F471067
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 633 | 271 | 1266 | 118 |
Family's Representative Sequence
| Representative Sequence | 3300006881|Ga0068865_101870036|Ga0068865_1018700362 |
| Length | 139 |
| Sequence | MSSVARLPKQERNPGRMSASPMPKEPSDRIELLQGTLDMLILRTLLFGAAHGHQIAKHIQRTTDDLLQVEHGSLYPALHRLERRGWIVAKWEAAAKDLKREFKYYRLTPAGKKQLLAEESKWKQMTGAIARIMWPAEES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 105 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 106 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 107 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 162 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 166 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 167 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 168 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 169 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 173 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 174 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 175 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 180 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 181 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 183 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 185 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 186 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 190 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 191 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 192 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 193 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 194 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 195 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 196 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 197 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 198 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 199 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 200 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 201 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 202 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 203 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 238 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 239 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 240 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 242 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 243 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 244 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 245 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 246 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 247 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 252 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 253 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 257 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 268 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 269 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 270 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 271 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.53 |
| Metatranscriptomes | 0.47 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.47 |
| Nodule | 0 |
| Rhizoplane | 1.74 |
| Rhizosphere | 92.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 37.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068865_101870036 | 3300006881 | Unclassified | 543 |
| 2 | rootH2_10194854 | 3300003320 | Bacteria | 1867 |
| 3 | Ga0070676_10804560 | 3300005328 | Unclassified | 694 |
| 4 | Ga0070683_100001260 | 3300005329 | Bacteria | 19270 |
| 5 | Ga0070690_100099871 | 3300005330 | Bacteria | 1923 |
| 6 | Ga0070690_100721155 | 3300005330 | Unclassified | 767 |
| 7 | Ga0070690_101265196 | 3300005330 | Bacteria | 590 |
| 8 | Ga0070670_100345696 | 3300005331 | Unclassified | 1306 |
| 9 | Ga0070670_100493599 | 3300005331 | Unclassified | 1088 |
| 10 | Ga0070670_100909363 | 3300005331 | Unclassified | 798 |
| 11 | Ga0068869_100250128 | 3300005334 | Bacteria | 1415 |
| 12 | Ga0070666_10736180 | 3300005335 | Unclassified | 724 |
| 13 | Ga0070666_10891739 | 3300005335 | Unclassified | 657 |
| 14 | Ga0070666_11442698 | 3300005335 | Unclassified | 514 |
| 15 | Ga0070680_100357628 | 3300005336 | Unclassified | 1242 |
| 16 | Ga0070680_100713151 | 3300005336 | Unclassified | 863 |
| 17 | Ga0070660_100164717 | 3300005339 | Bacteria | 1788 |
| 18 | Ga0070689_100196894 | 3300005340 | Bacteria | 1643 |
| 19 | Ga0070689_100230009 | 3300005340 | Unclassified | 1524 |
| 20 | Ga0070689_100737714 | 3300005340 | Unclassified | 862 |
| 21 | Ga0070691_10000025 | 3300005341 | Bacteria | 41015 |
| 22 | Ga0070661_100204987 | 3300005344 | Bacteria | 1508 |
| 23 | Ga0070669_100306214 | 3300005353 | Bacteria | 1279 |
| 24 | Ga0070669_100462588 | 3300005353 | Bacteria | 1047 |
| 25 | Ga0070675_100003547 | 3300005354 | Bacteria | 11842 |
| 26 | Ga0070675_100893777 | 3300005354 | Bacteria | 814 |
| 27 | Ga0070675_101369921 | 3300005354 | Unclassified | 652 |
| 28 | Ga0070674_101063211 | 3300005356 | Unclassified | 713 |
| 29 | Ga0070673_100182186 | 3300005364 | Bacteria | 1799 |
| 30 | Ga0070673_101288015 | 3300005364 | Bacteria | 686 |
| 31 | Ga0070688_100239795 | 3300005365 | Bacteria | 1286 |
| 32 | Ga0070688_100554313 | 3300005365 | Unclassified | 874 |
| 33 | Ga0070659_101999775 | 3300005366 | Unclassified | 520 |
| 34 | Ga0070709_10349076 | 3300005434 | Bacteria | 1093 |
| 35 | Ga0070709_10919892 | 3300005434 | Unclassified | 692 |
| 36 | Ga0070714_100050492 | 3300005435 | Bacteria | 3544 |
| 37 | Ga0070714_100610864 | 3300005435 | Unclassified | 1048 |
| 38 | Ga0070714_101066045 | 3300005435 | Bacteria | 787 |
| 39 | Ga0070714_101364337 | 3300005435 | Unclassified | 692 |
| 40 | Ga0070713_100022699 | 3300005436 | Bacteria | 4853 |
| 41 | Ga0070713_100042226 | 3300005436 | Unclassified | 3721 |
| 42 | Ga0070713_100053730 | 3300005436 | Unclassified | 3339 |
| 43 | Ga0070713_100269134 | 3300005436 | Bacteria | 1560 |
| 44 | Ga0070713_100393859 | 3300005436 | Bacteria | 1292 |
| 45 | Ga0070711_100089601 | 3300005439 | Bacteria | 2213 |
| 46 | Ga0070711_100127778 | 3300005439 | Bacteria | 1889 |
| 47 | Ga0070711_100213962 | 3300005439 | Bacteria | 1494 |
| 48 | Ga0070711_100255677 | 3300005439 | Bacteria | 1376 |
| 49 | Ga0070711_101530522 | 3300005439 | Bacteria | 582 |
| 50 | Ga0070705_100277991 | 3300005440 | Unclassified | 1189 |
| 51 | Ga0070700_100310313 | 3300005441 | Unclassified | 1155 |
| 52 | Ga0070694_100152174 | 3300005444 | Bacteria | 1690 |
| 53 | Ga0070694_100162860 | 3300005444 | Unclassified | 1638 |
| 54 | Ga0070694_100946674 | 3300005444 | Bacteria | 713 |
| 55 | Ga0070694_101124586 | 3300005444 | Bacteria | 656 |
| 56 | Ga0070694_101365479 | 3300005444 | Unclassified | 597 |
| 57 | Ga0070708_100007058 | 3300005445 | Bacteria | 8963 |
| 58 | Ga0070708_100222976 | 3300005445 | Bacteria | 1768 |
| 59 | Ga0070708_100933682 | 3300005445 | Bacteria | 814 |
| 60 | Ga0070663_100699819 | 3300005455 | Unclassified | 861 |
| 61 | Ga0070663_101921115 | 3300005455 | Unclassified | 532 |
| 62 | Ga0070681_10017510 | 3300005458 | Bacteria | 7161 |
| 63 | Ga0070681_10053985 | 3300005458 | Unclassified | 4004 |
| 64 | Ga0070681_10056692 | 3300005458 | Bacteria | 3899 |
| 65 | Ga0070681_10248656 | 3300005458 | Bacteria | 1691 |
| 66 | Ga0068867_100630580 | 3300005459 | Unclassified | 938 |
| 67 | Ga0070685_10331778 | 3300005466 | Unclassified | 1034 |
| 68 | Ga0070685_10561674 | 3300005466 | Unclassified | 816 |
| 69 | Ga0070706_100018931 | 3300005467 | Bacteria | 6351 |
| 70 | Ga0070706_100651397 | 3300005467 | Bacteria | 978 |
| 71 | Ga0070706_101300254 | 3300005467 | Bacteria | 667 |
| 72 | Ga0070707_100190668 | 3300005468 | Unclassified | 1999 |
| 73 | Ga0070707_100403596 | 3300005468 | Bacteria | 1327 |
| 74 | Ga0070707_101505804 | 3300005468 | Bacteria | 640 |
| 75 | Ga0070698_100040425 | 3300005471 | Bacteria | 4792 |
| 76 | Ga0070698_101213402 | 3300005471 | Unclassified | 704 |
| 77 | Ga0070699_100238580 | 3300005518 | Bacteria | 1622 |
| 78 | Ga0070699_100503024 | 3300005518 | Bacteria | 1101 |
