447823 3300045051 Unclassified 534
514 Ga0466958_0760330 3300045836 Unclassified 632
515 Ga0495592_0637466 3300046454 Unclassified 647
516 Ga0495592_0721596 3300046454 Unclassified 598
517 Ga0495592_0795905 3300046454 Bacteria 562
518 Ga0495651_0102645 3300046462 Bacteria 2126
519 Ga0495653_0016554 3300046463 Bacteria 6001
520 Ga0495580_0000042 3300046472 Bacteria 70551
521 Ga0495580_0000643 3300046472 Bacteria 29655
522 Ga0495580_0076953 3300046472 Bacteria 2327
523 Ga0495580_0176034 3300046472 Bacteria 1478
524 Ga0495582_0009201 3300046473 Bacteria 5448
525 Ga0495662_0365916 3300046476 Unclassified 708
526 Ga0495664_0227041 3300046477 Bacteria 1130
527 Ga0495664_0321887 3300046477 Bacteria 932
528 Ga0495594_0041666 3300046499 Unclassified 2514
529 Ga0495608_0239565 3300046511 Unclassified 1134
530 Ga0495608_0532870 3300046511 Unclassified 709
531 Ga0495608_0593243 3300046511 Unclassified 665
532 Ga0495618_0220726 3300046514 Bacteria 1196
533 Ga0495628_0832866 3300046516 Bacteria 644
534 Ga0495652_0149175 3300046529 Bacteria 1829
535 Ga0495665_0049616 3300046531 Bacteria 2225
536 Ga0495640_0254639 3300046533 Bacteria 1098
537 Ga0495586_0099030 3300046535 Bacteria 1617
538 Ga0495586_0165800 3300046535 Bacteria 1247
539 Ga0495587_0180403 3300046536 Unclassified 1197
540 Ga0495645_0478835 3300046543 Unclassified 781
541 Ga0495634_0068833 3300046642 Unclassified 2337
542 Ga0495634_0140311 3300046642 Bacteria 1535
543 Ga0495635_0446433 3300046663 Bacteria 855
544 Ga0495635_0832253 3300046663 Unclassified 594
545 Ga0495657_0609798 3300046675 Bacteria 631
546 Ga0495623_0233786 3300046679 Unclassified 1041
547 Ga0495647_0337927 3300046681 Bacteria 684
548 Ga0495658_0017353 3300046683 Bacteria 3717
549 Ga0495669_0333426 3300046684 Unclassified 733
550 Ga0495613_0471881 3300046689 Unclassified 848
551 Ga0495613_0495213 3300046689 Bacteria 823
552 Ga0495624_0215446 3300046690 Unclassified 1165
553 Ga0495624_0682544 3300046690 Bacteria 610
554 Ga0495600_0133344 3300046809 Unclassified 1614
555 Ga0495600_0143702 3300046809 Unclassified 1547
556 Ga0495600_0254622 3300046809 Bacteria 1116
557 Ga0495600_0562521 3300046809 Unclassified 696
558 Ga0495604_0029663 3300047317 Bacteria 4352
559 Ga0495604_0045978 3300047317 Bacteria 3405
560 Ga0495604_0100718 3300047317 Bacteria 2123
561 Ga0495636_0120507 3300047318 Bacteria 1160
562 Ga0495674_0028111 3300047319 Bacteria 5133
563 Ga0495674_0063678 3300047319 Unclassified 3207
564 Ga0495674_0068158 3300047319 Bacteria 3080
565 Ga0495674_0082963 3300047319 Bacteria 2748
566 Ga0495674_0157185 3300047319 Bacteria 1904
567 Ga0495674_0221198 3300047319 Bacteria 1565
568 Ga0495674_0372121 3300047319 Bacteria 1157
569 Ga0495674_0418511 3300047319 Unclassified 1080
570 Ga0495684_0011665 3300047471 Bacteria 6785
