F471038

General Info

Members Datasets Scaffolds Average Seq Length
632 261 632 227

Family's Representative Sequence

Representative Sequence 3300053136|Ga0500559_0001280|Ga0500559_0001280_12624_13295
Length 223
Sequence VITRIYLIRHGATVLSAEDRFAGATEVPLSDEGRRQASSLGQRLINKPITAIFASPMGRTIETAHLVAGTHRNLEVQVRDGLREINHGRWEGMTRAEVAMAFPQEVKDWDADPYTFSPEGGESGLSVTARALPVFMEIIRHHPGEHVAVISHKATIRLLLSSLLGFDPRRYRDNLDQSPAALNILDSRGPTLNRLMLFNDISHYESDDVVTPPVATRRLSKDW

Samples

Sample ID Description Type Environment
1 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
100 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
161 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
162 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
163 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
172 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
173 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
174 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
189 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
198 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
199 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
200 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
201 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
228 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
238 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
244 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
253 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
254 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
255 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
256 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
257 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
258 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
259 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.68
Metatranscriptomes 3.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.32
Nodule 0
Rhizoplane 2.37
Rhizosphere 92.25
Stem 0
Stem Tuber 0
Unclassified 2.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000020 3300000545 Bacteria 33583
2 JGI24744J21845_10002414 3300002077 Unclassified 3813
3 JGI25406J46586_10014367 3300003203 Bacteria 3370
4 rootH2_10002220 3300003320 Bacteria 2294
5 rootH2_10004478 3300003320 Bacteria 9537
6 rootH2_10046583 3300003320 Bacteria 12898
7 rootH2_10083206 3300003320 Bacteria 2333
8 rootL2_10028108 3300003322 Bacteria 7638
9 rootL2_10029640 3300003322 Bacteria 7496
10 rootL2_10062978 3300003322 Bacteria 25289
11 rootH1_10263792 3300003323 Unclassified 1755
12 JGI25404J52841_10015660 3300003659 Unclassified 1645
13 JGI25405J52794_10007547 3300003911 Unclassified 2008
14 JGI25405J52794_10013191 3300003911 Bacteria 1599
15 Ga0065712_10213462 3300005290 Bacteria 1065
16 Ga0065715_10268209 3300005293 Bacteria 1118
17 Ga0070658_10010619 3300005327 Bacteria 7378
18 Ga0070676_10002545 3300005328 Bacteria 9374
19 Ga0070676_10080538 3300005328 Bacteria 1974
20 Ga0070676_10183353 3300005328 Unclassified 1362
21 Ga0070690_100017997 3300005330 Bacteria 4260
22 Ga0070690_100024075 3300005330 Bacteria 3742
23 Ga0070690_100029800 3300005330 Unclassified 3387
24 Ga0070690_100038332 3300005330 Bacteria 3024
25 Ga0070690_100110784 3300005330 Bacteria 1832
26 Ga0070690_100658173 3300005330 Bacteria 801
27 Ga0070670_100008244 3300005331 Bacteria 8874
28 Ga0070670_100059560 3300005331 Unclassified 3278
29 Ga0070670_100083360 3300005331 Bacteria 2747
30 Ga0070670_100252591 3300005331 Bacteria 1536
31 Ga0068869_100032605 3300005334 Unclassified 3672
32 Ga0068869_100197360 3300005334 Unclassified 1585
33 Ga0070666_10002759 3300005335 Bacteria 10614
34 Ga0070666_10065992 3300005335 Bacteria 2455
35 Ga0070666_10078025 3300005335 Bacteria 2261
36 Ga0070666_10304644 3300005335 Unclassified 1135
37 Ga0070666_10505728 3300005335 Bacteria 876
38 Ga0068868_100009713 3300005338 Bacteria 6941
39 Ga0068868_100319002 3300005338 Bacteria 1323
40 Ga0070660_100013539 3300005339 Bacteria 5853
41 Ga0070660_100066451 3300005339 Bacteria 2807
42 Ga0070689_100121130 3300005340 Bacteria 2090
43 Ga0070689_100358225 3300005340 Unclassified 1225
44 Ga0070689_100379544 3300005340 Bacteria 1191
45 Ga0070661_100003792 3300005344 Bacteria 10417
46 Ga0070692_10000251 3300005345 Bacteria 14825
47 Ga0070668_100000836 3300005347 Bacteria 21289
48 Ga0070668_100014821 3300005347 Bacteria 5826
49 Ga0070668_100019936 3300005347 Bacteria 5054
50 Ga0070668_100069743 3300005347 Bacteria 2735
51 Ga0070668_100451455 3300005347 Unclassified 1105
52 Ga0070669_100002894 3300005353 Bacteria 12373
53 Ga0070669_100008324 3300005353 Bacteria 7405
54 Ga0070675_100003444 3300005354 Bacteria 11981
55 Ga0070675_100022767 3300005354 Bacteria 5007
56 Ga0070675_100100817 3300005354 Bacteria 2432
57 Ga0070671_100001471 3300005355 Bacteria 17592
58 Ga0070671_100008133 3300005355 Bacteria 8396
59 Ga0070671_100014737 3300005355 Bacteria 6318
60 Ga0070671_100034810 3300005355 Bacteria 4171
61 Ga0070671_100135178 3300005355 Bacteria 2078
62 Ga0070671_100618960 3300005355 Bacteria 936
63 Ga0070674_100002811 3300005356 Bacteria 9630
64 Ga0070674_100122278 3300005356 Bacteria 1929
65 Ga0070674_100176804 3300005356 Bacteria 1631
66 Ga0070674_100665639 3300005356 Unclassified 886
67 Ga0070673_100021642 3300005364 Bacteria 4667
68 Ga0070673_100039083 3300005364 Bacteria 3629
69 Ga0070673_100067906 3300005364 Bacteria 2853
70 Ga0070673_100071266 3300005364 Bacteria 2792
71 Ga0070688_100011577 3300005365 Bacteria 4906