| 79 | Ga0070699_100907987 | 3300005518 | Unclassified | 807 |
| 80 | Ga0070699_102192889 | 3300005518 | Unclassified | 504 |
| 81 | Ga0070679_100112556 | 3300005530 | Bacteria | 2707 |
| 82 | Ga0070679_100126019 | 3300005530 | Unclassified | 2543 |
| 83 | Ga0070679_100287336 | 3300005530 | Bacteria | 1596 |
| 84 | Ga0070679_100352577 | 3300005530 | Bacteria | 1419 |
| 85 | Ga0070684_100000569 | 3300005535 | Bacteria | 25491 |
| 86 | Ga0070684_100034261 | 3300005535 | Bacteria | 4341 |
| 87 | Ga0070684_100187288 | 3300005535 | Unclassified | 1882 |
| 88 | Ga0070684_100605058 | 3300005535 | Bacteria | 1019 |
| 89 | Ga0070697_100007205 | 3300005536 | Bacteria | 8648 |
| 90 | Ga0070697_100067722 | 3300005536 | Bacteria | 2921 |
| 91 | Ga0070697_102092720 | 3300005536 | Unclassified | 507 |
| 92 | Ga0068853_100051174 | 3300005539 | Bacteria | 3555 |
| 93 | Ga0068853_100950661 | 3300005539 | Unclassified | 826 |
| 94 | Ga0070672_100883180 | 3300005543 | Unclassified | 789 |
| 95 | Ga0070672_100894895 | 3300005543 | Bacteria | 784 |
| 96 | Ga0070695_100020986 | 3300005545 | Bacteria | 3993 |
| 97 | Ga0070695_100197330 | 3300005545 | Unclassified | 1436 |
| 98 | Ga0070696_100001913 | 3300005546 | Bacteria | 13699 |
| 99 | Ga0070696_100520330 | 3300005546 | Unclassified | 949 |
| 100 | Ga0070696_100961231 | 3300005546 | Bacteria | 712 |
| 101 | Ga0070693_100005864 | 3300005547 | Bacteria | 5934 |
| 102 | Ga0070665_100772731 | 3300005548 | Bacteria | 974 |
| 103 | Ga0070665_101798652 | 3300005548 | Unclassified | 619 |
| 104 | Ga0070704_100003082 | 3300005549 | Bacteria | 9487 |
| 105 | Ga0070704_100209708 | 3300005549 | Unclassified | 1578 |
| 106 | Ga0070704_100961409 | 3300005549 | Unclassified | 771 |
| 107 | Ga0068855_100007973 | 3300005563 | Bacteria | 12794 |
| 108 | Ga0068855_100288423 | 3300005563 | Bacteria | 1820 |
| 109 | Ga0068855_100610681 | 3300005563 | Bacteria | 1175 |
| 110 | Ga0068855_101525512 | 3300005563 | Bacteria | 685 |
| 111 | Ga0068855_101846268 | 3300005563 | Unclassified | 613 |
| 112 | Ga0068857_100000789 | 3300005577 | Bacteria | 23683 |
| 113 | Ga0068857_100003905 | 3300005577 | Bacteria | 12548 |
| 114 | Ga0068857_100460541 | 3300005577 | Unclassified | 1190 |
| 115 | Ga0068857_100897540 | 3300005577 | Unclassified | 850 |
| 116 | Ga0068854_101099976 | 3300005578 | Bacteria | 708 |
| 117 | Ga0068856_100220358 | 3300005614 | Bacteria | 1912 |
| 118 | Ga0068856_100323456 | 3300005614 | Bacteria | 1560 |
| 119 | Ga0068852_100003718 | 3300005616 | Bacteria | 10695 |
| 120 | Ga0068852_100603913 | 3300005616 | Unclassified | 1102 |
| 121 | Ga0068852_101347040 | 3300005616 | Unclassified | 736 |
| 122 | Ga0068852_102155899 | 3300005616 | Bacteria | 579 |
| 123 | Ga0068859_100009499 | 3300005617 | Bacteria | 9822 |
| 124 | Ga0068859_100194201 | 3300005617 | Bacteria | 2114 |
| 125 | Ga0068859_100672172 | 3300005617 | Bacteria | 1127 |
| 126 | Ga0068864_100312780 | 3300005618 | Bacteria | 1473 |
| 127 | Ga0068864_100780511 | 3300005618 | Unclassified | 938 |
| 128 | Ga0068866_11057376 | 3300005718 | Unclassified | 579 |
| 129 | Ga0068861_101159079 | 3300005719 | Unclassified | 745 |
| 130 | Ga0068851_10013902 | 3300005834 | Bacteria | 3814 |
| 131 | Ga0068870_10018219 | 3300005840 | Unclassified | 3387 |
| 132 | Ga0068870_10055592 | 3300005840 | Bacteria | 2109 |
| 133 | Ga0068863_101328052 | 3300005841 | Unclassified | 726 |
| 134 | Ga0068863_102135540 | 3300005841 | Bacteria | 570 |
| 135 | Ga0068863_102396326 | 3300005841 | Unclassified | 537 |
| 136 | Ga0068858_100636002 | 3300005842 | Bacteria | 1036 |
| 137 | Ga0068858_101300574 | 3300005842 | Unclassified | 716 |
| 138 | Ga0068860_100033059 | 3300005843 | Bacteria | 4966 |
| 139 | Ga0068860_100129690 | 3300005843 | Bacteria | 2419 |
| 140 | Ga0068860_101060468 | 3300005843 | Unclassified | 829 |
| 141 | Ga0068860_101549029 | 3300005843 | Unclassified | 685 |
| 142 | Ga0068860_102265354 | 3300005843 | Unclassified | 564 |
| 143 | Ga0068862_100089758 | 3300005844 | Bacteria | 2675 |
| 144 | Ga0068862_100994727 | 3300005844 | Viruses | 829 |
| 145 | Ga0070717_10070005 | 3300006028 | Bacteria | 2923 |
| 146 | Ga0070717_10261672 | 3300006028 | Unclassified | 1531 |
| 147 | Ga0070717_10644872 | 3300006028 | Unclassified | 961 |
| 148 | Ga0070717_11058031 | 3300006028 | Unclassified | 739 |
| 149 | Ga0070717_11447466 | 3300006028 | Bacteria | 624 |
| 150 | Ga0075432_10362058 | 3300006058 | Unclassified | 617 |
| 151 | Ga0070716_100184389 | 3300006173 | Bacteria | 1373 |
| 152 | Ga0070712_100004714 | 3300006175 | Bacteria | 8433 |
| 153 | Ga0070712_100005089 | 3300006175 | Bacteria | 8141 |
| 154 | Ga0070712_100110180 | 3300006175 | Bacteria | 2053 |
| 155 | Ga0075367_10390649 | 3300006178 | Bacteria | 880 |
| 156 | Ga0097621_101451667 | 3300006237 | Unclassified | 650 |
| 157 | Ga0068871_100050175 | 3300006358 | Bacteria | 3375 |
| 158 | Ga0068871_100317028 | 3300006358 | Bacteria | 1372 |
| 159 | Ga0068871_102054595 | 3300006358 | Unclassified | 544 |
| 160 | Ga0075428_100050137 | 3300006844 | Bacteria | 4579 |
| 161 | Ga0075428_100092439 | 3300006844 | Bacteria | 3298 |
| 162 | Ga0075428_100460354 | 3300006844 | Bacteria | 1362 |
| 163 | Ga0075430_100022574 | 3300006846 | Bacteria | 5355 |
| 164 | Ga0075430_100023589 | 3300006846 | Bacteria | 5239 |
| 165 | Ga0075430_100353848 | 3300006846 | Bacteria | 1213 |
| 166 | Ga0075430_101617579 | 3300006846 | Unclassified | 532 |
| 167 | Ga0075431_100013268 | 3300006847 | Bacteria | 8324 |
| 168 | Ga0075431_100068753 | 3300006847 | Bacteria | 3655 |
| 169 | Ga0075431_100218568 | 3300006847 | Unclassified | 1944 |
| 170 | Ga0075431_100300893 | 3300006847 | Unclassified | 1620 |
| 171 | Ga0075434_100070284 | 3300006871 | Bacteria | 3491 |
| 172 | Ga0075434_100528259 | 3300006871 | Bacteria | 1200 |
| 173 | Ga0075434_100787848 | 3300006871 | Bacteria | 967 |
| 174 | Ga0075429_100043178 | 3300006880 | Bacteria | 3922 |
| 175 | Ga0075429_100348636 | 3300006880 | Unclassified | 1296 |
| 176 | Ga0075429_100762343 | 3300006880 | Bacteria | 848 |
| 177 | Ga0068865_100207038 | 3300006881 | Unclassified | 1526 |
| 178 | Ga0068865_101563967 | 3300006881 | Bacteria | 592 |
| 179 | Ga0075436_100096773 | 3300006914 | Bacteria | 2053 |
| 180 | Ga0075436_100716284 | 3300006914 | Bacteria | 742 |
| 181 | Ga0097620_100009498 | 3300006931 | Bacteria | 9822 |
| 182 | Ga0097620_100194200 | 3300006931 | Bacteria | 2114 |
| 183 | Ga0097620_100672142 | 3300006931 | Bacteria | 1127 |
| 184 | Ga0097620_103085024 | 3300006931 | Bacteria | 508 |
| 185 | Ga0075435_100567650 | 3300007076 | Unclassified | 983 |
| 186 | Ga0075435_100608032 | 3300007076 | Bacteria | 948 |
| 187 | Ga0099794_10343105 | 3300007265 | Unclassified | 776 |
| 188 | Ga0105240_10002088 | 3300009093 | Bacteria | 32712 |
| 189 | Ga0105240_10053001 | 3300009093 | Bacteria | 5096 |
| 190 | Ga0105240_10071936 | 3300009093 | Bacteria | 4275 |
| 191 | Ga0105240_10076145 | 3300009093 | Unclassified | 4137 |
| 192 | Ga0105240_10411563 | 3300009093 | Bacteria | 1521 |
| 193 | Ga0105240_10449933 | 3300009093 | Bacteria | 1441 |
| 194 | Ga0105240_10526071 | 3300009093 | Bacteria | 1312 |
| 195 | Ga0105240_11230027 | 3300009093 | Bacteria | 792 |
| 196 | Ga0111539_10006899 | 3300009094 | Bacteria | 14589 |
| 197 | Ga0111539_10123500 | 3300009094 | Bacteria | 3034 |
| 198 | Ga0105245_10009716 | 3300009098 | Bacteria | 8389 |
| 199 | Ga0105245_10396319 | 3300009098 | Bacteria | 1378 |
| 200 | Ga0105245_10829049 | 3300009098 | Bacteria | 964 |
| 201 | Ga0105245_11098783 | 3300009098 | Bacteria | 841 |
| 202 | Ga0105245_12762141 | 3300009098 | Unclassified | 544 |
| 203 | Ga0114129_10068086 | 3300009147 | Bacteria | 4965 |
| 204 | Ga0114129_10149271 | 3300009147 | Bacteria | 3199 |
| 205 | Ga0114129_10257092 | 3300009147 | Bacteria | 2342 |
| 206 | Ga0114129_10593857 | 3300009147 | Bacteria | 1435 |
| 207 | Ga0114129_10638722 | 3300009147 | Bacteria | 1375 |
| 208 | Ga0114129_11190610 | 3300009147 | Unclassified | 950 |
| 209 | Ga0105243_10217118 | 3300009148 | Bacteria | 1688 |
| 210 | Ga0105243_12410007 | 3300009148 | Bacteria | 565 |