571 Ga0495684_0109861 3300047471 Bacteria 2082
572 Ga0495684_0696706 3300047471 Bacteria 674
573 Ga0495684_0703582 3300047471 Unclassified 670
574 Ga0495684_0778723 3300047471 Unclassified 627
575 Ga0495593_0663101 3300047673 Archaea 524
576 Ga0495602_0011901 3300048088 Bacteria 8975
577 Ga0495602_0595212 3300048088 Unclassified 761
578 Ga0495602_0604132 3300048088 Bacteria 754
579 Ga0495602_0978036 3300048088 Unclassified 559
580 Ga0496100_0592025 3300048903 Unclassified 861
581 Ga0496103_0929602 3300048906 Unclassified 544
582 Ga0496104_0956305 3300048907 Unclassified 761
583 Ga0496105_0655355 3300048908 Bacteria 810
584 Ga0496105_1324136 3300048908 Unclassified 525
585 Ga0496108_1578653 3300048911 Bacteria 544
586 Ga0496112_0616091 3300048915 Bacteria 1017
587 Ga0496112_0672781 3300048915 Bacteria 964
588 Ga0496114_0489323 3300048917 Unclassified 1088
589 Ga0496115_0236935 3300048918 Bacteria 1504
590 Ga0496118_0448593 3300048921 Bacteria 656
591 Ga0496126_0000063 3300048929 Bacteria 256841
592 Ga0496126_0084731 3300048929 Bacteria 2795
593 Ga0501299_091476 3300049522 Unclassified 692
594 Ga0501040_1037321 3300049576 Unclassified 595
595 Ga0501071_1236975 3300049587 Unclassified 577
596 Ga0501073_0426836 3300049589 Bacteria 916
597 Ga0501076_0191995 3300049592 Bacteria 1667
598 Ga0501224_062751 3300049664 Unclassified 581
599 Ga0501227_092435 3300049665 Unclassified 799
600 Ga0501079_0394309 3300049741 Bacteria 1086
601 Ga0501080_1081582 3300049742 Bacteria 693
602 Ga0501045_0896072 3300049824 Bacteria 652
603 nmdc:mga00v17_608643_c1 3300050491 Unclassified 704
604 nmdc:mga05p37_1929409_c1 3300050507 Bacteria 562
605 nmdc:mga05p37_56119_c1 3300050507 Bacteria 4849
606 nmdc:mga05p37_572168_c1 3300050507 Unclassified 1281
607 nmdc:mga05p37_934246_c1 3300050507 Unclassified 931
608 nmdc:mga09592_332156_c1 3300050508 Unclassified 1316
609 nmdc:mga09592_360282_c1 3300050508 Unclassified 1258
610 nmdc:mga09592_606881_c1 3300050508 Bacteria 937
611 nmdc:mga09592_65859_c1 3300050508 Unclassified 3070
612 nmdc:mga09592_86136_c1 3300050508 Bacteria 2680
613 nmdc:mga0qj67_21857_c1 3300050509 Unclassified 4908
614 nmdc:mga0qj67_598059_c1 3300050509 Bacteria 882
615 nmdc:mga06r32_119570_c1 3300050510 Bacteria 2598
616 nmdc:mga06r32_1215631_c1 3300050510 Unclassified 699
617 nmdc:mga06r32_232402_c1 3300050510 Unclassified 1832
618 nmdc:mga06r32_385991_c1 3300050510 Bacteria 1383
619 nmdc:mga06r32_83004_c1 3300050510 Unclassified 3122
620 nmdc:mga08y16_101433_c1 3300050511 Bacteria 2996
621 nmdc:mga08y16_276537_c1 3300050511 Unclassified 1733
622 nmdc:mga08y16_34708_c1 3300050511 Bacteria 5300
623 nmdc:mga0n895_751197_c1 3300050512 Bacteria 968
624 nmdc:mga0n895_75885_c1 3300050512 Bacteria 3342