72 Ga0070688_100062851 3300005365 Bacteria 2351
73 Ga0070688_100140896 3300005365 Bacteria 1638
74 Ga0070688_100271052 3300005365 Bacteria 1216
75 Ga0070659_100011977 3300005366 Bacteria 6420
76 Ga0070667_100007673 3300005367 Bacteria 8948
77 Ga0070667_100010302 3300005367 Bacteria 7725
78 Ga0070667_100014691 3300005367 Bacteria 6467
79 Ga0070667_100175099 3300005367 Bacteria 1896
80 Ga0070709_10367770 3300005434 Unclassified 1066
81 Ga0070714_100135602 3300005435 Unclassified 2204
82 Ga0070713_100326975 3300005436 Bacteria 1417
83 Ga0070701_10152737 3300005438 Bacteria 1331
84 Ga0070701_10335037 3300005438 Bacteria 940
85 Ga0070700_100112531 3300005441 Unclassified 1812
86 Ga0070708_100206735 3300005445 Unclassified 1839
87 Ga0070708_100209563 3300005445 Unclassified 1826
88 Ga0070708_100215155 3300005445 Bacteria 1801
89 Ga0070708_100516305 3300005445 Unclassified 1127
90 Ga0070708_100551578 3300005445 Bacteria 1087
91 Ga0070708_100753791 3300005445 Unclassified 915
92 Ga0070678_100002623 3300005456 Bacteria 9887
93 Ga0070678_100086575 3300005456 Bacteria 2391
94 Ga0070678_100101567 3300005456 Bacteria 2230
95 Ga0070662_100008638 3300005457 Bacteria 6648
96 Ga0070662_100465726 3300005457 Unclassified 1051
97 Ga0070662_100585328 3300005457 Unclassified 938
98 Ga0070662_100752744 3300005457 Bacteria 826
99 Ga0068867_100035645 3300005459 Bacteria 3610
100 Ga0068867_100191220 3300005459 Bacteria 1633
101 Ga0068867_100208720 3300005459 Bacteria 1567
102 Ga0070685_10037690 3300005466 Bacteria 2739
103 Ga0070685_10180319 3300005466 Bacteria 1359
104 Ga0070685_10242942 3300005466 Unclassified 1189
105 Ga0070685_10363635 3300005466 Bacteria 992
106 Ga0070706_100000462 3300005467 Bacteria 48224
107 Ga0070706_100001662 3300005467 Bacteria 23155
108 Ga0070706_100008351 3300005467 Bacteria 9647
109 Ga0070706_100040362 3300005467 Bacteria 4308
110 Ga0070706_100214755 3300005467 Bacteria 1795
111 Ga0070706_101170542 3300005467 Unclassified 707
112 Ga0070707_100000728 3300005468 Bacteria 32782
113 Ga0070707_100069169 3300005468 Bacteria 3399
114 Ga0070707_100098352 3300005468 Bacteria 2834
115 Ga0070707_100110597 3300005468 Bacteria 2665
116 Ga0070707_100158816 3300005468 Bacteria 2202
117 Ga0070707_100159499 3300005468 Unclassified 2197
118 Ga0070707_100211044 3300005468 Bacteria 1892
119 Ga0070707_100319899 3300005468 Unclassified 1508
120 Ga0070698_100001706 3300005471 Bacteria 24505
121 Ga0070698_100013186 3300005471 Bacteria 8746
122 Ga0070698_100026402 3300005471 Bacteria 6045
123 Ga0070698_100029808 3300005471 Bacteria 5662
124 Ga0070698_100090490 3300005471 Bacteria 3043
125 Ga0070698_100207785 3300005471 Bacteria 1893
126 Ga0070698_100362291 3300005471 Unclassified 1382
127 Ga0070699_100066584 3300005518 Bacteria 3127
128 Ga0070699_100202216 3300005518 Bacteria 1767
129 Ga0070697_100004042 3300005536 Bacteria 11255
130 Ga0070697_100011674 3300005536 Bacteria 6868
131 Ga0070697_100014749 3300005536 Bacteria 6134
132 Ga0070697_100015653 3300005536 Bacteria 5956
133 Ga0070697_100036425 3300005536 Unclassified 3975
134 Ga0070697_100091863 3300005536 Bacteria 2510
135 Ga0070697_100095222 3300005536 Bacteria 2468
136 Ga0070697_100294857 3300005536 Unclassified 1393
137 Ga0070697_100320805 3300005536 Bacteria 1334
138 Ga0070697_100336171 3300005536 Bacteria 1303
139 Ga0070697_100354463 3300005536 Bacteria 1268
140 Ga0070697_100440831 3300005536 Unclassified 1133
141 Ga0068853_100000019 3300005539 Bacteria 163178
142 Ga0068853_100173445 3300005539 Unclassified 1952
143 Ga0070672_100016223 3300005543 Bacteria 5327
144 Ga0070672_100033406 3300005543 Bacteria 3896
145 Ga0070672_100039902 3300005543 Unclassified 3599
146 Ga0070672_100053547 3300005543 Bacteria 3155
147 Ga0070672_100493668 3300005543 Unclassified 1058
148 Ga0070686_100029044 3300005544 Bacteria 3359
149 Ga0070686_100119057 3300005544 Bacteria 1811
150 Ga0070686_100280561 3300005544 Unclassified 1228
151 Ga0070695_100004317 3300005545 Bacteria 8327
152 Ga0070695_100124604 3300005545 Bacteria 1768
153 Ga0070665_100000149 3300005548 Bacteria 128375
154 Ga0070665_100078522 3300005548 Bacteria 3307
155 Ga0070665_100084767 3300005548 Bacteria 3174
156 Ga0070665_100241670 3300005548 Bacteria 1806
157 Ga0070665_100590118 3300005548 Unclassified 1124
158 Ga0068855_100002454 3300005563 Bacteria 22918
159 Ga0070664_100006182 3300005564 Bacteria 9677
160 Ga0070664_100060567 3300005564 Unclassified 3224
161 Ga0070664_100202533 3300005564 Bacteria 1771
162 Ga0068857_100462146 3300005577 Bacteria 1188
163 Ga0070702_100156852 3300005615 Bacteria 1467
164 Ga0070702_100446696 3300005615 Unclassified 937
165 Ga0068852_100769966 3300005616 Unclassified 975
166 Ga0068859_100000038 3300005617 Bacteria 165071
167 Ga0068859_100002012 3300005617 Bacteria 20744
168 Ga0068859_100011947 3300005617 Bacteria 8722
169 Ga0068859_100096163 3300005617 Bacteria 3015
170 Ga0068859_101075666 3300005617 Unclassified 884
171 Ga0068864_100018025 3300005618 Bacteria 5892
172 Ga0068864_100075299 3300005618 Unclassified 2947
173 Ga0068861_100038411 3300005719 Unclassified 3565
174 Ga0068861_100295817 3300005719 Unclassified 1400
175 Ga0068863_100001041 3300005841 Bacteria 27780
176 Ga0068863_100040421 3300005841 Bacteria 4434
177 Ga0068858_100014124 3300005842 Bacteria 7532
178 Ga0068858_100027060 3300005842 Bacteria 5327
179 Ga0068858_100043959 3300005842 Bacteria 4142
180 Ga0068858_100102644 3300005842 Bacteria 2668