| 211 | Ga0105241_10029048 | 3300009174 | Bacteria | 4122 |
| 212 | Ga0105241_10060179 | 3300009174 | Bacteria | 2921 |
| 213 | Ga0105241_11020972 | 3300009174 | Unclassified | 775 |
| 214 | Ga0105241_11364689 | 3300009174 | Bacteria | 677 |
| 215 | Ga0105242_10011977 | 3300009176 | Bacteria | 6676 |
| 216 | Ga0105242_10344449 | 3300009176 | Unclassified | 1374 |
| 217 | Ga0105242_10805309 | 3300009176 | Bacteria | 930 |
| 218 | Ga0105242_12278854 | 3300009176 | Bacteria | 588 |
| 219 | Ga0105248_10106284 | 3300009177 | Unclassified | 3165 |
| 220 | Ga0105248_10149760 | 3300009177 | Bacteria | 2633 |
| 221 | Ga0105248_10309363 | 3300009177 | Bacteria | 1779 |
| 222 | Ga0105248_10625218 | 3300009177 | Unclassified | 1215 |
| 223 | Ga0105248_12703570 | 3300009177 | Bacteria | 566 |
| 224 | Ga0105237_10012917 | 3300009545 | Bacteria | 8774 |
| 225 | Ga0105237_10015531 | 3300009545 | Bacteria | 7921 |
| 226 | Ga0105237_10024504 | 3300009545 | Bacteria | 6172 |
| 227 | Ga0105237_10780600 | 3300009545 | Unclassified | 962 |
| 228 | Ga0105237_10785625 | 3300009545 | Unclassified | 959 |
| 229 | Ga0105237_11417974 | 3300009545 | Bacteria | 701 |
| 230 | Ga0105237_11617205 | 3300009545 | Unclassified | 655 |
| 231 | Ga0105237_11901980 | 3300009545 | Bacteria | 603 |
| 232 | Ga0105238_10025924 | 3300009551 | Bacteria | 5976 |
| 233 | Ga0105238_10063743 | 3300009551 | Bacteria | 3686 |
| 234 | Ga0105238_10860593 | 3300009551 | Bacteria | 924 |
| 235 | Ga0105238_11028068 | 3300009551 | Unclassified | 845 |
| 236 | Ga0105249_10052984 | 3300009553 | Unclassified | 3707 |
| 237 | Ga0105249_10083925 | 3300009553 | Bacteria | 2966 |
| 238 | Ga0105249_10202712 | 3300009553 | Unclassified | 1942 |
| 239 | Ga0105249_10627930 | 3300009553 | Bacteria | 1131 |
| 240 | Ga0099796_10413276 | 3300010159 | Unclassified | 594 |
| 241 | Ga0105239_10000502 | 3300010375 | Bacteria | 56682 |
| 242 | Ga0105239_10177867 | 3300010375 | Unclassified | 2380 |
| 243 | Ga0105239_10183307 | 3300010375 | Unclassified | 2343 |
| 244 | Ga0105239_10336075 | 3300010375 | Bacteria | 1704 |
| 245 | Ga0105239_10548332 | 3300010375 | Bacteria | 1317 |
| 246 | Ga0105239_10677787 | 3300010375 | Bacteria | 1178 |
| 247 | Ga0105239_11094877 | 3300010375 | Unclassified | 917 |
| 248 | Ga0105246_10003731 | 3300011119 | Bacteria | 9226 |
| 249 | Ga0105246_10255962 | 3300011119 | Bacteria | 1392 |
| 250 | Ga0105246_10826395 | 3300011119 | Unclassified | 824 |
| 251 | Ga0105246_10983209 | 3300011119 | Unclassified | 763 |
| 252 | Ga0105246_11148564 | 3300011119 | Bacteria | 712 |
| 253 | Ga0157313_1040352 | 3300012503 | Bacteria | 570 |
| 254 | Ga0157373_10216961 | 3300013100 | Bacteria | 1349 |
| 255 | Ga0157373_10248202 | 3300013100 | Bacteria | 1259 |
| 256 | Ga0157371_10336482 | 3300013102 | Bacteria | 1097 |
| 257 | Ga0157370_10019384 | 3300013104 | Bacteria | 6825 |
| 258 | Ga0157370_10097759 | 3300013104 | Bacteria | 2754 |
| 259 | Ga0157370_10162460 | 3300013104 | Unclassified | 2078 |
| 260 | Ga0157370_10320792 | 3300013104 | Bacteria | 1429 |
| 261 | Ga0157370_10454868 | 3300013104 | Bacteria | 1177 |
| 262 | Ga0157369_10002403 | 3300013105 | Bacteria | 22497 |
| 263 | Ga0157369_10009602 | 3300013105 | Bacteria | 11065 |
| 264 | Ga0157369_10028745 | 3300013105 | Bacteria | 6149 |
| 265 | Ga0157369_10103281 | 3300013105 | Bacteria | 3036 |
| 266 | Ga0157369_10261716 | 3300013105 | Unclassified | 1804 |
| 267 | Ga0157369_10583662 | 3300013105 | Bacteria | 1154 |
| 268 | Ga0157369_10600390 | 3300013105 | Bacteria | 1136 |
| 269 | Ga0157374_10006661 | 3300013296 | Bacteria | 9814 |
| 270 | Ga0157374_10528474 | 3300013296 | Unclassified | 1186 |
| 271 | Ga0157374_10698198 | 3300013296 | Bacteria | 1028 |
| 272 | Ga0157374_12245861 | 3300013296 | Unclassified | 573 |
| 273 | Ga0157378_10306266 | 3300013297 | Bacteria | 1539 |
| 274 | Ga0163162_10085836 | 3300013306 | Bacteria | 3225 |
| 275 | Ga0163162_10540450 | 3300013306 | Unclassified | 1294 |
| 276 | Ga0163162_10872647 | 3300013306 | Unclassified | 1014 |
| 277 | Ga0163162_11286883 | 3300013306 | Unclassified | 831 |
| 278 | Ga0163162_11763355 | 3300013306 | Bacteria | 707 |
| 279 | Ga0163162_13039561 | 3300013306 | Unclassified | 539 |
| 280 | Ga0157372_10031550 | 3300013307 | Bacteria | 5801 |
| 281 | Ga0157372_10165279 | 3300013307 | Bacteria | 2559 |
| 282 | Ga0157372_10172509 | 3300013307 | Unclassified | 2502 |
| 283 | Ga0157372_11012561 | 3300013307 | Bacteria | 962 |
| 284 | Ga0157372_12035172 | 3300013307 | Bacteria | 660 |
| 285 | Ga0157372_12488056 | 3300013307 | Unclassified | 594 |
| 286 | Ga0157375_10010846 | 3300013308 | Bacteria | 8030 |
| 287 | Ga0157375_10161667 | 3300013308 | Unclassified | 2381 |
| 288 | Ga0157375_12584003 | 3300013308 | Unclassified | 607 |
| 289 | Ga0157375_12790456 | 3300013308 | Bacteria | 584 |
| 290 | Ga0163163_10008287 | 3300014325 | Bacteria | 9224 |
| 291 | Ga0163163_10059635 | 3300014325 | Bacteria | 3776 |
| 292 | Ga0163163_10071061 | 3300014325 | Bacteria | 3467 |
| 293 | Ga0163163_10310696 | 3300014325 | Bacteria | 1629 |
| 294 | Ga0157379_10254358 | 3300014968 | Bacteria | 1595 |
| 295 | Ga0157379_10590022 | 3300014968 | Bacteria | 1036 |
| 296 | Ga0157379_11340366 | 3300014968 | Bacteria | 692 |
| 297 | Ga0157379_12558199 | 3300014968 | Unclassified | 511 |
| 298 | Ga0157376_10521280 | 3300014969 | Bacteria | 1171 |
| 299 | Ga0157376_10638678 | 3300014969 | Bacteria | 1064 |
| 300 | Ga0157376_11432494 | 3300014969 | Unclassified | 723 |
| 301 | Ga0157376_11476840 | 3300014969 | Unclassified | 712 |
| 302 | Ga0157376_11514614 | 3300014969 | Bacteria | 704 |
| 303 | Ga0213876_10051555 | 3300021384 | Unclassified | 2175 |
| 304 | Ga0213875_10051130 | 3300021388 | Bacteria | 1936 |
| 305 | Ga0213875_10051175 | 3300021388 | Bacteria | 1935 |
| 306 | Ga0213875_10073377 | 3300021388 | Bacteria | 1597 |
| 307 | Ga0213875_10472007 | 3300021388 | Unclassified | 601 |
| 308 | Ga0228598_1000296 | 3300024227 | Bacteria | 9671 |
| 309 | Ga0207656_10099644 | 3300025321 | Bacteria | 1330 |
| 310 | Ga0207692_10451851 | 3300025898 | Unclassified | 809 |
| 311 | Ga0207680_10230202 | 3300025903 | Unclassified | 1274 |
| 312 | Ga0207647_10546027 | 3300025904 | Unclassified | 643 |
| 313 | Ga0207699_10138121 | 3300025906 | Unclassified | 1599 |
| 314 | Ga0207699_10373400 | 3300025906 | Bacteria | 1011 |
| 315 | Ga0207643_10067494 | 3300025908 | Unclassified | 2053 |
| 316 | Ga0207684_10006099 | 3300025910 | Bacteria | 11024 |
| 317 | Ga0207684_10521446 | 3300025910 | Bacteria | 1018 |
| 318 | Ga0207684_11402003 | 3300025910 | Bacteria | 572 |
| 319 | Ga0207654_10080785 | 3300025911 | Bacteria | 1956 |
| 320 | Ga0207654_10089811 | 3300025911 | Bacteria | 1870 |
| 321 | Ga0207654_10690389 | 3300025911 | Bacteria | 733 |
| 322 | Ga0207707_10375693 | 3300025912 | Bacteria | 1222 |
| 323 | Ga0207707_10882208 | 3300025912 | Unclassified | 740 |
| 324 | Ga0207695_10000808 | 3300025913 | Bacteria | 58272 |
| 325 | Ga0207695_10017373 | 3300025913 | Bacteria | 8371 |
| 326 | Ga0207695_10039201 | 3300025913 | Bacteria | 5093 |
| 327 | Ga0207695_10154449 | 3300025913 | Bacteria | 2231 |
| 328 | Ga0207695_10178334 | 3300025913 | Bacteria | 2046 |
| 329 | Ga0207695_10461767 | 3300025913 | Unclassified | 1153 |
| 330 | Ga0207695_11200021 | 3300025913 | Bacteria | 639 |
| 331 | Ga0207671_10009726 | 3300025914 | Bacteria | 8003 |
| 332 | Ga0207671_10010284 | 3300025914 | Bacteria | 7732 |
| 333 | Ga0207671_10276673 | 3300025914 | Unclassified | 1323 |
| 334 | Ga0207671_10902323 | 3300025914 | Bacteria | 699 |
| 335 | Ga0207693_10004156 | 3300025915 | Bacteria | 12279 |
| 336 | Ga0207693_10136899 | 3300025915 | Bacteria | 1926 |
| 337 | Ga0207693_10221622 | 3300025915 | Bacteria | 1486 |
| 338 | Ga0207663_10007962 | 3300025916 | Bacteria | 5529 |
| 339 | Ga0207663_10045214 | 3300025916 | Unclassified | 2707 |
| 340 | Ga0207663_10576802 | 3300025916 | Bacteria | 882 |
| 341 | Ga0207660_10155932 | 3300025917 | Unclassified | 1758 |
| 342 | Ga0207657_10034778 | 3300025919 | Bacteria | 4526 |
| 343 | Ga0207652_10069032 | 3300025921 | Bacteria | 3068 |