625 nmdc:mga08x19_368195_c1 3300050514 Bacteria 1005
626 Ga0495601_0118492 3300053077 Bacteria 1718
627 Ga0495619_0007563 3300053085 Bacteria 6879
628 Ga0501084_0511848 3300054114 Bacteria 1015
629 Ga0500661_001093 3300055283 Bacteria 5103
630 Ga0590071_001337 3300059421 Bacteria 6546
631 Ga0590074_010660 3300059423 Bacteria 1536
632 Ga0590075_005646 3300059424 Unclassified 2957
633 Ga0590077_000501 3300059426 Bacteria 10906
634 Ga0068865_101870036
635 rootH2_10194854
636 Ga0070676_10804560
637 Ga0070683_100001260
638 Ga0070690_100099871
639 Ga0070690_100721155
640 Ga0070690_101265196
641 Ga0070670_100345696
642 Ga0070670_100493599
643 Ga0070670_100909363
644 Ga0068869_100250128
645 Ga0070666_10736180
646 Ga0070666_10891739
647 Ga0070666_11442698
648 Ga0070680_100357628
649 Ga0070680_100713151
650 Ga0070660_100164717
651 Ga0070689_100196894
652 Ga0070689_100230009
653 Ga0070689_100737714
654 Ga0070691_10000025
655 Ga0070661_100204987
656 Ga0070669_100306214
657 Ga0070669_100462588
658 Ga0070675_100003547
659 Ga0070675_100893777
660 Ga0070675_101369921
661 Ga0070674_101063211
662 Ga0070673_100182186
663 Ga0070673_101288015
664 Ga0070688_100239795
665 Ga0070688_100554313
666 Ga0070659_101999775
667 Ga0070709_10349076
668 Ga0070709_10919892
669 Ga0070714_100050492
670 Ga0070714_100610864
671 Ga0070714_101066045
672 Ga0070714_101364337
673 Ga0070713_100022699
674 Ga0070713_100042226
675 Ga0070713_100053730
676 Ga0070713_100269134
677 Ga0070713_100393859
678 Ga0070711_100089601
679 Ga0070711_100127778
680 Ga0070711_100213962
681 Ga0070711_100255677
682 Ga0070711_101530522
683 Ga0070705_100277991
684 Ga0070700_100310313
685 Ga0070694_100152174
686 Ga0070694_100162860
687 Ga0070694_100946674
688 Ga0070694_101124586
689 Ga0070694_101365479
690 Ga0070708_100007058
691 Ga0070708_100222976
692 Ga0070708_100933682
693 Ga0070663_100699819
694 Ga0070663_101921115
695 Ga0070681_10017510
696 Ga0070681_10053985
697 Ga0070681_10056692
698 Ga0070681_10248656
699 Ga0068867_100630580
700 Ga0070685_10331778
701 Ga0070685_10561674
702 Ga0070706_100018931
703 Ga0070706_100651397
704 Ga0070706_101300254
705 Ga0070707_100190668
706 Ga0070707_100403596
707 Ga0070707_101505804
708 Ga0070698_100040425
709 Ga0070698_101213402
710 Ga0070699_100238580
711 Ga0070699_100503024
712 Ga0070699_100907987
713 Ga0070699_102192889
714 Ga0070679_100112556
715 Ga0070679_100126019
716 Ga0070679_100287336
717 Ga0070679_100352577
718 Ga0070684_100000569
719 Ga0070684_100034261
720 Ga0070684_100187288
721 Ga0070684_100605058
722 Ga0070697_100007205
723 Ga0070697_100067722
724 Ga0070697_102092720
725 Ga0068853_100051174
726 Ga0068853_100950661
727 Ga0070672_100883180
728 Ga0070672_100894895
729 Ga0070695_100020986
730 Ga0070695_100197330
731 Ga0070696_100001913
732 Ga0070696_100520330