181 Ga0068858_100105367 3300005842 Bacteria 2631
182 Ga0068858_100153831 3300005842 Bacteria 2163
183 Ga0068858_100466773 3300005842 Unclassified 1217
184 Ga0068858_100592430 3300005842 Unclassified 1075
185 Ga0068860_100000488 3300005843 Bacteria 48969
186 Ga0068860_100033602 3300005843 Unclassified 4920
187 Ga0068860_100172766 3300005843 Bacteria 2088
188 Ga0068860_100333183 3300005843 Unclassified 1491
189 Ga0068860_100752428 3300005843 Bacteria 986
190 Ga0068862_100010875 3300005844 Bacteria 7514
191 Ga0068862_100024112 3300005844 Bacteria 5102
192 Ga0068862_100087197 3300005844 Bacteria 2715
193 Ga0081455_10006035 3300005937 Bacteria 13117
194 Ga0081455_10030553 3300005937 Bacteria 4892
195 Ga0081455_10126934 3300005937 Bacteria 2000
196 Ga0081538_10088579 3300005981 Bacteria 1610
197 Ga0081540_1002277 3300005983 Bacteria 15780
198 Ga0081540_1023881 3300005983 Unclassified 3562
199 Ga0081539_10000971 3300005985 Bacteria 53608
200 Ga0070717_10000793 3300006028 Bacteria 20762
201 Ga0070717_10008409 3300006028 Bacteria 7708
202 Ga0070717_10244434 3300006028 Unclassified 1583
203 Ga0070717_10328253 3300006028 Bacteria 1364
204 Ga0070715_10224975 3300006163 Bacteria 967
205 Ga0070716_100138642 3300006173 Bacteria 1548
206 Ga0070712_100165025 3300006175 Unclassified 1713
207 Ga0070712_100219297 3300006175 Bacteria 1505
208 Ga0070712_100380805 3300006175 Bacteria 1161
209 Ga0075362_10043915 3300006177 Bacteria 1980
210 Ga0075367_10187604 3300006178 Unclassified 1290
211 Ga0075366_10012361 3300006195 Bacteria 4841
212 Ga0075366_10180962 3300006195 Bacteria 1280
213 Ga0097621_100002691 3300006237 Bacteria 12162
214 Ga0097621_100054463 3300006237 Unclassified 3263
215 Ga0097621_100074387 3300006237 Bacteria 2814
216 Ga0097621_100092498 3300006237 Bacteria 2533
217 Ga0097621_100269133 3300006237 Bacteria 1497
218 Ga0097621_101007708 3300006237 Bacteria 779
219 Ga0068871_100014049 3300006358 Bacteria 5955
220 Ga0068871_100042774 3300006358 Unclassified 3638
221 Ga0068871_100156598 3300006358 Bacteria 1946
222 Ga0068871_100422712 3300006358 Unclassified 1190
223 Ga0068871_100546119 3300006358 Bacteria 1049
224 Ga0075431_100022731 3300006847 Bacteria 6410
225 Ga0075434_100992486 3300006871 Unclassified 854
226 Ga0068865_100073996 3300006881 Unclassified 2425
227 Ga0068865_100160251 3300006881 Unclassified 1716
228 Ga0097620_100000038 3300006931 Bacteria 165071
229 Ga0097620_100002012 3300006931 Bacteria 20744
230 Ga0097620_100011947 3300006931 Bacteria 8722
231 Ga0097620_100029867 3300006931 Bacteria 5469
232 Ga0097620_100096163 3300006931 Bacteria 3015
233 Ga0097620_101075439 3300006931 Unclassified 884
234 Ga0105240_10000550 3300009093 Bacteria 69293
235 Ga0105240_10018350 3300009093 Bacteria 9398
236 Ga0105240_10208176 3300009093 Bacteria 2287
237 Ga0111539_10003567 3300009094 Bacteria 20512
238 Ga0111539_10175676 3300009094 Bacteria 2502
239 Ga0105245_10012225 3300009098 Bacteria 7469
240 Ga0105245_10017205 3300009098 Bacteria 6307
241 Ga0105245_10314670 3300009098 Bacteria 1540
242 Ga0105247_10161478 3300009101 Bacteria 1484
243 Ga0105247_10191337 3300009101 Bacteria 1370
244 Ga0114129_11299423 3300009147 Unclassified 902
245 Ga0105243_10000049 3300009148 Bacteria 145575
246 Ga0105243_10037579 3300009148 Bacteria 3764
247 Ga0105242_10006298 3300009176 Bacteria 9142
248 Ga0105242_10093889 3300009176 Bacteria 2530
249 Ga0105248_10218675 3300009177 Bacteria 2145
250 Ga0105237_10016884 3300009545 Bacteria 7575
251 Ga0105237_10460773 3300009545 Bacteria 1277
252 Ga0105249_10424190 3300009553 Unclassified 1364
253 Ga0105249_10712175 3300009553 Bacteria 1064
254 Ga0105249_11226421 3300009553 Unclassified 821
255 Ga0105239_10023770 3300010375 Bacteria 6749
256 Ga0105239_10106245 3300010375 Unclassified 3110
257 Ga0105239_10892810 3300010375 Bacteria 1020
258 Ga0157371_10306208 3300013102 Unclassified 1151
259 Ga0157374_10000028 3300013296 Bacteria 213725
260 Ga0157374_10001798 3300013296 Bacteria 18044
261 Ga0157374_10020178 3300013296 Bacteria 5909
262 Ga0157374_10028926 3300013296 Bacteria 5010
263 Ga0157374_10046247 3300013296 Bacteria 4029
264 Ga0157374_10072924 3300013296 Unclassified 3240
265 Ga0157378_10005095 3300013297 Bacteria 11542
266 Ga0157378_10008102 3300013297 Bacteria 9170
267 Ga0157378_10044813 3300013297 Bacteria 3929
268 Ga0157378_10057599 3300013297 Bacteria 3463
269 Ga0157378_10058710 3300013297 Bacteria 3431
270 Ga0157378_10139072 3300013297 Bacteria 2254
271 Ga0157378_10147206 3300013297 Unclassified 2192
272 Ga0157378_10166322 3300013297 Bacteria 2066
273 Ga0157378_10189601 3300013297 Bacteria 1938
274 Ga0157378_10799018 3300013297 Bacteria 969
275 Ga0157378_10976266 3300013297 Bacteria 880
276 Ga0163162_10002102 3300013306 Bacteria 18695
277 Ga0163162_10023532 3300013306 Bacteria 6080
278 Ga0163162_10127752 3300013306 Unclassified 2649
279 Ga0163162_10697674 3300013306 Bacteria 1137
280 Ga0157372_10125590 3300013307 Bacteria 2950
281 Ga0157372_10150807 3300013307 Bacteria 2683
282 Ga0157372_10472634 3300013307 Bacteria 1461
283 Ga0157375_10003368 3300013308 Bacteria 13855
284 Ga0157375_10008590 3300013308 Bacteria 8943
285 Ga0157375_10041718 3300013308 Bacteria 4434
286 Ga0157375_10622198 3300013308 Unclassified 1238
287 Ga0157375_10882396 3300013308 Unclassified 1039
288 Ga0157375_11483703 3300013308 Unclassified 800
289 Ga0163163_10023264 3300014325 Bacteria 5879
290 Ga0163163_10153049 3300014325 Bacteria 2349
291 Ga0157376_10000994 3300014969 Bacteria 18490