| 344 | Ga0207652_10155727 | 3300025921 | Unclassified | 2047 |
| 345 | Ga0207652_10309759 | 3300025921 | Bacteria | 1425 |
| 346 | Ga0207652_10985406 | 3300025921 | Unclassified | 741 |
| 347 | Ga0207646_10296975 | 3300025922 | Bacteria | 1460 |
| 348 | Ga0207646_11064309 | 3300025922 | Unclassified | 713 |
| 349 | Ga0207646_11178856 | 3300025922 | Bacteria | 672 |
| 350 | Ga0207681_10438126 | 3300025923 | Bacteria | 1061 |
| 351 | Ga0207694_10001446 | 3300025924 | Bacteria | 20345 |
| 352 | Ga0207694_10276508 | 3300025924 | Bacteria | 1378 |
| 353 | Ga0207650_10421643 | 3300025925 | Unclassified | 1107 |
| 354 | Ga0207650_11114050 | 3300025925 | Unclassified | 672 |
| 355 | Ga0207659_10004960 | 3300025926 | Bacteria | 8068 |
| 356 | Ga0207659_10603527 | 3300025926 | Unclassified | 936 |
| 357 | Ga0207659_10609819 | 3300025926 | Bacteria | 931 |
| 358 | Ga0207687_10123712 | 3300025927 | Bacteria | 1938 |
| 359 | Ga0207687_10181462 | 3300025927 | Unclassified | 1631 |
| 360 | Ga0207687_10447192 | 3300025927 | Bacteria | 1071 |
| 361 | Ga0207687_11560144 | 3300025927 | Unclassified | 567 |
| 362 | Ga0207700_10041597 | 3300025928 | Unclassified | 3364 |
| 363 | Ga0207700_10203759 | 3300025928 | Unclassified | 1668 |
| 364 | Ga0207700_10210511 | 3300025928 | Bacteria | 1643 |
| 365 | Ga0207700_10249289 | 3300025928 | Bacteria | 1516 |
| 366 | Ga0207700_10734596 | 3300025928 | Unclassified | 882 |
| 367 | Ga0207664_10186766 | 3300025929 | Bacteria | 1782 |
| 368 | Ga0207664_10331834 | 3300025929 | Bacteria | 1344 |
| 369 | Ga0207644_11497867 | 3300025931 | Unclassified | 566 |
| 370 | Ga0207686_10002661 | 3300025934 | Bacteria | 9688 |
| 371 | Ga0207686_10052428 | 3300025934 | Bacteria | 2546 |
| 372 | Ga0207709_10226018 | 3300025935 | Bacteria | 1353 |
| 373 | Ga0207670_10162345 | 3300025936 | Bacteria | 1669 |
| 374 | Ga0207670_10510368 | 3300025936 | Unclassified | 977 |
| 375 | Ga0207669_11382002 | 3300025937 | Unclassified | 599 |
| 376 | Ga0207704_10057836 | 3300025938 | Bacteria | 2384 |
| 377 | Ga0207704_11425157 | 3300025938 | Bacteria | 594 |
| 378 | Ga0207704_11473604 | 3300025938 | Bacteria | 584 |
| 379 | Ga0207665_10165830 | 3300025939 | Bacteria | 1592 |
| 380 | Ga0207711_10198084 | 3300025941 | Unclassified | 1832 |
| 381 | Ga0207711_11575853 | 3300025941 | Bacteria | 600 |
| 382 | Ga0207689_10099309 | 3300025942 | Bacteria | 2392 |
| 383 | Ga0207689_10203075 | 3300025942 | Bacteria | 1636 |
| 384 | Ga0207689_10429451 | 3300025942 | Bacteria | 1103 |
| 385 | Ga0207661_10041781 | 3300025944 | Bacteria | 3611 |
| 386 | Ga0207661_10119871 | 3300025944 | Bacteria | 2238 |
| 387 | Ga0207661_10185363 | 3300025944 | Unclassified | 1821 |
| 388 | Ga0207661_10662633 | 3300025944 | Unclassified | 959 |
| 389 | Ga0207679_10751274 | 3300025945 | Unclassified | 887 |
| 390 | Ga0207679_10753832 | 3300025945 | Unclassified | 886 |
| 391 | Ga0207679_11223563 | 3300025945 | Unclassified | 689 |
| 392 | Ga0207679_11627033 | 3300025945 | Bacteria | 592 |
| 393 | Ga0207667_10000673 | 3300025949 | Bacteria | 44277 |
| 394 | Ga0207667_12022315 | 3300025949 | Bacteria | 536 |
| 395 | Ga0207651_10120753 | 3300025960 | Bacteria | 1987 |
| 396 | Ga0207712_10514236 | 3300025961 | Bacteria | 1025 |
| 397 | Ga0207668_10525963 | 3300025972 | Unclassified | 1021 |
| 398 | Ga0207668_10940563 | 3300025972 | Bacteria | 770 |
| 399 | Ga0207640_11726500 | 3300025981 | Bacteria | 565 |
| 400 | Ga0207658_10033734 | 3300025986 | Bacteria | 3653 |
| 401 | Ga0207703_10139173 | 3300026035 | Bacteria | 2105 |
| 402 | Ga0207703_10142936 | 3300026035 | Bacteria | 2078 |
| 403 | Ga0207703_10941842 | 3300026035 | Bacteria | 828 |
| 404 | Ga0207639_10818330 | 3300026041 | Bacteria | 868 |
| 405 | Ga0207639_10880073 | 3300026041 | Unclassified | 837 |
| 406 | Ga0207708_10654808 | 3300026075 | Unclassified | 894 |
| 407 | Ga0207702_10037853 | 3300026078 | Bacteria | 4040 |
| 408 | Ga0207702_10072707 | 3300026078 | Bacteria | 2964 |
| 409 | Ga0207702_10175059 | 3300026078 | Bacteria | 1971 |
| 410 | Ga0207702_11290466 | 3300026078 | Unclassified | 724 |
| 411 | Ga0207641_11228405 | 3300026088 | Unclassified | 749 |
| 412 | Ga0207641_11995879 | 3300026088 | Bacteria | 581 |
| 413 | Ga0207648_10023321 | 3300026089 | Bacteria | 5547 |
| 414 | Ga0207648_11985976 | 3300026089 | Bacteria | 543 |
| 415 | Ga0207676_11012216 | 3300026095 | Bacteria | 819 |
| 416 | Ga0207674_10000109 | 3300026116 | Bacteria | 94920 |
| 417 | Ga0207674_10006906 | 3300026116 | Bacteria | 13298 |
| 418 | Ga0207674_10229513 | 3300026116 | Bacteria | 1804 |
| 419 | Ga0207674_10581577 | 3300026116 | Unclassified | 1082 |
| 420 | Ga0207675_100936917 | 3300026118 | Unclassified | 883 |
| 421 | Ga0207698_10178285 | 3300026142 | Bacteria | 1879 |
| 422 | Ga0207698_10457956 | 3300026142 | Bacteria | 1233 |
| 423 | Ga0207698_12476609 | 3300026142 | Bacteria | 529 |
| 424 | Ga0207428_10019404 | 3300027907 | Bacteria | 5798 |
| 425 | Ga0207428_10100717 | 3300027907 | Bacteria | 2233 |
| 426 | Ga0207428_10485193 | 3300027907 | Bacteria | 899 |
| 427 | Ga0268266_10108439 | 3300028379 | Bacteria | 2457 |
| 428 | Ga0268266_10234383 | 3300028379 | Bacteria | 1692 |
| 429 | Ga0268266_11242651 | 3300028379 | Unclassified | 720 |
| 430 | Ga0268264_10156277 | 3300028381 | Bacteria | 2050 |
| 431 | Ga0265323_10002130 | 3300028653 | Bacteria | 9230 |
| 432 | Ga0265338_10089049 | 3300028800 | Bacteria | 2559 |
| 433 | Ga0265338_11161066 | 3300028800 | Bacteria | 519 |
| 434 | Ga0265762_1011299 | 3300030760 | Bacteria | 1597 |
| 435 | Ga0265762_1052667 | 3300030760 | Bacteria | 821 |
| 436 | Ga0265760_10140068 | 3300031090 | Unclassified | 787 |
| 437 | Ga0265325_10343765 | 3300031241 | Bacteria | 660 |
| 438 | Ga0265325_10368252 | 3300031241 | Unclassified | 633 |
| 439 | Ga0265340_10037801 | 3300031247 | Bacteria | 2390 |
| 440 | Ga0265340_10147505 | 3300031247 | Bacteria | 1074 |
| 441 | Ga0265331_10069103 | 3300031250 | Bacteria | 1655 |
| 442 | Ga0265331_10136048 | 3300031250 | Bacteria | 1119 |
| 443 | Ga0265331_10163949 | 3300031250 | Bacteria | 1007 |
| 444 | Ga0265316_10039847 | 3300031344 | Bacteria | 3770 |
| 445 | Ga0265316_10452069 | 3300031344 | Unclassified | 921 |
| 446 | Ga0265314_10003017 | 3300031711 | Bacteria | 16637 |
| 447 | Ga0265314_10021585 | 3300031711 | Unclassified | 4945 |
| 448 | Ga0265314_10348166 | 3300031711 | Unclassified | 816 |
| 449 | Ga0265342_10045347 | 3300031712 | Unclassified | 2646 |
| 450 | Ga0265342_10063999 | 3300031712 | Bacteria | 2160 |
| 451 | Ga0307405_10340668 | 3300031731 | Bacteria | 1153 |
| 452 | Ga0307405_10502669 | 3300031731 | Unclassified | 972 |
| 453 | Ga0307413_10318870 | 3300031824 | Bacteria | 1186 |
| 454 | Ga0307410_10669176 | 3300031852 | Unclassified | 872 |
| 455 | Ga0307407_10234579 | 3300031903 | Bacteria | 1248 |
| 456 | Ga0307412_10220381 | 3300031911 | Unclassified | 1454 |
| 457 | Ga0307412_10345347 | 3300031911 | Bacteria | 1193 |
| 458 | Ga0307416_101155000 | 3300032002 | Unclassified | 880 |
| 459 | Ga0307414_11583594 | 3300032004 | Unclassified | 610 |
| 460 | Ga0307411_10546843 | 3300032005 | Bacteria | 987 |
| 461 | Ga0307510_10024079 | 3300033180 | Bacteria | 7042 |
| 462 | Ga0307510_10055224 | 3300033180 | Bacteria | 4150 |
| 463 | Ga0373954_0101165 | 3300035118 | Unclassified | 1391 |
| 464 | Ga0373955_0797109 | 3300035172 | Unclassified | 581 |
| 465 | Ga0373924_0548194 | 3300035410 | Unclassified | 521 |
| 466 | Ga0373935_0329198 | 3300035692 | Unclassified | 1085 |
| 467 | Ga0373935_1179977 | 3300035692 | Unclassified | 571 |
| 468 | Ga0373927_0113843 | 3300035695 | Bacteria | 1763 |
| 469 | Ga0373927_0991560 | 3300035695 | Unclassified | 554 |
| 470 | Ga0373933_1165735 | 3300035724 | Unclassified | 508 |
| 471 | Ga0373937_0656377 | 3300036401 | Unclassified | 995 |
| 472 | Ga0373925_0293305 | 3300037068 | Bacteria | 1312 |
| 473 | Ga0373925_0314770 | 3300037068 | Bacteria | 1266 |
| 474 | Ga0373925_0403767 | 3300037068 | Bacteria | 1115 |
| 475 | Ga0373925_1542379 | 3300037068 | Unclassified | 543 |
| 476 | Ga0395900_0273630 | 3300037418 | Bacteria | 1683 |