733 Ga0070696_100961231
734 Ga0070693_100005864
735 Ga0070665_100772731
736 Ga0070665_101798652
737 Ga0070704_100003082
738 Ga0070704_100209708
739 Ga0070704_100961409
740 Ga0068855_100007973
741 Ga0068855_100288423
742 Ga0068855_100610681
743 Ga0068855_101525512
744 Ga0068855_101846268
745 Ga0068857_100000789
746 Ga0068857_100003905
747 Ga0068857_100460541
748 Ga0068857_100897540
749 Ga0068854_101099976
750 Ga0068856_100220358
751 Ga0068856_100323456
752 Ga0068852_100003718
753 Ga0068852_100603913
754 Ga0068852_101347040
755 Ga0068852_102155899
756 Ga0068859_100009499
757 Ga0068859_100194201
758 Ga0068859_100672172
759 Ga0068864_100312780
760 Ga0068864_100780511
761 Ga0068866_11057376
762 Ga0068861_101159079
763 Ga0068851_10013902
764 Ga0068870_10018219
765 Ga0068870_10055592
766 Ga0068863_101328052
767 Ga0068863_102135540
768 Ga0068863_102396326
769 Ga0068858_100636002
770 Ga0068858_101300574
771 Ga0068860_100033059
772 Ga0068860_100129690
773 Ga0068860_101060468
774 Ga0068860_101549029
775 Ga0068860_102265354
776 Ga0068862_100089758
777 Ga0068862_100994727
778 Ga0070717_10070005
779 Ga0070717_10261672
780 Ga0070717_10644872
781 Ga0070717_11058031
782 Ga0070717_11447466
783 Ga0075432_10362058
784 Ga0070716_100184389
785 Ga0070712_100004714
786 Ga0070712_100005089
787 Ga0070712_100110180
788 Ga0075367_10390649
789 Ga0097621_101451667
790 Ga0068871_100050175
791 Ga0068871_100317028
792 Ga0068871_102054595
793 Ga0075428_100050137
794 Ga0075428_100092439
795 Ga0075428_100460354
796 Ga0075430_100022574
797 Ga0075430_100023589
798 Ga0075430_100353848
799 Ga0075430_101617579
800 Ga0075431_100013268
801 Ga0075431_100068753
802 Ga0075431_100218568
803 Ga0075431_100300893
804 Ga0075434_100070284
805 Ga0075434_100528259
806 Ga0075434_100787848
807 Ga0075429_100043178
808 Ga0075429_100348636
809 Ga0075429_100762343
810 Ga0068865_100207038
811 Ga0068865_101563967
812 Ga0075436_100096773
813 Ga0075436_100716284
814 Ga0097620_100009498
815 Ga0097620_100194200
816 Ga0097620_100672142
817 Ga0097620_103085024
818 Ga0075435_100567650
819 Ga0075435_100608032
820 Ga0099794_10343105
821 Ga0105240_10002088
822 Ga0105240_10053001
823 Ga0105240_10071936
824 Ga0105240_10076145
825 Ga0105240_10411563
826 Ga0105240_10449933
827 Ga0105240_10526071
828 Ga0105240_11230027
829 Ga0111539_10006899
830 Ga0111539_10123500
831 Ga0105245_10009716
832 Ga0105245_10396319
833 Ga0105245_10829049
834 Ga0105245_11098783
835 Ga0105245_12762141
836 Ga0114129_10068086
837 Ga0114129_10149271
838 Ga0114129_10257092
839 Ga0114129_10593857
840 Ga0114129_10638722
841 Ga0114129_11190610
842 Ga0105243_10217118
843 Ga0105243_12410007
844 Ga0105241_10029048
845 Ga0105241_10060179
846 Ga0105241_11020972
847 Ga0105241_11364689
848 Ga0105242_10011977
849 Ga0105242_10344449