292 Ga0157376_10024295 3300014969 Bacteria 4755
293 Ga0157376_10327800 3300014969 Bacteria 1458
294 Ga0157376_10580482 3300014969 Bacteria 1113
295 Ga0207673_1019275 3300025290 Unclassified 916
296 Ga0209050_1002359 3300025298 Bacteria 16471
297 Ga0207697_10000118 3300025315 Bacteria 37510
298 Ga0207697_10001277 3300025315 Bacteria 13811
299 Ga0207697_10003302 3300025315 Bacteria 8028
300 Ga0207697_10017742 3300025315 Bacteria 2924
301 Ga0207697_10144829 3300025315 Unclassified 1032
302 Ga0207680_10015363 3300025903 Bacteria 3995
303 Ga0207680_10051110 3300025903 Bacteria 2470
304 Ga0207680_10104097 3300025903 Bacteria 1829
305 Ga0207680_10162745 3300025903 Bacteria 1498
306 Ga0207685_10319980 3300025905 Bacteria 773
307 Ga0207645_10002506 3300025907 Bacteria 14403
308 Ga0207645_10004461 3300025907 Bacteria 10358
309 Ga0207645_10019741 3300025907 Bacteria 4415
310 Ga0207645_10178664 3300025907 Unclassified 1392
311 Ga0207643_10008021 3300025908 Bacteria 5666
312 Ga0207705_10058601 3300025909 Bacteria 2778
313 Ga0207684_10000512 3300025910 Bacteria 48238
314 Ga0207684_10001013 3300025910 Bacteria 31553
315 Ga0207684_10010625 3300025910 Bacteria 8090
316 Ga0207684_10015915 3300025910 Bacteria 6464
317 Ga0207684_10017151 3300025910 Bacteria 6215
318 Ga0207684_10060574 3300025910 Bacteria 3215
319 Ga0207695_10000644 3300025913 Bacteria 69302
320 Ga0207695_10024472 3300025913 Bacteria 6792
321 Ga0207695_10123090 3300025913 Unclassified 2559
322 Ga0207671_10021637 3300025914 Bacteria 4875
323 Ga0207693_10046005 3300025915 Bacteria 3429
324 Ga0207693_10242237 3300025915 Bacteria 1415
325 Ga0207693_10293245 3300025915 Unclassified 1275
326 Ga0207693_10326399 3300025915 Unclassified 1201
327 Ga0207693_10634625 3300025915 Unclassified 830
328 Ga0207663_10054682 3300025916 Bacteria 2501
329 Ga0207662_10005566 3300025918 Bacteria 6728
330 Ga0207657_10032943 3300025919 Bacteria 4674
331 Ga0207649_10019063 3300025920 Bacteria 3917
332 Ga0207646_10012322 3300025922 Bacteria 8223
333 Ga0207646_10015828 3300025922 Bacteria 7101
334 Ga0207646_10047918 3300025922 Bacteria 3832
335 Ga0207646_10177010 3300025922 Unclassified 1927
336 Ga0207646_10182156 3300025922 Bacteria 1897
337 Ga0207646_10358323 3300025922 Bacteria 1318
338 Ga0207646_10504663 3300025922 Unclassified 1090
339 Ga0207681_10073138 3300025923 Bacteria 2396
340 Ga0207650_10085099 3300025925 Bacteria 2405
341 Ga0207650_10176949 3300025925 Bacteria 1698
342 Ga0207650_10218693 3300025925 Bacteria 1532
343 Ga0207659_10012073 3300025926 Bacteria 5477
344 Ga0207659_10042972 3300025926 Unclassified 3171
345 Ga0207659_10072530 3300025926 Bacteria 2517
346 Ga0207659_10158838 3300025926 Bacteria 1773
347 Ga0207659_10226522 3300025926 Bacteria 1506
348 Ga0207687_10517146 3300025927 Bacteria 998
349 Ga0207700_10454177 3300025928 Bacteria 1130
350 Ga0207664_10242631 3300025929 Bacteria 1570
351 Ga0207644_10003472 3300025931 Bacteria 10187
352 Ga0207644_10012842 3300025931 Bacteria 5571
353 Ga0207644_10132992 3300025931 Bacteria 1907
354 Ga0207644_10213990 3300025931 Bacteria 1525
355 Ga0207644_10370186 3300025931 Bacteria 1167
356 Ga0207690_10031801 3300025932 Bacteria 3381
357 Ga0207706_10001810 3300025933 Bacteria 20994
358 Ga0207706_10283195 3300025933 Bacteria 1445
359 Ga0207686_10058724 3300025934 Bacteria 2426
360 Ga0207686_10113499 3300025934 Bacteria 1832
361 Ga0207686_10181648 3300025934 Bacteria 1492
362 Ga0207709_10000097 3300025935 Bacteria 136507
363 Ga0207709_10033841 3300025935 Bacteria 3006
364 Ga0207670_10009592 3300025936 Bacteria 5531
365 Ga0207670_10079767 3300025936 Bacteria 2286
366 Ga0207670_10085737 3300025936 Bacteria 2214
367 Ga0207704_10158282 3300025938 Bacteria 1608
368 Ga0207665_10000279 3300025939 Bacteria 35535
369 Ga0207665_10132188 3300025939 Unclassified 1773
370 Ga0207665_10534040 3300025939 Unclassified 910
371 Ga0207691_10000359 3300025940 Bacteria 46053
372 Ga0207691_10043986 3300025940 Bacteria 4113
373 Ga0207691_10058924 3300025940 Bacteria 3493
374 Ga0207691_10758619 3300025940 Unclassified 817
375 Ga0207689_10005280 3300025942 Bacteria 11579
376 Ga0207661_10590958 3300025944 Bacteria 1019
377 Ga0207679_10000726 3300025945 Bacteria 21877
378 Ga0207679_10171966 3300025945 Bacteria 1784
379 Ga0207679_10411883 3300025945 Bacteria 1191
380 Ga0207667_10001763 3300025949 Bacteria 27229
381 Ga0207651_10023014 3300025960 Bacteria 3823
382 Ga0207651_10042485 3300025960 Bacteria 3026
383 Ga0207651_10051902 3300025960 Bacteria 2793
384 Ga0207651_10053019 3300025960 Bacteria 2769
385 Ga0207651_10287735 3300025960 Unclassified 1361
386 Ga0207712_10016002 3300025961 Bacteria 4848
387 Ga0207712_10079511 3300025961 Bacteria 2382
388 Ga0207668_10001824 3300025972 Bacteria 12434
389 Ga0207668_10488251 3300025972 Bacteria 1057
390 Ga0207658_10015807 3300025986 Bacteria 5181
391 Ga0207658_10023292 3300025986 Bacteria 4321
392 Ga0207658_10121627 3300025986 Bacteria 2082
393 Ga0207677_10056480 3300026023 Bacteria 2690
394 Ga0207677_10090110 3300026023 Bacteria 2228
395 Ga0207677_10091314 3300026023 Bacteria 2215
396 Ga0207677_10336993 3300026023 Bacteria 1259
397 Ga0207703_10011901 3300026035 Bacteria 6775
398 Ga0207703_10208521 3300026035 Bacteria 1741
399 Ga0207703_10288213 3300026035 Bacteria 1493
400 Ga0207703_10363919 3300026035 Unclassified 1334
401 Ga0207639_10000032 3300026041 Bacteria 163200
402 Ga0207708_10047233 3300026075 Bacteria 3278
403 Ga0207708_10123132 3300026075 Bacteria 2022