| 477 | Ga0395900_0781316 | 3300037418 | Bacteria | 884 |
| 478 | Ga0395898_0067057 | 3300037466 | Unclassified | 3476 |
| 479 | Ga0436364_0025059 | 3300037853 | Bacteria | 838 |
| 480 | Ga0436364_0067778 | 3300037853 | Unclassified | 858 |
| 481 | Ga0436364_0141740 | 3300037853 | Bacteria | 1359 |
| 482 | Ga0436364_0195132 | 3300037853 | Unclassified | 2599 |
| 483 | Ga0436364_0268926 | 3300037853 | Unclassified | 528 |
| 484 | Ga0436364_0877711 | 3300037853 | Bacteria | 5472 |
| 485 | Ga0436364_0909864 | 3300037853 | Unclassified | 2241 |
| 486 | Ga0436364_0923833 | 3300037853 | Unclassified | 629 |
| 487 | Ga0436364_0980994 | 3300037853 | Bacteria | 1300 |
| 488 | Ga0436364_1038348 | 3300037853 | Bacteria | 2199 |
| 489 | Ga0436364_1150490 | 3300037853 | Bacteria | 5923 |
| 490 | Ga0436364_1191071 | 3300037853 | Unclassified | 981 |
| 491 | Ga0436364_1227489 | 3300037853 | Bacteria | 11896 |
| 492 | Ga0436364_1314471 | 3300037853 | Bacteria | 781 |
| 493 | Ga0436364_1358164 | 3300037853 | Bacteria | 3039 |
| 494 | Ga0436364_1416338 | 3300037853 | Unclassified | 3717 |
| 495 | Ga0436365_0088699 | 3300039437 | Unclassified | 761 |
| 496 | Ga0436365_0277722 | 3300039437 | Unclassified | 2644 |
| 497 | Ga0436365_0612070 | 3300039437 | Unclassified | 847 |
| 498 | Ga0436365_1179091 | 3300039437 | Bacteria | 1866 |
| 499 | Ga0436365_1198862 | 3300039437 | Unclassified | 3381 |
| 500 | Ga0436360_0118015 | 3300039438 | Unclassified | 596 |
| 501 | Ga0436361_0271610 | 3300039447 | Bacteria | 15971 |
| 502 | Ga0436363_0535897 | 3300039450 | Unclassified | 669 |
| 503 | Ga0436362_0006487 | 3300039453 | Unclassified | 598 |
| 504 | Ga0436362_1179268 | 3300039453 | Unclassified | 717 |
| 505 | Ga0451800_1549858 | 3300041459 | Unclassified | 825 |
| 506 | Ga0439441_042378 | 3300042001 | Unclassified | 916 |
| 507 | Ga0466966_0336720 | 3300044684 | Unclassified | 907 |
| 508 | Ga0453684_0162723 | 3300044712 | Bacteria | 2638 |
| 509 | Ga0466959_0479060 | 3300045049 | Unclassified | 842 |
| 510 | Ga0466959_0785445 | 3300045049 | Unclassified | 637 |
| 511 | Ga0451576_0594878 | 3300045051 | Bacteria | 1163 |
| 512 | Ga0451576_2296105 | 3300045051 | Unclassified | 553 |
| 513 | Ga0451576_2447823 | 3300045051 | Unclassified | 534 |
| 514 | Ga0466958_0760330 | 3300045836 | Unclassified | 632 |
| 515 | Ga0495592_0637466 | 3300046454 | Unclassified | 647 |
| 516 | Ga0495592_0721596 | 3300046454 | Unclassified | 598 |
| 517 | Ga0495592_0795905 | 3300046454 | Bacteria | 562 |
| 518 | Ga0495651_0102645 | 3300046462 | Bacteria | 2126 |
| 519 | Ga0495653_0016554 | 3300046463 | Bacteria | 6001 |
| 520 | Ga0495580_0000042 | 3300046472 | Bacteria | 70551 |
| 521 | Ga0495580_0000643 | 3300046472 | Bacteria | 29655 |
| 522 | Ga0495580_0076953 | 3300046472 | Bacteria | 2327 |
| 523 | Ga0495580_0176034 | 3300046472 | Bacteria | 1478 |
| 524 | Ga0495582_0009201 | 3300046473 | Bacteria | 5448 |
| 525 | Ga0495662_0365916 | 3300046476 | Unclassified | 708 |
| 526 | Ga0495664_0227041 | 3300046477 | Bacteria | 1130 |
| 527 | Ga0495664_0321887 | 3300046477 | Bacteria | 932 |
| 528 | Ga0495594_0041666 | 3300046499 | Unclassified | 2514 |
| 529 | Ga0495608_0239565 | 3300046511 | Unclassified | 1134 |
| 530 | Ga0495608_0532870 | 3300046511 | Unclassified | 709 |
| 531 | Ga0495608_0593243 | 3300046511 | Unclassified | 665 |
| 532 | Ga0495618_0220726 | 3300046514 | Bacteria | 1196 |
| 533 | Ga0495628_0832866 | 3300046516 | Bacteria | 644 |
| 534 | Ga0495652_0149175 | 3300046529 | Bacteria | 1829 |
| 535 | Ga0495665_0049616 | 3300046531 | Bacteria | 2225 |
| 536 | Ga0495640_0254639 | 3300046533 | Bacteria | 1098 |
| 537 | Ga0495586_0099030 | 3300046535 | Bacteria | 1617 |
| 538 | Ga0495586_0165800 | 3300046535 | Bacteria | 1247 |
| 539 | Ga0495587_0180403 | 3300046536 | Unclassified | 1197 |
| 540 | Ga0495645_0478835 | 3300046543 | Unclassified | 781 |
| 541 | Ga0495634_0068833 | 3300046642 | Unclassified | 2337 |
| 542 | Ga0495634_0140311 | 3300046642 | Bacteria | 1535 |
| 543 | Ga0495635_0446433 | 3300046663 | Bacteria | 855 |
| 544 | Ga0495635_0832253 | 3300046663 | Unclassified | 594 |
| 545 | Ga0495657_0609798 | 3300046675 | Bacteria | 631 |
| 546 | Ga0495623_0233786 | 3300046679 | Unclassified | 1041 |
| 547 | Ga0495647_0337927 | 3300046681 | Bacteria | 684 |
| 548 | Ga0495658_0017353 | 3300046683 | Bacteria | 3717 |
| 549 | Ga0495669_0333426 | 3300046684 | Unclassified | 733 |
| 550 | Ga0495613_0471881 | 3300046689 | Unclassified | 848 |
| 551 | Ga0495613_0495213 | 3300046689 | Bacteria | 823 |
| 552 | Ga0495624_0215446 | 3300046690 | Unclassified | 1165 |
| 553 | Ga0495624_0682544 | 3300046690 | Bacteria | 610 |
| 554 | Ga0495600_0133344 | 3300046809 | Unclassified | 1614 |
| 555 | Ga0495600_0143702 | 3300046809 | Unclassified | 1547 |
| 556 | Ga0495600_0254622 | 3300046809 | Bacteria | 1116 |
| 557 | Ga0495600_0562521 | 3300046809 | Unclassified | 696 |
| 558 | Ga0495604_0029663 | 3300047317 | Bacteria | 4352 |
| 559 | Ga0495604_0045978 | 3300047317 | Bacteria | 3405 |
| 560 | Ga0495604_0100718 | 3300047317 | Bacteria | 2123 |
| 561 | Ga0495636_0120507 | 3300047318 | Bacteria | 1160 |
| 562 | Ga0495674_0028111 | 3300047319 | Bacteria | 5133 |
| 563 | Ga0495674_0063678 | 3300047319 | Unclassified | 3207 |
| 564 | Ga0495674_0068158 | 3300047319 | Bacteria | 3080 |
| 565 | Ga0495674_0082963 | 3300047319 | Bacteria | 2748 |
| 566 | Ga0495674_0157185 | 3300047319 | Bacteria | 1904 |
| 567 | Ga0495674_0221198 | 3300047319 | Bacteria | 1565 |
| 568 | Ga0495674_0372121 | 3300047319 | Bacteria | 1157 |
| 569 | Ga0495674_0418511 | 3300047319 | Unclassified | 1080 |
| 570 | Ga0495684_0011665 | 3300047471 | Bacteria | 6785 |
| 571 | Ga0495684_0109861 | 3300047471 | Bacteria | 2082 |
| 572 | Ga0495684_0696706 | 3300047471 | Bacteria | 674 |
| 573 | Ga0495684_0703582 | 3300047471 | Unclassified | 670 |
| 574 | Ga0495684_0778723 | 3300047471 | Unclassified | 627 |
| 575 | Ga0495593_0663101 | 3300047673 | Archaea | 524 |
| 576 | Ga0495602_0011901 | 3300048088 | Bacteria | 8975 |
| 577 | Ga0495602_0595212 | 3300048088 | Unclassified | 761 |
| 578 | Ga0495602_0604132 | 3300048088 | Bacteria | 754 |
| 579 | Ga0495602_0978036 | 3300048088 | Unclassified | 559 |
| 580 | Ga0496100_0592025 | 3300048903 | Unclassified | 861 |
| 581 | Ga0496103_0929602 | 3300048906 | Unclassified | 544 |
| 582 | Ga0496104_0956305 | 3300048907 | Unclassified | 761 |
| 583 | Ga0496105_0655355 | 3300048908 | Bacteria | 810 |
| 584 | Ga0496105_1324136 | 3300048908 | Unclassified | 525 |
| 585 | Ga0496108_1578653 | 3300048911 | Bacteria | 544 |
| 586 | Ga0496112_0616091 | 3300048915 | Bacteria | 1017 |
| 587 | Ga0496112_0672781 | 3300048915 | Bacteria | 964 |
| 588 | Ga0496114_0489323 | 3300048917 | Unclassified | 1088 |
| 589 | Ga0496115_0236935 | 3300048918 | Bacteria | 1504 |
| 590 | Ga0496118_0448593 | 3300048921 | Bacteria | 656 |
| 591 | Ga0496126_0000063 | 3300048929 | Bacteria | 256841 |
| 592 | Ga0496126_0084731 | 3300048929 | Bacteria | 2795 |
| 593 | Ga0501299_091476 | 3300049522 | Unclassified | 692 |
| 594 | Ga0501040_1037321 | 3300049576 | Unclassified | 595 |
| 595 | Ga0501071_1236975 | 3300049587 | Unclassified | 577 |
| 596 | Ga0501073_0426836 | 3300049589 | Bacteria | 916 |
| 597 | Ga0501076_0191995 | 3300049592 | Bacteria | 1667 |
| 598 | Ga0501224_062751 | 3300049664 | Unclassified | 581 |
| 599 | Ga0501227_092435 | 3300049665 | Unclassified | 799 |
| 600 | Ga0501079_0394309 | 3300049741 | Bacteria | 1086 |
| 601 | Ga0501080_1081582 | 3300049742 | Bacteria | 693 |
| 602 | Ga0501045_0896072 | 3300049824 | Bacteria | 652 |
| 603 | nmdc:mga00v17_608643_c1 | 3300050491 | Unclassified | 704 |
| 604 | nmdc:mga05p37_1929409_c1 | 3300050507 | Bacteria | 562 |
| 605 | nmdc:mga05p37_56119_c1 | 3300050507 | Bacteria | 4849 |
| 606 | nmdc:mga05p37_572168_c1 | 3300050507 | Unclassified | 1281 |
| 607 | nmdc:mga05p37_934246_c1 | 3300050507 | Unclassified | 931 |
| 608 | nmdc:mga09592_332156_c1 | 3300050508 | Unclassified | 1316 |
| 609 | nmdc:mga09592_360282_c1 | 3300050508 | Unclassified | 1258 |
| 610 | nmdc:mga09592_606881_c1 | 3300050508 | Bacteria | 937 |