850 Ga0105242_10805309
851 Ga0105242_12278854
852 Ga0105248_10106284
853 Ga0105248_10149760
854 Ga0105248_10309363
855 Ga0105248_10625218
856 Ga0105248_12703570
857 Ga0105237_10012917
858 Ga0105237_10015531
859 Ga0105237_10024504
860 Ga0105237_10780600
861 Ga0105237_10785625
862 Ga0105237_11417974
863 Ga0105237_11617205
864 Ga0105237_11901980
865 Ga0105238_10025924
866 Ga0105238_10063743
867 Ga0105238_10860593
868 Ga0105238_11028068
869 Ga0105249_10052984
870 Ga0105249_10083925
871 Ga0105249_10202712
872 Ga0105249_10627930
873 Ga0099796_10413276
874 Ga0105239_10000502
875 Ga0105239_10177867
876 Ga0105239_10183307
877 Ga0105239_10336075
878 Ga0105239_10548332
879 Ga0105239_10677787
880 Ga0105239_11094877
881 Ga0105246_10003731
882 Ga0105246_10255962
883 Ga0105246_10826395
884 Ga0105246_10983209
885 Ga0105246_11148564
886 Ga0157313_1040352
887 Ga0157373_10216961
888 Ga0157373_10248202
889 Ga0157371_10336482
890 Ga0157370_10019384
891 Ga0157370_10097759
892 Ga0157370_10162460
893 Ga0157370_10320792
894 Ga0157370_10454868
895 Ga0157369_10002403
896 Ga0157369_10009602
897 Ga0157369_10028745
898 Ga0157369_10103281
899 Ga0157369_10261716
900 Ga0157369_10583662
901 Ga0157369_10600390
902 Ga0157374_10006661
903 Ga0157374_10528474
904 Ga0157374_10698198
905 Ga0157374_12245861
906 Ga0157378_10306266
907 Ga0163162_10085836
908 Ga0163162_10540450
909 Ga0163162_10872647
910 Ga0163162_11286883
911 Ga0163162_11763355
912 Ga0163162_13039561
913 Ga0157372_10031550
914 Ga0157372_10165279
915 Ga0157372_10172509
916 Ga0157372_11012561
917 Ga0157372_12035172
918 Ga0157372_12488056
919 Ga0157375_10010846
920 Ga0157375_10161667
921 Ga0157375_12584003
922 Ga0157375_12790456
923 Ga0163163_10008287
924 Ga0163163_10059635
925 Ga0163163_10071061
926 Ga0163163_10310696
927 Ga0157379_10254358
928 Ga0157379_10590022
929 Ga0157379_11340366
930 Ga0157379_12558199
931 Ga0157376_10521280
932 Ga0157376_10638678
933 Ga0157376_11432494
934 Ga0157376_11476840
935 Ga0157376_11514614
936 Ga0213876_10051555
937 Ga0213875_10051130
938 Ga0213875_10051175
939 Ga0213875_10073377
940 Ga0213875_10472007
941 Ga0228598_1000296
942 Ga0207656_10099644
943 Ga0207692_10451851
944 Ga0207680_10230202
945 Ga0207647_10546027
946 Ga0207699_10138121
947 Ga0207699_10373400
948 Ga0207643_10067494
949 Ga0207684_10006099
950 Ga0207684_10521446
951 Ga0207684_11402003
952 Ga0207654_10080785
953 Ga0207654_10089811
954 Ga0207654_10690389
955 Ga0207707_10375693
956 Ga0207707_10882208
957 Ga0207695_10000808
958 Ga0207695_10017373
959 Ga0207695_10039201
960 Ga0207695_10154449
961 Ga0207695_10178334
962 Ga0207695_10461767
963 Ga0207695_11200021
964 Ga0207671_10009726
965 Ga0207671_10010284
966 Ga0207671_10276673
967 Ga0207671_10902323
968 Ga0207693_10004156
969 Ga0207693_10136899