404 Ga0207641_10003812 3300026088 Bacteria 13218
405 Ga0207641_10438734 3300026088 Unclassified 1260
406 Ga0207648_10002123 3300026089 Bacteria 21568
407 Ga0207648_10050196 3300026089 Bacteria 3649
408 Ga0207648_10134627 3300026089 Bacteria 2176
409 Ga0207648_10590316 3300026089 Unclassified 1023
410 Ga0207648_10714537 3300026089 Bacteria 929
411 Ga0207676_10055323 3300026095 Bacteria 3115
412 Ga0207674_10421850 3300026116 Bacteria 1289
413 Ga0207675_100057606 3300026118 Bacteria 3626
414 Ga0207675_100124915 3300026118 Bacteria 2437
415 Ga0207675_100224558 3300026118 Bacteria 1810
416 Ga0207683_10001130 3300026121 Bacteria 24282
417 Ga0207683_10026280 3300026121 Bacteria 5025
418 Ga0207683_10234296 3300026121 Bacteria 1674
419 Ga0207428_10546861 3300027907 Bacteria 838
420 Ga0268266_10000157 3300028379 Bacteria 128419
421 Ga0268266_10002775 3300028379 Bacteria 18285
422 Ga0268266_10035345 3300028379 Bacteria 4250
423 Ga0268266_10150272 3300028379 Bacteria 2098
424 Ga0268266_10215085 3300028379 Bacteria 1764
425 Ga0268266_10332437 3300028379 Bacteria 1424
426 Ga0268266_10479960 3300028379 Unclassified 1185
427 Ga0268265_10039102 3300028380 Bacteria 3494
428 Ga0268265_10982271 3300028380 Bacteria 833
429 Ga0268264_10000730 3300028381 Bacteria 37595
430 Ga0268264_10295838 3300028381 Unclassified 1522
431 Ga0307511_10002085 3300030521 Bacteria 20944
432 Ga0265325_10009202 3300031241 Bacteria 5783
433 Ga0265327_10000878 3300031251 Bacteria 44430
434 Ga0265316_10033091 3300031344 Bacteria 4214
435 Ga0307513_10164379 3300031456 Unclassified 2106
436 Ga0307408_100000021 3300031548 Bacteria 312158
437 Ga0307408_100001793 3300031548 Bacteria 15669
438 Ga0307508_10039241 3300031616 Bacteria 4255
439 Ga0316579_10003862 3300031691 Bacteria 5904
440 Ga0316579_10017919 3300031691 Bacteria 3112
441 Ga0316579_10127077 3300031691 Bacteria 1227
442 Ga0316576_10006878 3300031727 Bacteria 7111
443 Ga0316576_10009889 3300031727 Bacteria 6174
444 Ga0316576_10018123 3300031727 Bacteria 4800
445 Ga0316576_10020426 3300031727 Bacteria 4558
446 Ga0316576_10043537 3300031727 Bacteria 3239
447 Ga0316576_10046299 3300031727 Bacteria 3147
448 Ga0316576_10068594 3300031727 Bacteria 2613
449 Ga0316576_10094993 3300031727 Bacteria 2223
450 Ga0316576_10099102 3300031727 Bacteria 2176
451 Ga0316576_10140818 3300031727 Unclassified 1816
452 Ga0316576_10178368 3300031727 Bacteria 1602
453 Ga0316578_10012145 3300031728 Bacteria 4534
454 Ga0316578_10021019 3300031728 Bacteria 3617
455 Ga0316578_10075493 3300031728 Bacteria 2000
456 Ga0316578_10088721 3300031728 Bacteria 1845
457 Ga0316578_10131411 3300031728 Bacteria 1506
458 Ga0316578_10146869 3300031728 Bacteria 1420
459 Ga0316578_10165763 3300031728 Bacteria 1332
460 Ga0316577_10017218 3300031733 Bacteria 3988
461 Ga0316577_10032187 3300031733 Bacteria 2929
462 Ga0316577_10039732 3300031733 Bacteria 2632
463 Ga0316577_10065333 3300031733 Bacteria 2031
464 Ga0316577_10084711 3300031733 Unclassified 1773
465 Ga0316577_10185269 3300031733 Bacteria 1176
466 Ga0316577_10369066 3300031733 Bacteria 815
467 Ga0307406_10000117 3300031901 Bacteria 46339
468 Ga0307407_10000218 3300031903 Bacteria 17226
469 Ga0307412_10000127 3300031911 Bacteria 56113
470 Ga0307412_10390961 3300031911 Unclassified 1129
471 Ga0307409_100001120 3300031995 Bacteria 12697
472 Ga0307416_100020725 3300032002 Bacteria 4699
473 Ga0307414_10000015 3300032004 Bacteria 268602
474 Ga0307414_10281790 3300032004 Bacteria 1397
475 Ga0307414_10318589 3300032004 Bacteria 1322
476 Ga0307415_100275351 3300032126 Bacteria 1381
477 Ga0316583_10002435 3300032133 Bacteria 6451
478 Ga0316583_10003086 3300032133 Bacteria 5855
479 Ga0316583_10040772 3300032133 Unclassified 1644
480 Ga0316583_10054457 3300032133 Bacteria 1407
481 Ga0316585_10003810 3300032137 Bacteria 4168
482 Ga0316585_10089526 3300032137 Bacteria 1005
483 Ga0316580_10000952 3300032139 Bacteria 7194
484 Ga0316580_10005501 3300032139 Bacteria 3702
485 Ga0316580_10010511 3300032139 Bacteria 2799
486 Ga0316580_10013604 3300032139 Unclassified 2480
487 Ga0316593_10016513 3300032168 Unclassified 2239
488 Ga0316593_10023454 3300032168 Bacteria 1947
489 Ga0316593_10035616 3300032168 Bacteria 1638
490 Ga0316593_10058452 3300032168 Bacteria 1315
491 Ga0316593_10070412 3300032168 Bacteria 1209
492 Ga0316593_10148033 3300032168 Bacteria 853
493 Ga0316592_1000854 3300033524 Unclassified 4599
494 Ga0316592_1001529 3300033524 Bacteria 3753
495 Ga0316592_1007953 3300033524 Bacteria 2082
496 Ga0316592_1027887 3300033524 Bacteria 1222
497 Ga0316586_1001462 3300033527 Unclassified 2719
498 Ga0316586_1024949 3300033527 Bacteria 1005
499 Ga0316588_1002069 3300033528 Unclassified 3436
500 Ga0316588_1010251 3300033528 Bacteria 1971
501 Ga0316588_1017618 3300033528 Bacteria 1593
502 Ga0316588_1019482 3300033528 Bacteria 1528
503 Ga0316587_1002217 3300033529 Unclassified 2561
504 Ga0316587_1031560 3300033529 Bacteria 937
505 Ga0316596_1010783 3300033541 Bacteria 2221
506 Ga0316596_1017416 3300033541 Bacteria 1806
507 Ga0316596_1026339 3300033541 Bacteria 1499
508 Ga0373943_0245608 3300035170 Bacteria 1004
509 Ga0373946_0252225 3300035171 Bacteria 861
510 Ga0373955_0012899 3300035172 Bacteria 4029
511 Ga0316574_0014773 3300035398 Bacteria 4519
512 Ga0316574_0016875 3300035398 Bacteria 4262
513 Ga0316574_0037555 3300035398 Bacteria 2971
514 Ga0316574_0057990 3300035398 Unclassified 2425
515 Ga0316574_0064910 3300035398 Bacteria 2298