| 611 | nmdc:mga09592_65859_c1 | 3300050508 | Unclassified | 3070 |
| 612 | nmdc:mga09592_86136_c1 | 3300050508 | Bacteria | 2680 |
| 613 | nmdc:mga0qj67_21857_c1 | 3300050509 | Unclassified | 4908 |
| 614 | nmdc:mga0qj67_598059_c1 | 3300050509 | Bacteria | 882 |
| 615 | nmdc:mga06r32_119570_c1 | 3300050510 | Bacteria | 2598 |
| 616 | nmdc:mga06r32_1215631_c1 | 3300050510 | Unclassified | 699 |
| 617 | nmdc:mga06r32_232402_c1 | 3300050510 | Unclassified | 1832 |
| 618 | nmdc:mga06r32_385991_c1 | 3300050510 | Bacteria | 1383 |
| 619 | nmdc:mga06r32_83004_c1 | 3300050510 | Unclassified | 3122 |
| 620 | nmdc:mga08y16_101433_c1 | 3300050511 | Bacteria | 2996 |
| 621 | nmdc:mga08y16_276537_c1 | 3300050511 | Unclassified | 1733 |
| 622 | nmdc:mga08y16_34708_c1 | 3300050511 | Bacteria | 5300 |
| 623 | nmdc:mga0n895_751197_c1 | 3300050512 | Bacteria | 968 |
| 624 | nmdc:mga0n895_75885_c1 | 3300050512 | Bacteria | 3342 |
| 625 | nmdc:mga08x19_368195_c1 | 3300050514 | Bacteria | 1005 |
| 626 | Ga0495601_0118492 | 3300053077 | Bacteria | 1718 |
| 627 | Ga0495619_0007563 | 3300053085 | Bacteria | 6879 |
| 628 | Ga0501084_0511848 | 3300054114 | Bacteria | 1015 |
| 629 | Ga0500661_001093 | 3300055283 | Bacteria | 5103 |
| 630 | Ga0590071_001337 | 3300059421 | Bacteria | 6546 |
| 631 | Ga0590074_010660 | 3300059423 | Bacteria | 1536 |
| 632 | Ga0590075_005646 | 3300059424 | Unclassified | 2957 |
| 633 | Ga0590077_000501 | 3300059426 | Bacteria | 10906 |
| 634 | Ga0068865_101870036 | |||
| 635 | rootH2_10194854 | |||
| 636 | Ga0070676_10804560 | |||
| 637 | Ga0070683_100001260 | |||
| 638 | Ga0070690_100099871 | |||
| 639 | Ga0070690_100721155 | |||
| 640 | Ga0070690_101265196 | |||
| 641 | Ga0070670_100345696 | |||
| 642 | Ga0070670_100493599 | |||
| 643 | Ga0070670_100909363 | |||
| 644 | Ga0068869_100250128 | |||
| 645 | Ga0070666_10736180 | |||
| 646 | Ga0070666_10891739 | |||
| 647 | Ga0070666_11442698 | |||
| 648 | Ga0070680_100357628 | |||
| 649 | Ga0070680_100713151 | |||
| 650 | Ga0070660_100164717 | |||
| 651 | Ga0070689_100196894 | |||
| 652 | Ga0070689_100230009 | |||
| 653 | Ga0070689_100737714 | |||
| 654 | Ga0070691_10000025 | |||
| 655 | Ga0070661_100204987 | |||
| 656 | Ga0070669_100306214 | |||
| 657 | Ga0070669_100462588 | |||
| 658 | Ga0070675_100003547 | |||
| 659 | Ga0070675_100893777 | |||
| 660 | Ga0070675_101369921 | |||
| 661 | Ga0070674_101063211 | |||
| 662 | Ga0070673_100182186 | |||
| 663 | Ga0070673_101288015 | |||
| 664 | Ga0070688_100239795 | |||
| 665 | Ga0070688_100554313 | |||
| 666 | Ga0070659_101999775 | |||
| 667 | Ga0070709_10349076 | |||
| 668 | Ga0070709_10919892 | |||
| 669 | Ga0070714_100050492 | |||
| 670 | Ga0070714_100610864 | |||
| 671 | Ga0070714_101066045 | |||
| 672 | Ga0070714_101364337 | |||
| 673 | Ga0070713_100022699 | |||
| 674 | Ga0070713_100042226 | |||
| 675 | Ga0070713_100053730 | |||
| 676 | Ga0070713_100269134 | |||
| 677 | Ga0070713_100393859 | |||
| 678 | Ga0070711_100089601 | |||
| 679 | Ga0070711_100127778 | |||
| 680 | Ga0070711_100213962 | |||
| 681 | Ga0070711_100255677 | |||
| 682 | Ga0070711_101530522 | |||
| 683 | Ga0070705_100277991 | |||
| 684 | Ga0070700_100310313 | |||
| 685 | Ga0070694_100152174 | |||
| 686 | Ga0070694_100162860 | |||
| 687 | Ga0070694_100946674 | |||
| 688 | Ga0070694_101124586 | |||
| 689 | Ga0070694_101365479 | |||
| 690 | Ga0070708_100007058 | |||
| 691 | Ga0070708_100222976 | |||
| 692 | Ga0070708_100933682 | |||
| 693 | Ga0070663_100699819 | |||
| 694 | Ga0070663_101921115 | |||
| 695 | Ga0070681_10017510 | |||
| 696 | Ga0070681_10053985 | |||
| 697 | Ga0070681_10056692 | |||
| 698 | Ga0070681_10248656 | |||
| 699 | Ga0068867_100630580 | |||
| 700 | Ga0070685_10331778 | |||
| 701 | Ga0070685_10561674 | |||
| 702 | Ga0070706_100018931 | |||
| 703 | Ga0070706_100651397 | |||
| 704 | Ga0070706_101300254 | |||
| 705 | Ga0070707_100190668 | |||
| 706 | Ga0070707_100403596 | |||
| 707 | Ga0070707_101505804 | |||
| 708 | Ga0070698_100040425 | |||
| 709 | Ga0070698_101213402 | |||
| 710 | Ga0070699_100238580 | |||
| 711 | Ga0070699_100503024 | |||
| 712 | Ga0070699_100907987 | |||
| 713 | Ga0070699_102192889 | |||
| 714 | Ga0070679_100112556 | |||
| 715 | Ga0070679_100126019 | |||
| 716 | Ga0070679_100287336 | |||
| 717 | Ga0070679_100352577 | |||
| 718 | Ga0070684_100000569 | |||
| 719 | Ga0070684_100034261 | |||
| 720 | Ga0070684_100187288 | |||
| 721 | Ga0070684_100605058 | |||
| 722 | Ga0070697_100007205 | |||
| 723 | Ga0070697_100067722 | |||
| 724 | Ga0070697_102092720 | |||
| 725 | Ga0068853_100051174 | |||
| 726 | Ga0068853_100950661 | |||
| 727 | Ga0070672_100883180 | |||
| 728 | Ga0070672_100894895 | |||
| 729 | Ga0070695_100020986 | |||
| 730 | Ga0070695_100197330 | |||
| 731 | Ga0070696_100001913 | |||
| 732 | Ga0070696_100520330 | |||
| 733 | Ga0070696_100961231 | |||
| 734 | Ga0070693_100005864 | |||
| 735 | Ga0070665_100772731 | |||
| 736 | Ga0070665_101798652 | |||
| 737 | Ga0070704_100003082 | |||
| 738 | Ga0070704_100209708 | |||
| 739 | Ga0070704_100961409 | |||
| 740 | Ga0068855_100007973 | |||
| 741 | Ga0068855_100288423 | |||
| 742 | Ga0068855_100610681 | |||
| 743 | Ga0068855_101525512 | |||
| 744 | Ga0068855_101846268 | |||
| 745 | Ga0068857_100000789 | |||
| 746 | Ga0068857_100003905 | |||
| 747 | Ga0068857_100460541 | |||
| 748 | Ga0068857_100897540 | |||
| 749 | Ga0068854_101099976 | |||
| 750 | Ga0068856_100220358 | |||
| 751 | Ga0068856_100323456 | |||
| 752 | Ga0068852_100003718 | |||
| 753 | Ga0068852_100603913 | |||
| 754 | Ga0068852_101347040 | |||
| 755 | Ga0068852_102155899 | |||
| 756 | Ga0068859_100009499 | |||
| 757 | Ga0068859_100194201 | |||
| 758 | Ga0068859_100672172 | |||
| 759 | Ga0068864_100312780 | |||
| 760 | Ga0068864_100780511 | |||
| 761 | Ga0068866_11057376 | |||
| 762 | Ga0068861_101159079 | |||
| 763 | Ga0068851_10013902 | |||
| 764 | Ga0068870_10018219 | |||
| 765 | Ga0068870_10055592 | |||
| 766 | Ga0068863_101328052 | |||
| 767 | Ga0068863_102135540 | |||
| 768 | Ga0068863_102396326 | |||
| 769 | Ga0068858_100636002 | |||
| 770 | Ga0068858_101300574 | |||
| 771 | Ga0068860_100033059 | |||
| 772 | Ga0068860_100129690 | |||
| 773 | Ga0068860_101060468 | |||
| 774 | Ga0068860_101549029 | |||
| 775 | Ga0068860_102265354 | |||
| 776 | Ga0068862_100089758 | |||
| 777 | Ga0068862_100994727 | |||
| 778 | Ga0070717_10070005 | |||
| 779 | Ga0070717_10261672 | |||
| 780 | Ga0070717_10644872 | |||
| 781 | Ga0070717_11058031 | |||
| 782 | Ga0070717_11447466 | |||
| 783 | Ga0075432_10362058 | |||
| 784 | Ga0070716_100184389 | |||
| 785 | Ga0070712_100004714 | |||
| 786 | Ga0070712_100005089 | |||
| 787 | Ga0070712_100110180 | |||
| 788 | Ga0075367_10390649 | |||
| 789 | Ga0097621_101451667 | |||
| 790 | Ga0068871_100050175 | |||
| 791 | Ga0068871_100317028 | |||
| 792 | Ga0068871_102054595 | |||
| 793 | Ga0075428_100050137 | |||
| 794 | Ga0075428_100092439 | |||
| 795 | Ga0075428_100460354 | |||
| 796 | Ga0075430_100022574 | |||
| 797 | Ga0075430_100023589 | |||
| 798 | Ga0075430_100353848 | |||
| 799 | Ga0075430_101617579 | |||
| 800 | Ga0075431_100013268 | |||
| 801 | Ga0075431_100068753 | |||
| 802 | Ga0075431_100218568 | |||
| 803 | Ga0075431_100300893 | |||
| 804 | Ga0075434_100070284 | |||
| 805 | Ga0075434_100528259 | |||
| 806 | Ga0075434_100787848 | |||
| 807 | Ga0075429_100043178 | |||
| 808 | Ga0075429_100348636 | |||
| 809 | Ga0075429_100762343 | |||
| 810 | Ga0068865_100207038 | |||
| 811 | Ga0068865_101563967 | |||
| 812 | Ga0075436_100096773 | |||
| 813 | Ga0075436_100716284 | |||
| 814 | Ga0097620_100009498 | |||
| 815 | Ga0097620_100194200 | |||
| 816 | Ga0097620_100672142 | |||
| 817 | Ga0097620_103085024 | |||
| 818 | Ga0075435_100567650 | |||
| 819 | Ga0075435_100608032 | |||
| 820 | Ga0099794_10343105 | |||
| 821 | Ga0105240_10002088 | |||
| 822 | Ga0105240_10053001 | |||
| 823 | Ga0105240_10071936 | |||
| 824 | Ga0105240_10076145 | |||
| 825 | Ga0105240_10411563 | |||
| 826 | Ga0105240_10449933 | |||
| 827 | Ga0105240_10526071 | |||
| 828 | Ga0105240_11230027 | |||
| 829 | Ga0111539_10006899 | |||
| 830 | Ga0111539_10123500 | |||