970 Ga0207693_10221622
971 Ga0207663_10007962
972 Ga0207663_10045214
973 Ga0207663_10576802
974 Ga0207660_10155932
975 Ga0207657_10034778
976 Ga0207652_10069032
977 Ga0207652_10155727
978 Ga0207652_10309759
979 Ga0207652_10985406
980 Ga0207646_10296975
981 Ga0207646_11064309
982 Ga0207646_11178856
983 Ga0207681_10438126
984 Ga0207694_10001446
985 Ga0207694_10276508
986 Ga0207650_10421643
987 Ga0207650_11114050
988 Ga0207659_10004960
989 Ga0207659_10603527
990 Ga0207659_10609819
991 Ga0207687_10123712
992 Ga0207687_10181462
993 Ga0207687_10447192
994 Ga0207687_11560144
995 Ga0207700_10041597
996 Ga0207700_10203759
997 Ga0207700_10210511
998 Ga0207700_10249289
999 Ga0207700_10734596
1000 Ga0207664_10186766
1001 Ga0207664_10331834
1002 Ga0207644_11497867
1003 Ga0207686_10002661
1004 Ga0207686_10052428
1005 Ga0207709_10226018
1006 Ga0207670_10162345
1007 Ga0207670_10510368
1008 Ga0207669_11382002
1009 Ga0207704_10057836
1010 Ga0207704_11425157
1011 Ga0207704_11473604
1012 Ga0207665_10165830
1013 Ga0207711_10198084
1014 Ga0207711_11575853
1015 Ga0207689_10099309
1016 Ga0207689_10203075
1017 Ga0207689_10429451
1018 Ga0207661_10041781
1019 Ga0207661_10119871
1020 Ga0207661_10185363
1021 Ga0207661_10662633
1022 Ga0207679_10751274
1023 Ga0207679_10753832
1024 Ga0207679_11223563
1025 Ga0207679_11627033
1026 Ga0207667_10000673
1027 Ga0207667_12022315
1028 Ga0207651_10120753
1029 Ga0207712_10514236
1030 Ga0207668_10525963
1031 Ga0207668_10940563
1032 Ga0207640_11726500
1033 Ga0207658_10033734
1034 Ga0207703_10139173
1035 Ga0207703_10142936
1036 Ga0207703_10941842
1037 Ga0207639_10818330
1038 Ga0207639_10880073
1039 Ga0207708_10654808
1040 Ga0207702_10037853
1041 Ga0207702_10072707
1042 Ga0207702_10175059
1043 Ga0207702_11290466
1044 Ga0207641_11228405
1045 Ga0207641_11995879
1046 Ga0207648_10023321
1047 Ga0207648_11985976
1048 Ga0207676_11012216
1049 Ga0207674_10000109
1050 Ga0207674_10006906
1051 Ga0207674_10229513
1052 Ga0207674_10581577
1053 Ga0207675_100936917
1054 Ga0207698_10178285
1055 Ga0207698_10457956
1056 Ga0207698_12476609
1057 Ga0207428_10019404
1058 Ga0207428_10100717
1059 Ga0207428_10485193
1060 Ga0268266_10108439
1061 Ga0268266_10234383
1062 Ga0268266_11242651
1063 Ga0268264_10156277
1064 Ga0265323_10002130
1065 Ga0265338_10089049
1066 Ga0265338_11161066
1067 Ga0265762_1011299
1068 Ga0265762_1052667
1069 Ga0265760_10140068
1070 Ga0265325_10343765
1071 Ga0265325_10368252
1072 Ga0265340_10037801
1073 Ga0265340_10147505
1074 Ga0265331_10069103
1075 Ga0265331_10136048
1076 Ga0265331_10163949
1077 Ga0265316_10039847
1078 Ga0265316_10452069
1079 Ga0265314_10003017
1080 Ga0265314_10021585
1081 Ga0265314_10348166
1082 Ga0265342_10045347
1083 Ga0265342_10063999
1084 Ga0307405_10340668
1085 Ga0307405_10502669
1086 Ga0307413_10318870