516 Ga0373935_0043668 3300035692 Unclassified 2822
517 Ga0373935_0074285 3300035692 Bacteria 2198
518 Ga0373927_0226649 3300035695 Bacteria 1228
519 Ga0373947_0021763 3300035725 Unclassified 3714
520 Ga0373937_0074152 3300036401 Bacteria 3140
521 Ga0373937_0174964 3300036401 Bacteria 2015
522 Ga0373937_0409540 3300036401 Bacteria 1286
523 Ga0373937_0542395 3300036401 Bacteria 1105
524 Ga0316582_0001255 3300036647 Bacteria 10953
525 Ga0316582_0032516 3300036647 Bacteria 3197
526 Ga0316582_0149459 3300036647 Bacteria 1578
527 Ga0316584_0015370 3300036712 Bacteria 5473
528 Ga0316584_0030621 3300036712 Bacteria 3974
529 Ga0316584_0035083 3300036712 Bacteria 3720
530 Ga0316584_0036350 3300036712 Bacteria 3654
531 Ga0316584_0130623 3300036712 Bacteria 1876
532 Ga0316584_0184782 3300036712 Bacteria 1542
533 Ga0316584_0384415 3300036712 Bacteria 1002
534 Ga0373925_0370601 3300037068 Unclassified 1165
535 Ga0395899_0157168 3300037312 Bacteria 1608
536 Ga0395900_0005116 3300037418 Bacteria 13770
537 Ga0395900_0170690 3300037418 Bacteria 2215
538 Ga0395898_0005956 3300037466 Bacteria 13088
539 Ga0395905_0088257 3300037471 Bacteria 2907
540 Ga0395905_0226432 3300037471 Unclassified 1749
541 Ga0395901_0001211 3300038443 Bacteria 27435
542 Ga0436365_0155704 3300039437 Bacteria 7574
543 Ga0439453_0002049 3300041408 Bacteria 2718
544 Ga0450890_000103 3300042127 Bacteria 14138
545 Ga0450891_000326 3300042129 Bacteria 4877
546 Ga0450889_013135 3300042144 Unclassified 874
547 Ga0450893_0000014 3300042532 Bacteria 17445
548 Ga0451576_0000140 3300045051 Bacteria 183279
549 Ga0451576_0022372 3300045051 Bacteria 6855
550 Ga0451576_0039281 3300045051 Bacteria 5009
551 Ga0495629_0129293 3300046459 Unclassified 1759
552 Ga0495651_0003824 3300046462 Bacteria 11512
553 Ga0495580_0103449 3300046472 Bacteria 1979
554 Ga0495639_0013137 3300046475 Bacteria 3572
555 Ga0495639_0127273 3300046475 Bacteria 1218
556 Ga0495639_0245805 3300046475 Unclassified 884
557 Ga0495594_0078938 3300046499 Unclassified 1837
558 Ga0495630_0062676 3300046517 Bacteria 2793
559 Ga0495643_0000176 3300046522 Bacteria 102034
560 Ga0495652_0007139 3300046529 Bacteria 10306
561 Ga0495587_0168178 3300046536 Bacteria 1246
562 Ga0495645_0128687 3300046543 Unclassified 1777
563 Ga0495635_0225106 3300046663 Bacteria 1268
564 Ga0495658_0043444 3300046683 Bacteria 2514
565 Ga0495680_0129895 3300047322 Bacteria 1852
566 Ga0495680_0159774 3300047322 Unclassified 1637
567 Ga0496100_0007845 3300048903 Bacteria 5925
568 Ga0496101_0095530 3300048904 Bacteria 2217
569 Ga0496104_0436756 3300048907 Unclassified 1221
570 Ga0496105_0203022 3300048908 Bacteria 1617
571 Ga0496106_0159448 3300048909 Unclassified 1784
572 Ga0496108_0062750 3300048911 Bacteria 3129
573 Ga0496109_0023561 3300048912 Bacteria 5465
574 Ga0496112_0028358 3300048915 Bacteria 5404
575 Ga0496112_0081502 3300048915 Bacteria 3200
576 Ga0496112_0098973 3300048915 Bacteria 2886
577 Ga0496113_0200955 3300048916 Bacteria 1584
578 Ga0496113_0236857 3300048916 Bacteria 1456
579 Ga0496114_0843477 3300048917 Unclassified 796
580 Ga0496115_0004254 3300048918 Bacteria 10353
581 Ga0496115_0020210 3300048918 Bacteria 5134
582 Ga0496125_0322375 3300048928 Bacteria 936
583 Ga0501032_0008182 3300049569 Bacteria 7622
584 Ga0501037_0045111 3300049573 Bacteria 3236
585 Ga0501037_0269392 3300049573 Unclassified 1189
586 Ga0501038_0001708 3300049574 Bacteria 20393
587 Ga0501043_0083134 3300049579 Bacteria 2517
588 Ga0501047_0009905 3300049581 Bacteria 9010
589 Ga0501047_0049179 3300049581 Bacteria 4071
590 Ga0501047_0074388 3300049581 Bacteria 3271
591 Ga0501067_0153153 3300049583 Bacteria 1284
592 Ga0501069_0278626 3300049585 Bacteria 978
593 Ga0501070_0326627 3300049586 Bacteria 1247
594 Ga0501073_0139274 3300049589 Unclassified 1681
595 Ga0501077_0039049 3300049593 Unclassified 3023
596 Ga0501227_002158 3300049665 Bacteria 4356
597 Ga0501080_0005607 3300049742 Bacteria 11220
598 Ga0501080_0046191 3300049742 Bacteria 4056
599 Ga0501080_0302718 3300049742 Bacteria 1450
600 Ga0501083_0016819 3300049744 Bacteria 5110
601 Ga0501035_0086999 3300049822 Bacteria 2754
602 Ga0501044_0008540 3300049823 Bacteria 11224
603 Ga0501044_0258964 3300049823 Bacteria 1678
604 nmdc:mga03683_37261_c1 3300050489 Unclassified 1981
605 nmdc:mga0k408_24895_c2 3300050493 Bacteria 1996
606 nmdc:mga0k408_337755_c1 3300050493 Unclassified 898
607 nmdc:mga0k408_60713_c1 3300050493 Bacteria 2197
608 nmdc:mga05p37_1321216_c1 3300050507 Unclassified 733
609 nmdc:mga05p37_917302_c1 3300050507 Unclassified 942
610 nmdc:mga06r32_492094_c1 3300050510 Bacteria 1204
611 nmdc:mga08y16_144897_c1 3300050511 Unclassified 2469
612 nmdc:mga08y16_25666_c1 3300050511 Bacteria 6217
613 nmdc:mga08y16_402222_c1 3300050511 Bacteria 1401
614 nmdc:mga08y16_44722_c1 3300050511 Bacteria 4640
615 nmdc:mga08y16_763614_c1 3300050511 Bacteria 962
616 nmdc:mga0rr50_274239_c1 3300050513 Unclassified 1406
617 Ga0495601_0096671 3300053077 Bacteria 1905
618 Ga0500635_0029516 3300053080 Bacteria 1761
619 Ga0495619_0092465 3300053085 Bacteria 2049
620 Ga0500643_020371 3300053087 Bacteria 2170
621 Ga0500555_000015 3300053103 Bacteria 230204
622 Ga0500595_020650 3300053119 Unclassified 2366
623 Ga0500608_179069 3300053122 Bacteria 900
624 Ga0500559_0001280 3300053136 Bacteria 14650
625 Ga0500573_0244258 3300053140 Bacteria 929
626 Ga0500616_0001787 3300053153 Bacteria 19618
627 Ga0500616_0003083 3300053153 Bacteria 13089
628 Ga0500616_0005407 3300053153 Bacteria 8668