| 831 | Ga0105245_10009716 | |||
| 832 | Ga0105245_10396319 | |||
| 833 | Ga0105245_10829049 | |||
| 834 | Ga0105245_11098783 | |||
| 835 | Ga0105245_12762141 | |||
| 836 | Ga0114129_10068086 | |||
| 837 | Ga0114129_10149271 | |||
| 838 | Ga0114129_10257092 | |||
| 839 | Ga0114129_10593857 | |||
| 840 | Ga0114129_10638722 | |||
| 841 | Ga0114129_11190610 | |||
| 842 | Ga0105243_10217118 | |||
| 843 | Ga0105243_12410007 | |||
| 844 | Ga0105241_10029048 | |||
| 845 | Ga0105241_10060179 | |||
| 846 | Ga0105241_11020972 | |||
| 847 | Ga0105241_11364689 | |||
| 848 | Ga0105242_10011977 | |||
| 849 | Ga0105242_10344449 | |||
| 850 | Ga0105242_10805309 | |||
| 851 | Ga0105242_12278854 | |||
| 852 | Ga0105248_10106284 | |||
| 853 | Ga0105248_10149760 | |||
| 854 | Ga0105248_10309363 | |||
| 855 | Ga0105248_10625218 | |||
| 856 | Ga0105248_12703570 | |||
| 857 | Ga0105237_10012917 | |||
| 858 | Ga0105237_10015531 | |||
| 859 | Ga0105237_10024504 | |||
| 860 | Ga0105237_10780600 | |||
| 861 | Ga0105237_10785625 | |||
| 862 | Ga0105237_11417974 | |||
| 863 | Ga0105237_11617205 | |||
| 864 | Ga0105237_11901980 | |||
| 865 | Ga0105238_10025924 | |||
| 866 | Ga0105238_10063743 | |||
| 867 | Ga0105238_10860593 | |||
| 868 | Ga0105238_11028068 | |||
| 869 | Ga0105249_10052984 | |||
| 870 | Ga0105249_10083925 | |||
| 871 | Ga0105249_10202712 | |||
| 872 | Ga0105249_10627930 | |||
| 873 | Ga0099796_10413276 | |||
| 874 | Ga0105239_10000502 | |||
| 875 | Ga0105239_10177867 | |||
| 876 | Ga0105239_10183307 | |||
| 877 | Ga0105239_10336075 | |||
| 878 | Ga0105239_10548332 | |||
| 879 | Ga0105239_10677787 | |||
| 880 | Ga0105239_11094877 | |||
| 881 | Ga0105246_10003731 | |||
| 882 | Ga0105246_10255962 | |||
| 883 | Ga0105246_10826395 | |||
| 884 | Ga0105246_10983209 | |||
| 885 | Ga0105246_11148564 | |||
| 886 | Ga0157313_1040352 | |||
| 887 | Ga0157373_10216961 | |||
| 888 | Ga0157373_10248202 | |||
| 889 | Ga0157371_10336482 | |||
| 890 | Ga0157370_10019384 | |||
| 891 | Ga0157370_10097759 | |||
| 892 | Ga0157370_10162460 | |||
| 893 | Ga0157370_10320792 | |||
| 894 | Ga0157370_10454868 | |||
| 895 | Ga0157369_10002403 | |||
| 896 | Ga0157369_10009602 | |||
| 897 | Ga0157369_10028745 | |||
| 898 | Ga0157369_10103281 | |||
| 899 | Ga0157369_10261716 | |||
| 900 | Ga0157369_10583662 | |||
| 901 | Ga0157369_10600390 | |||
| 902 | Ga0157374_10006661 | |||
| 903 | Ga0157374_10528474 | |||
| 904 | Ga0157374_10698198 | |||
| 905 | Ga0157374_12245861 | |||
| 906 | Ga0157378_10306266 | |||
| 907 | Ga0163162_10085836 | |||
| 908 | Ga0163162_10540450 | |||
| 909 | Ga0163162_10872647 | |||
| 910 | Ga0163162_11286883 | |||
| 911 | Ga0163162_11763355 | |||
| 912 | Ga0163162_13039561 | |||
| 913 | Ga0157372_10031550 | |||
| 914 | Ga0157372_10165279 | |||
| 915 | Ga0157372_10172509 | |||
| 916 | Ga0157372_11012561 | |||
| 917 | Ga0157372_12035172 | |||
| 918 | Ga0157372_12488056 | |||
| 919 | Ga0157375_10010846 | |||
| 920 | Ga0157375_10161667 | |||
| 921 | Ga0157375_12584003 | |||
| 922 | Ga0157375_12790456 | |||
| 923 | Ga0163163_10008287 | |||
| 924 | Ga0163163_10059635 | |||
| 925 | Ga0163163_10071061 | |||
| 926 | Ga0163163_10310696 | |||
| 927 | Ga0157379_10254358 | |||
| 928 | Ga0157379_10590022 | |||
| 929 | Ga0157379_11340366 | |||
| 930 | Ga0157379_12558199 | |||
| 931 | Ga0157376_10521280 | |||
| 932 | Ga0157376_10638678 | |||
| 933 | Ga0157376_11432494 | |||
| 934 | Ga0157376_11476840 | |||
| 935 | Ga0157376_11514614 | |||
| 936 | Ga0213876_10051555 | |||
| 937 | Ga0213875_10051130 | |||
| 938 | Ga0213875_10051175 | |||
| 939 | Ga0213875_10073377 | |||
| 940 | Ga0213875_10472007 | |||
| 941 | Ga0228598_1000296 | |||
| 942 | Ga0207656_10099644 | |||
| 943 | Ga0207692_10451851 | |||
| 944 | Ga0207680_10230202 | |||
| 945 | Ga0207647_10546027 | |||
| 946 | Ga0207699_10138121 | |||
| 947 | Ga0207699_10373400 | |||
| 948 | Ga0207643_10067494 | |||
| 949 | Ga0207684_10006099 | |||
| 950 | Ga0207684_10521446 | |||
| 951 | Ga0207684_11402003 | |||
| 952 | Ga0207654_10080785 | |||
| 953 | Ga0207654_10089811 | |||
| 954 | Ga0207654_10690389 | |||
| 955 | Ga0207707_10375693 | |||
| 956 | Ga0207707_10882208 | |||
| 957 | Ga0207695_10000808 | |||
| 958 | Ga0207695_10017373 | |||
| 959 | Ga0207695_10039201 | |||
| 960 | Ga0207695_10154449 | |||
| 961 | Ga0207695_10178334 | |||
| 962 | Ga0207695_10461767 | |||
| 963 | Ga0207695_11200021 | |||
| 964 | Ga0207671_10009726 | |||
| 965 | Ga0207671_10010284 | |||
| 966 | Ga0207671_10276673 | |||
| 967 | Ga0207671_10902323 | |||
| 968 | Ga0207693_10004156 | |||
| 969 | Ga0207693_10136899 | |||
| 970 | Ga0207693_10221622 | |||
| 971 | Ga0207663_10007962 | |||
| 972 | Ga0207663_10045214 | |||
| 973 | Ga0207663_10576802 | |||
| 974 | Ga0207660_10155932 | |||
| 975 | Ga0207657_10034778 | |||
| 976 | Ga0207652_10069032 | |||
| 977 | Ga0207652_10155727 | |||
| 978 | Ga0207652_10309759 | |||
| 979 | Ga0207652_10985406 | |||
| 980 | Ga0207646_10296975 | |||
| 981 | Ga0207646_11064309 | |||
| 982 | Ga0207646_11178856 | |||
| 983 | Ga0207681_10438126 | |||
| 984 | Ga0207694_10001446 | |||
| 985 | Ga0207694_10276508 | |||
| 986 | Ga0207650_10421643 | |||
| 987 | Ga0207650_11114050 | |||
| 988 | Ga0207659_10004960 | |||
| 989 | Ga0207659_10603527 | |||
| 990 | Ga0207659_10609819 | |||
| 991 | Ga0207687_10123712 | |||
| 992 | Ga0207687_10181462 | |||
| 993 | Ga0207687_10447192 | |||
| 994 | Ga0207687_11560144 | |||
| 995 | Ga0207700_10041597 | |||
| 996 | Ga0207700_10203759 | |||
| 997 | Ga0207700_10210511 | |||
| 998 | Ga0207700_10249289 | |||
| 999 | Ga0207700_10734596 | |||
| 1000 | Ga0207664_10186766 | |||
| 1001 | Ga0207664_10331834 | |||
| 1002 | Ga0207644_11497867 | |||
| 1003 | Ga0207686_10002661 | |||
| 1004 | Ga0207686_10052428 | |||
| 1005 | Ga0207709_10226018 | |||
| 1006 | Ga0207670_10162345 | |||
| 1007 | Ga0207670_10510368 | |||
| 1008 | Ga0207669_11382002 | |||
| 1009 | Ga0207704_10057836 | |||
| 1010 | Ga0207704_11425157 | |||
| 1011 | Ga0207704_11473604 | |||
| 1012 | Ga0207665_10165830 | |||
| 1013 | Ga0207711_10198084 | |||
| 1014 | Ga0207711_11575853 | |||
| 1015 | Ga0207689_10099309 | |||
| 1016 | Ga0207689_10203075 | |||
| 1017 | Ga0207689_10429451 | |||
| 1018 | Ga0207661_10041781 | |||
| 1019 | Ga0207661_10119871 | |||
| 1020 | Ga0207661_10185363 | |||
| 1021 | Ga0207661_10662633 | |||
| 1022 | Ga0207679_10751274 | |||
| 1023 | Ga0207679_10753832 | |||
| 1024 | Ga0207679_11223563 | |||
| 1025 | Ga0207679_11627033 | |||
| 1026 | Ga0207667_10000673 | |||
| 1027 | Ga0207667_12022315 | |||
| 1028 | Ga0207651_10120753 | |||
| 1029 | Ga0207712_10514236 | |||
| 1030 | Ga0207668_10525963 | |||
| 1031 | Ga0207668_10940563 | |||
| 1032 | Ga0207640_11726500 | |||
| 1033 | Ga0207658_10033734 | |||
| 1034 | Ga0207703_10139173 | |||
| 1035 | Ga0207703_10142936 | |||
| 1036 | Ga0207703_10941842 | |||
| 1037 | Ga0207639_10818330 | |||
| 1038 | Ga0207639_10880073 | |||
| 1039 | Ga0207708_10654808 | |||
| 1040 | Ga0207702_10037853 | |||
| 1041 | Ga0207702_10072707 | |||
| 1042 | Ga0207702_10175059 | |||
| 1043 | Ga0207702_11290466 | |||
| 1044 | Ga0207641_11228405 | |||
| 1045 | Ga0207641_11995879 | |||
| 1046 | Ga0207648_10023321 | |||
| 1047 | Ga0207648_11985976 | |||
| 1048 | Ga0207676_11012216 | |||
| 1049 | Ga0207674_10000109 | |||
| 1050 | Ga0207674_10006906 | |||
| 1051 | Ga0207674_10229513 | |||
| 1052 | Ga0207674_10581577 | |||
| 1053 | Ga0207675_100936917 | |||
| 1054 | Ga0207698_10178285 | |||
| 1055 | Ga0207698_10457956 | |||
| 1056 | Ga0207698_12476609 | |||
| 1057 | Ga0207428_10019404 | |||
| 1058 | Ga0207428_10100717 | |||
| 1059 | Ga0207428_10485193 | |||
| 1060 | Ga0268266_10108439 | |||
| 1061 | Ga0268266_10234383 | |||
| 1062 | Ga0268266_11242651 | |||
| 1063 | Ga0268264_10156277 | |||
| 1064 | Ga0265323_10002130 | |||
| 1065 | Ga0265338_10089049 | |||
| 1066 | Ga0265338_11161066 | |||
| 1067 | Ga0265762_1011299 | |||
| 1068 | Ga0265762_1052667 | |||
| 1069 | Ga0265760_10140068 | |||
| 1070 | Ga0265325_10343765 | |||
| 1071 | Ga0265325_10368252 | |||
| 1072 | Ga0265340_10037801 | |||
| 1073 | Ga0265340_10147505 | |||
| 1074 | Ga0265331_10069103 | |||