1087 Ga0307410_10669176
1088 Ga0307407_10234579
1089 Ga0307412_10220381
1090 Ga0307412_10345347
1091 Ga0307416_101155000
1092 Ga0307414_11583594
1093 Ga0307411_10546843
1094 Ga0307510_10024079
1095 Ga0307510_10055224
1096 Ga0373954_0101165
1097 Ga0373955_0797109
1098 Ga0373924_0548194
1099 Ga0373935_0329198
1100 Ga0373935_1179977
1101 Ga0373927_0113843
1102 Ga0373927_0991560
1103 Ga0373933_1165735
1104 Ga0373937_0656377
1105 Ga0373925_0293305
1106 Ga0373925_0314770
1107 Ga0373925_0403767
1108 Ga0373925_1542379
1109 Ga0395900_0273630
1110 Ga0395900_0781316
1111 Ga0395898_0067057
1112 Ga0436364_0025059
1113 Ga0436364_0067778
1114 Ga0436364_0141740
1115 Ga0436364_0195132
1116 Ga0436364_0268926
1117 Ga0436364_0877711
1118 Ga0436364_0909864
1119 Ga0436364_0923833
1120 Ga0436364_0980994
1121 Ga0436364_1038348
1122 Ga0436364_1150490
1123 Ga0436364_1191071
1124 Ga0436364_1227489
1125 Ga0436364_1314471
1126 Ga0436364_1358164
1127 Ga0436364_1416338
1128 Ga0436365_0088699
1129 Ga0436365_0277722
1130 Ga0436365_0612070
1131 Ga0436365_1179091
1132 Ga0436365_1198862
1133 Ga0436360_0118015
1134 Ga0436361_0271610
1135 Ga0436363_0535897
1136 Ga0436362_0006487
1137 Ga0436362_1179268
1138 Ga0451800_1549858
1139 Ga0439441_042378
1140 Ga0466966_0336720
1141 Ga0453684_0162723
1142 Ga0466959_0479060
1143 Ga0466959_0785445
1144 Ga0451576_0594878
1145 Ga0451576_2296105
1146 Ga0451576_2447823
1147 Ga0466958_0760330
1148 Ga0495592_0637466
1149 Ga0495592_0721596
1150 Ga0495592_0795905
1151 Ga0495651_0102645
1152 Ga0495653_0016554
1153 Ga0495580_0000042
1154 Ga0495580_0000643
1155 Ga0495580_0076953
1156 Ga0495580_0176034
1157 Ga0495582_0009201
1158 Ga0495662_0365916
1159 Ga0495664_0227041
1160 Ga0495664_0321887
1161 Ga0495594_0041666
1162 Ga0495608_0239565
1163 Ga0495608_0532870
1164 Ga0495608_0593243
1165 Ga0495618_0220726
1166 Ga0495628_0832866
1167 Ga0495652_0149175
1168 Ga0495665_0049616
1169 Ga0495640_0254639
1170 Ga0495586_0099030
1171 Ga0495586_0165800
1172 Ga0495587_0180403
1173 Ga0495645_0478835
1174 Ga0495634_0068833
1175 Ga0495634_0140311
1176 Ga0495635_0446433
1177 Ga0495635_0832253
1178 Ga0495657_0609798
1179 Ga0495623_0233786
1180 Ga0495647_0337927
1181 Ga0495658_0017353
1182 Ga0495669_0333426
1183 Ga0495613_0471881
1184 Ga0495613_0495213
1185 Ga0495624_0215446
1186 Ga0495624_0682544
1187 Ga0495600_0133344
1188 Ga0495600_0143702
1189 Ga0495600_0254622
1190 Ga0495600_0562521
1191 Ga0495604_0029663
1192 Ga0495604_0045978
1193 Ga0495604_0100718
1194 Ga0495636_0120507
1195 Ga0495674_0028111
1196 Ga0495674_0063678
1197 Ga0495674_0068158
1198 Ga0495674_0082963
1199 Ga0495674_0157185
1200 Ga0495674_0221198
1201 Ga0495674_0372121
1202 Ga0495674_0418511
1203 Ga0495684_0011665
1204 Ga0495684_0109861
1205 Ga0495684_0696706
1206 Ga0495684_0703582