629 Ga0500616_0195740 3300053153 Bacteria 899
630 Ga0500645_005103 3300053730 Unclassified 4899
631 Ga0501084_0255296 3300054114 Bacteria 1480
632 Ga0501082_0387791 3300060353 Bacteria 1219

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005364 Ga0070673_100021642 Ga0070673_1000216422 208
2 3300005543 Ga0070672_100053547 Ga0070672_1000535472 208
3 3300006358 Ga0068871_100422712 Ga0068871_1004227122 208
4 3300013308 Ga0157375_10882396 Ga0157375_108823962 208
5 3300025931 Ga0207644_10012842 Ga0207644_100128423 208
6 3300025960 Ga0207651_10053019 Ga0207651_100530192 208
7 3300005843 Ga0068860_100752428 Ga0068860_1007524282 209
8 3300005438 Ga0070701_10335037 Ga0070701_103350372 212
9 3300005545 Ga0070695_100004317 Ga0070695_1000043172 212
10 3300025315 Ga0207697_10144829 Ga0207697_101448292 212
11 3300005347 Ga0070668_100451455 Ga0070668_1004514551 213
12 3300005983 Ga0081540_1023881 Ga0081540_10238813 213
13 3300048912 Ga0496109_0023561 Ga0496109_0023561_560_1201 213
14 3300048915 Ga0496112_0098973 Ga0496112_0098973_1023_1706 213
15 3300048916 Ga0496113_0200955 Ga0496113_0200955_540_1181 213
16 3300048918 Ga0496115_0020210 Ga0496115_0020210_982_1623 213
17 3300005331 Ga0070670_100252591 Ga0070670_1002525911 214
18 3300005355 Ga0070671_100618960 Ga0070671_1006189602 214
19 3300005365 Ga0070688_100062851 Ga0070688_1000628512 214
20 3300005466 Ga0070685_10180319 Ga0070685_101803191 214
21 3300005617 Ga0068859_101075666 Ga0068859_1010756661 214
22 3300006931 Ga0097620_101075439 Ga0097620_1010754392 214
23 3300009553 Ga0105249_11226421 Ga0105249_112264211 214
24 3300013297 Ga0157378_10976266 Ga0157378_109762661 214
25 3300013308 Ga0157375_11483703 Ga0157375_114837031 214
26 3300025931 Ga0207644_10370186 Ga0207644_103701861 214
27 3300035171 Ga0373946_0252225 Ga0373946_0252225_20_676 214
28 3300035172 Ga0373955_0012899 Ga0373955_0012899_3247_3903 214
29 3300035692 Ga0373935_0074285 Ga0373935_0074285_97_753 214
30 3300036401 Ga0373937_0409540 Ga0373937_0409540_471_1127 214
31 3300046462 Ga0495651_0003824 Ga0495651_0003824_4766_5422 214
32 3300046517 Ga0495630_0062676 Ga0495630_0062676_2122_2778 214
33 3300046522 Ga0495643_0000176 Ga0495643_0000176_52253_52936 214
34 3300046529 Ga0495652_0007139 Ga0495652_0007139_5715_6371 214
35 3300046536 Ga0495587_0168178 Ga0495587_0168178_437_1093 214
36 3300046543 Ga0495645_0128687 Ga0495645_0128687_198_854 214
37 3300047322 Ga0495680_0159774 Ga0495680_0159774_880_1536 214
38 3300053077 Ga0495601_0096671 Ga0495601_0096671_727_1383 214
39 3300003322 rootL2_10062978 rootL2_100629785 217
40 3300003323 rootH1_10263792 rootH1_102637921 217
41 3300005330 Ga0070690_100017997 Ga0070690_1000179972 217
42 3300005335 Ga0070666_10304644 Ga0070666_103046441 217
43 3300005354 Ga0070675_100022767 Ga0070675_1000227673 217
44 3300005367 Ga0070667_100175099 Ga0070667_1001750992 217
45 3300005543 Ga0070672_100016223 Ga0070672_1000162232 217
46 3300005544 Ga0070686_100119057 Ga0070686_1001190572 217
47 3300005617 Ga0068859_100096163 Ga0068859_1000961634 217
48 3300005842 Ga0068858_100027060 Ga0068858_1000270605 217
49 3300005843 Ga0068860_100172766 Ga0068860_1001727662 217
50 3300006931 Ga0097620_100096163 Ga0097620_1000961634 217
51 3300009098 Ga0105245_10017205 Ga0105245_100172055 217
52 3300009101 Ga0105247_10191337 Ga0105247_101913372 217
53 3300009148 Ga0105243_10037579 Ga0105243_100375792 217
54 3300013297 Ga0157378_10005095 Ga0157378_100050959 217
55 3300026023 Ga0207677_10336993 Ga0207677_103369931 217
56 3300036401 Ga0373937_0174964 Ga0373937_0174964_263_967 217
57 3300005983 Ga0081540_1002277 Ga0081540_10022773 218
58 3300006175 Ga0070712_100380805 Ga0070712_1003808052 218
59 3300009553 Ga0105249_10424190 Ga0105249_104241902 218
60 3300013306 Ga0163162_10127752 Ga0163162_101277522 218
61 3300025315 Ga0207697_10003302 Ga0207697_100033022 218
62 3300025915 Ga0207693_10293245 Ga0207693_102932452 218
63 3300025916 Ga0207663_10054682 Ga0207663_100546822 218
64 3300025929 Ga0207664_10242631 Ga0207664_102426312 218
65 3300026035 Ga0207703_10011901 Ga0207703_100119015 218
66 3300026088 Ga0207641_10438734 Ga0207641_104387341 218
67 3300027907 Ga0207428_10546861 Ga0207428_105468611 218
68 3300049581 Ga0501047_0074388 Ga0501047_0074388_1543_2205 218
69 3300050511 nmdc:mga08y16_44722_c1 nmdc:mga08y16_44722_c1_990_1646 218
70 3300005340 Ga0070689_100358225 Ga0070689_1003582252 219
71 3300005364 Ga0070673_100071266 Ga0070673_1000712663 219
72 3300005441 Ga0070700_100112531 Ga0070700_1001125312 219
73 3300005457 Ga0070662_100752744 Ga0070662_1007527441 219
74 3300005466 Ga0070685_10242942 Ga0070685_102429422 219
75 3300005543 Ga0070672_100493668 Ga0070672_1004936682 219
76 3300005544 Ga0070686_100029044 Ga0070686_1000290445 219
77 3300005544 Ga0070686_100280561 Ga0070686_1002805612 219
78 3300005617 Ga0068859_100002012 Ga0068859_1000020128 219
79 3300005617 Ga0068859_100011947 Ga0068859_1000119476 219
80 3300005719 Ga0068861_100038411 Ga0068861_1000384112 219
81 3300005719 Ga0068861_100295817 Ga0068861_1002958172 219
82 3300005842 Ga0068858_100466773 Ga0068858_1004667731 219
83 3300005843 Ga0068860_100333183 Ga0068860_1003331832 219
84 3300006195 Ga0075366_10012361 Ga0075366_100123616 219
85 3300006931 Ga0097620_100002012 Ga0097620_1000020128 219
86 3300006931 Ga0097620_100011947 Ga0097620_1000119476 219
87 3300006931 Ga0097620_100029867 Ga0097620_1000298676 219
88 3300009553 Ga0105249_10712175 Ga0105249_107121752 219