| 1075 | Ga0265331_10136048 | |||
| 1076 | Ga0265331_10163949 | |||
| 1077 | Ga0265316_10039847 | |||
| 1078 | Ga0265316_10452069 | |||
| 1079 | Ga0265314_10003017 | |||
| 1080 | Ga0265314_10021585 | |||
| 1081 | Ga0265314_10348166 | |||
| 1082 | Ga0265342_10045347 | |||
| 1083 | Ga0265342_10063999 | |||
| 1084 | Ga0307405_10340668 | |||
| 1085 | Ga0307405_10502669 | |||
| 1086 | Ga0307413_10318870 | |||
| 1087 | Ga0307410_10669176 | |||
| 1088 | Ga0307407_10234579 | |||
| 1089 | Ga0307412_10220381 | |||
| 1090 | Ga0307412_10345347 | |||
| 1091 | Ga0307416_101155000 | |||
| 1092 | Ga0307414_11583594 | |||
| 1093 | Ga0307411_10546843 | |||
| 1094 | Ga0307510_10024079 | |||
| 1095 | Ga0307510_10055224 | |||
| 1096 | Ga0373954_0101165 | |||
| 1097 | Ga0373955_0797109 | |||
| 1098 | Ga0373924_0548194 | |||
| 1099 | Ga0373935_0329198 | |||
| 1100 | Ga0373935_1179977 | |||
| 1101 | Ga0373927_0113843 | |||
| 1102 | Ga0373927_0991560 | |||
| 1103 | Ga0373933_1165735 | |||
| 1104 | Ga0373937_0656377 | |||
| 1105 | Ga0373925_0293305 | |||
| 1106 | Ga0373925_0314770 | |||
| 1107 | Ga0373925_0403767 | |||
| 1108 | Ga0373925_1542379 | |||
| 1109 | Ga0395900_0273630 | |||
| 1110 | Ga0395900_0781316 | |||
| 1111 | Ga0395898_0067057 | |||
| 1112 | Ga0436364_0025059 | |||
| 1113 | Ga0436364_0067778 | |||
| 1114 | Ga0436364_0141740 | |||
| 1115 | Ga0436364_0195132 | |||
| 1116 | Ga0436364_0268926 | |||
| 1117 | Ga0436364_0877711 | |||
| 1118 | Ga0436364_0909864 | |||
| 1119 | Ga0436364_0923833 | |||
| 1120 | Ga0436364_0980994 | |||
| 1121 | Ga0436364_1038348 | |||
| 1122 | Ga0436364_1150490 | |||
| 1123 | Ga0436364_1191071 | |||
| 1124 | Ga0436364_1227489 | |||
| 1125 | Ga0436364_1314471 | |||
| 1126 | Ga0436364_1358164 | |||
| 1127 | Ga0436364_1416338 | |||
| 1128 | Ga0436365_0088699 | |||
| 1129 | Ga0436365_0277722 | |||
| 1130 | Ga0436365_0612070 | |||
| 1131 | Ga0436365_1179091 | |||
| 1132 | Ga0436365_1198862 | |||
| 1133 | Ga0436360_0118015 | |||
| 1134 | Ga0436361_0271610 | |||
| 1135 | Ga0436363_0535897 | |||
| 1136 | Ga0436362_0006487 | |||
| 1137 | Ga0436362_1179268 | |||
| 1138 | Ga0451800_1549858 | |||
| 1139 | Ga0439441_042378 | |||
| 1140 | Ga0466966_0336720 | |||
| 1141 | Ga0453684_0162723 | |||
| 1142 | Ga0466959_0479060 | |||
| 1143 | Ga0466959_0785445 | |||
| 1144 | Ga0451576_0594878 | |||
| 1145 | Ga0451576_2296105 | |||
| 1146 | Ga0451576_2447823 | |||
| 1147 | Ga0466958_0760330 | |||
| 1148 | Ga0495592_0637466 | |||
| 1149 | Ga0495592_0721596 | |||
| 1150 | Ga0495592_0795905 | |||
| 1151 | Ga0495651_0102645 | |||
| 1152 | Ga0495653_0016554 | |||
| 1153 | Ga0495580_0000042 | |||
| 1154 | Ga0495580_0000643 | |||
| 1155 | Ga0495580_0076953 | |||
| 1156 | Ga0495580_0176034 | |||
| 1157 | Ga0495582_0009201 | |||
| 1158 | Ga0495662_0365916 | |||
| 1159 | Ga0495664_0227041 | |||
| 1160 | Ga0495664_0321887 | |||
| 1161 | Ga0495594_0041666 | |||
| 1162 | Ga0495608_0239565 | |||
| 1163 | Ga0495608_0532870 | |||
| 1164 | Ga0495608_0593243 | |||
| 1165 | Ga0495618_0220726 | |||
| 1166 | Ga0495628_0832866 | |||
| 1167 | Ga0495652_0149175 | |||
| 1168 | Ga0495665_0049616 | |||
| 1169 | Ga0495640_0254639 | |||
| 1170 | Ga0495586_0099030 | |||
| 1171 | Ga0495586_0165800 | |||
| 1172 | Ga0495587_0180403 | |||
| 1173 | Ga0495645_0478835 | |||
| 1174 | Ga0495634_0068833 | |||
| 1175 | Ga0495634_0140311 | |||
| 1176 | Ga0495635_0446433 | |||
| 1177 | Ga0495635_0832253 | |||
| 1178 | Ga0495657_0609798 | |||
| 1179 | Ga0495623_0233786 | |||
| 1180 | Ga0495647_0337927 | |||
| 1181 | Ga0495658_0017353 | |||
| 1182 | Ga0495669_0333426 | |||
| 1183 | Ga0495613_0471881 | |||
| 1184 | Ga0495613_0495213 | |||
| 1185 | Ga0495624_0215446 | |||
| 1186 | Ga0495624_0682544 | |||
| 1187 | Ga0495600_0133344 | |||
| 1188 | Ga0495600_0143702 | |||
| 1189 | Ga0495600_0254622 | |||
| 1190 | Ga0495600_0562521 | |||
| 1191 | Ga0495604_0029663 | |||
| 1192 | Ga0495604_0045978 | |||
| 1193 | Ga0495604_0100718 | |||
| 1194 | Ga0495636_0120507 | |||
| 1195 | Ga0495674_0028111 | |||
| 1196 | Ga0495674_0063678 | |||
| 1197 | Ga0495674_0068158 | |||
| 1198 | Ga0495674_0082963 | |||
| 1199 | Ga0495674_0157185 | |||
| 1200 | Ga0495674_0221198 | |||
| 1201 | Ga0495674_0372121 | |||
| 1202 | Ga0495674_0418511 | |||
| 1203 | Ga0495684_0011665 | |||
| 1204 | Ga0495684_0109861 | |||
| 1205 | Ga0495684_0696706 | |||
| 1206 | Ga0495684_0703582 | |||
| 1207 | Ga0495684_0778723 | |||
| 1208 | Ga0495593_0663101 | |||
| 1209 | Ga0495602_0011901 | |||
| 1210 | Ga0495602_0595212 | |||
| 1211 | Ga0495602_0604132 | |||
| 1212 | Ga0495602_0978036 | |||
| 1213 | Ga0496100_0592025 | |||
| 1214 | Ga0496103_0929602 | |||
| 1215 | Ga0496104_0956305 | |||
| 1216 | Ga0496105_0655355 | |||
| 1217 | Ga0496105_1324136 | |||
| 1218 | Ga0496108_1578653 | |||
| 1219 | Ga0496112_0616091 | |||
| 1220 | Ga0496112_0672781 | |||
| 1221 | Ga0496114_0489323 | |||
| 1222 | Ga0496115_0236935 | |||
| 1223 | Ga0496118_0448593 | |||
| 1224 | Ga0496126_0000063 | |||
| 1225 | Ga0496126_0084731 | |||
| 1226 | Ga0501299_091476 | |||
| 1227 | Ga0501040_1037321 | |||
| 1228 | Ga0501071_1236975 | |||
| 1229 | Ga0501073_0426836 | |||
| 1230 | Ga0501076_0191995 | |||
| 1231 | Ga0501224_062751 | |||
| 1232 | Ga0501227_092435 | |||
| 1233 | Ga0501079_0394309 | |||
| 1234 | Ga0501080_1081582 | |||
| 1235 | Ga0501045_0896072 | |||
| 1236 | nmdc:mga00v17_608643_c1 | |||
| 1237 | nmdc:mga05p37_1929409_c1 | |||
| 1238 | nmdc:mga05p37_56119_c1 | |||
| 1239 | nmdc:mga05p37_572168_c1 | |||
| 1240 | nmdc:mga05p37_934246_c1 | |||
| 1241 | nmdc:mga09592_332156_c1 | |||
| 1242 | nmdc:mga09592_360282_c1 | |||
| 1243 | nmdc:mga09592_606881_c1 | |||
| 1244 | nmdc:mga09592_65859_c1 | |||
| 1245 | nmdc:mga09592_86136_c1 | |||
| 1246 | nmdc:mga0qj67_21857_c1 | |||
| 1247 | nmdc:mga0qj67_598059_c1 | |||
| 1248 | nmdc:mga06r32_119570_c1 | |||
| 1249 | nmdc:mga06r32_1215631_c1 | |||
| 1250 | nmdc:mga06r32_232402_c1 | |||
| 1251 | nmdc:mga06r32_385991_c1 | |||
| 1252 | nmdc:mga06r32_83004_c1 | |||
| 1253 | nmdc:mga08y16_101433_c1 | |||
| 1254 | nmdc:mga08y16_276537_c1 | |||
| 1255 | nmdc:mga08y16_34708_c1 | |||
| 1256 | nmdc:mga0n895_751197_c1 | |||
| 1257 | nmdc:mga0n895_75885_c1 | |||
| 1258 | nmdc:mga08x19_368195_c1 | |||
| 1259 | Ga0495601_0118492 | |||
| 1260 | Ga0495619_0007563 | |||
| 1261 | Ga0501084_0511848 | |||
| 1262 | Ga0500661_001093 | |||
| 1263 | Ga0590071_001337 | |||
| 1264 | Ga0590074_010660 | |||
| 1265 | Ga0590075_005646 | |||
| 1266 | Ga0590077_000501 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xma-assembly1.cif.gz_B-2 | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9033 | 9 | 109 |
| 3hhh-assembly1.cif.gz_B | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.8988 | 8 | 111 |
| 1xma-assembly1.cif.gz_A | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.8944 | 10 | 109 |
| 3l7w-assembly1.cif.gz_A-2 | the crystal structure of smu.1704 from streptococcus mutans ua159 | 0.8888 | 13 | 118 |
| 5zqh-assembly1.cif.gz_A-2 | crystal structure of streptococcus transcriptional regulator | 0.8883 | 11 | 111 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71704_1_89_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8986 | 16 | 93 | 1.10.10.10 |
| af_Q57682_5_95_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8946 | 20 | 87 | 1.10.10.10 |
| 1xmaA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8944 | 10 | 109 | 1.10.10.10 |
| 5zqhA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8883 | 11 | 111 | 1.10.10.10 |
| 5y8tC01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8866 | 16 | 93 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9ZD40-F1-model_v4 | PadR family transcriptional regulator | 0.971 | 1 | 90 |
|
| AF-A0A2V8MJK6-F1-model_v4 | Transcription regulator PadR N-terminal domain-containing protein | 0.9682 | 5 | 95 |
|
| AF-A0A0D0SHF8-F1-model_v4 | Transcriptional regulator, PadR family | 0.9627 | 11 | 111 |
|
| AF-A0A1Y4NFL1-F1-model_v4 | Transcription regulator PadR N-terminal domain-containing protein | 0.9595 | 8 | 111 |
|
| AF-A0A2V9FL99-F1-model_v4 | PadR family transcriptional regulator | 0.9592 | 8 | 100 |
|