1207 Ga0495684_0778723
1208 Ga0495593_0663101
1209 Ga0495602_0011901
1210 Ga0495602_0595212
1211 Ga0495602_0604132
1212 Ga0495602_0978036
1213 Ga0496100_0592025
1214 Ga0496103_0929602
1215 Ga0496104_0956305
1216 Ga0496105_0655355
1217 Ga0496105_1324136
1218 Ga0496108_1578653
1219 Ga0496112_0616091
1220 Ga0496112_0672781
1221 Ga0496114_0489323
1222 Ga0496115_0236935
1223 Ga0496118_0448593
1224 Ga0496126_0000063
1225 Ga0496126_0084731
1226 Ga0501299_091476
1227 Ga0501040_1037321
1228 Ga0501071_1236975
1229 Ga0501073_0426836
1230 Ga0501076_0191995
1231 Ga0501224_062751
1232 Ga0501227_092435
1233 Ga0501079_0394309
1234 Ga0501080_1081582
1235 Ga0501045_0896072
1236 nmdc:mga00v17_608643_c1
1237 nmdc:mga05p37_1929409_c1
1238 nmdc:mga05p37_56119_c1
1239 nmdc:mga05p37_572168_c1
1240 nmdc:mga05p37_934246_c1
1241 nmdc:mga09592_332156_c1
1242 nmdc:mga09592_360282_c1
1243 nmdc:mga09592_606881_c1
1244 nmdc:mga09592_65859_c1
1245 nmdc:mga09592_86136_c1
1246 nmdc:mga0qj67_21857_c1
1247 nmdc:mga0qj67_598059_c1
1248 nmdc:mga06r32_119570_c1
1249 nmdc:mga06r32_1215631_c1
1250 nmdc:mga06r32_232402_c1
1251 nmdc:mga06r32_385991_c1
1252 nmdc:mga06r32_83004_c1
1253 nmdc:mga08y16_101433_c1
1254 nmdc:mga08y16_276537_c1
1255 nmdc:mga08y16_34708_c1
1256 nmdc:mga0n895_751197_c1
1257 nmdc:mga0n895_75885_c1
1258 nmdc:mga08x19_368195_c1
1259 Ga0495601_0118492
1260 Ga0495619_0007563
1261 Ga0501084_0511848
1262 Ga0500661_001093
1263 Ga0590071_001337
1264 Ga0590074_010660
1265 Ga0590075_005646
1266 Ga0590077_000501

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

41

117

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9033 9 109
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.8988 8 111
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.8944 10 109
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.8888 13 118
5zqh-assembly1.cif.gz_A-2 crystal structure of streptococcus transcriptional regulator 0.8883 11 111
ID Description Score Start End Superfamily
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8986 16 93 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8946 20 87 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8944 10 109 1.10.10.10
5zqhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8883 11 111 1.10.10.10
5y8tC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8866 16 93 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V9ZD40-F1-model_v4 PadR family transcriptional regulator 0.971 1 90
AF-A0A2V8MJK6-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.9682 5 95
AF-A0A0D0SHF8-F1-model_v4 Transcriptional regulator, PadR family 0.9627 11 111
AF-A0A1Y4NFL1-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.9595 8 111
AF-A0A2V9FL99-F1-model_v4 PadR family transcriptional regulator 0.9592 8 100

Map