89 3300013308 Ga0157375_10041718 Ga0157375_100417183 219
90 3300025940 Ga0207691_10758619 Ga0207691_107586191 219
91 3300025960 Ga0207651_10287735 Ga0207651_102877353 219
92 3300026075 Ga0207708_10123132 Ga0207708_101231323 219
93 3300026095 Ga0207676_10055323 Ga0207676_100553233 219
94 3300026116 Ga0207674_10421850 Ga0207674_104218502 219
95 3300026118 Ga0207675_100057606 Ga0207675_1000576062 219
96 3300028381 Ga0268264_10295838 Ga0268264_102958381 219
97 3300031616 Ga0307508_10039241 Ga0307508_100392413 219
98 3300031727 Ga0316576_10178368 Ga0316576_101783681 219
99 3300035398 Ga0316574_0014773 Ga0316574_0014773_322_990 219
100 3300036401 Ga0373937_0074152 Ga0373937_0074152_2113_2772 219
101 3300036712 Ga0316584_0384415 Ga0316584_0384415_292_960 219
102 3300046459 Ga0495629_0129293 Ga0495629_0129293_852_1511 219
103 3300046475 Ga0495639_0013137 Ga0495639_0013137_2474_3133 219
104 3300046499 Ga0495594_0078938 Ga0495594_0078938_277_936 219
105 3300046663 Ga0495635_0225106 Ga0495635_0225106_489_1148 219
106 3300046683 Ga0495658_0043444 Ga0495658_0043444_383_1042 219
107 3300047322 Ga0495680_0129895 Ga0495680_0129895_115_774 219
108 3300050493 nmdc:mga0k408_24895_c2 nmdc:mga0k408_24895_c2_284_943 219
109 3300050511 nmdc:mga08y16_144897_c1 nmdc:mga08y16_144897_c1_1651_2310 219
110 3300053080 Ga0500635_0029516 Ga0500635_0029516_390_1049 219
111 3300053085 Ga0495619_0092465 Ga0495619_0092465_916_1575 219
112 3300005536 Ga0070697_100091863 Ga0070697_1000918632 220
113 3300005536 Ga0070697_100336171 Ga0070697_1003361712 220
114 3300005548 Ga0070665_100241670 Ga0070665_1002416702 220
115 3300005842 Ga0068858_100592430 Ga0068858_1005924302 220
116 3300006028 Ga0070717_10000793 Ga0070717_1000079325 220
117 3300006175 Ga0070712_100165025 Ga0070712_1001650252 220
118 3300025915 Ga0207693_10326399 Ga0207693_103263992 220
119 3300025922 Ga0207646_10504663 Ga0207646_105046632 220
120 3300026035 Ga0207703_10363919 Ga0207703_103639192 220
121 3300028379 Ga0268266_10332437 Ga0268266_103324372 220
122 3300031728 Ga0316578_10146869 Ga0316578_101468691 220
123 3300031733 Ga0316577_10084711 Ga0316577_100847113 220
124 3300032133 Ga0316583_10054457 Ga0316583_100544571 220
125 3300032168 Ga0316593_10016513 Ga0316593_100165132 220
126 3300032168 Ga0316593_10070412 Ga0316593_100704122 220
127 3300032168 Ga0316593_10148033 Ga0316593_101480331 220
128 3300033524 Ga0316592_1000854 Ga0316592_10008544 220
129 3300033527 Ga0316586_1001462 Ga0316586_10014623 220
130 3300033527 Ga0316586_1024949 Ga0316586_10249491 220
131 3300033528 Ga0316588_1002069 Ga0316588_10020692 220
132 3300033528 Ga0316588_1019482 Ga0316588_10194822 220
133 3300033529 Ga0316587_1002217 Ga0316587_10022172 220
134 3300033529 Ga0316587_1031560 Ga0316587_10315601 220
135 3300033541 Ga0316596_1026339 Ga0316596_10263392 220
136 3300035398 Ga0316574_0057990 Ga0316574_0057990_1627_2298 220
137 3300036712 Ga0316584_0130623 Ga0316584_0130623_1195_1866 220
138 3300036712 Ga0316584_0184782 Ga0316584_0184782_571_1242 220
139 3300045051 Ga0451576_0000140 Ga0451576_0000140_138353_139024 220
140 3300049589 Ga0501073_0139274 Ga0501073_0139274_186_851 220
141 3300049593 Ga0501077_0039049 Ga0501077_0039049_38_703 220
142 3300054114 Ga0501084_0255296 Ga0501084_0255296_800_1465 220
143 3300060353 Ga0501082_0387791 Ga0501082_0387791_176_841 220
144 3300005356 Ga0070674_100665639 Ga0070674_1006656391 221
145 3300005467 Ga0070706_100000462 Ga0070706_10000046219 221
146 3300005467 Ga0070706_100040362 Ga0070706_1000403623 221
147 3300005467 Ga0070706_101170542 Ga0070706_1011705421 221
148 3300005468 Ga0070707_100110597 Ga0070707_1001105972 221
149 3300005468 Ga0070707_100211044 Ga0070707_1002110442 221
150 3300005471 Ga0070698_100001706 Ga0070698_10000170626 221
151 3300005536 Ga0070697_100440831 Ga0070697_1004408312 221
152 3300006028 Ga0070717_10328253 Ga0070717_103282532 221
153 3300009098 Ga0105245_10012225 Ga0105245_100122254 221
154 3300025910 Ga0207684_10000512 Ga0207684_1000051220 221
155 3300025915 Ga0207693_10634625 Ga0207693_106346251 221
156 3300025922 Ga0207646_10047918 Ga0207646_100479184 221
157 3300025939 Ga0207665_10534040 Ga0207665_105340401 221
158 3300031691 Ga0316579_10003862 Ga0316579_100038623 221
159 3300031691 Ga0316579_10017919 Ga0316579_100179193 221
160 3300031727 Ga0316576_10006878 Ga0316576_100068783 221
161 3300031727 Ga0316576_10018123 Ga0316576_100181233 221
162 3300031727 Ga0316576_10020426 Ga0316576_100204261 221
163 3300031727 Ga0316576_10043537 Ga0316576_100435373 221
164 3300031727 Ga0316576_10046299 Ga0316576_100462994 221
165 3300031727 Ga0316576_10094993 Ga0316576_100949931 221
166 3300031727 Ga0316576_10099102 Ga0316576_100991023 221
167 3300031727 Ga0316576_10140818 Ga0316576_101408181 221
168 3300031728 Ga0316578_10012145 Ga0316578_100121453 221
169 3300031728 Ga0316578_10021019 Ga0316578_100210193 221
170 3300031728 Ga0316578_10075493 Ga0316578_100754933 221
171 3300031728 Ga0316578_10088721 Ga0316578_100887212 221
172 3300031728 Ga0316578_10131411 Ga0316578_101314111 221
173 3300031728 Ga0316578_10165763 Ga0316578_101657631 221
174 3300031733 Ga0316577_10017218 Ga0316577_100172183 221
175 3300031733 Ga0316577_10032187 Ga0316577_100321873 221
176 3300031733 Ga0316577_10039732 Ga0316577_100397322 221
177 3300031733 Ga0316577_10185269 Ga0316577_101852692 221
178 3300031733 Ga0316577_10369066 Ga0316577_103690661 221
179 3300032133 Ga0316583_10003086 Ga0316583_100030863 221
180 3300032133 Ga0316583_10040772 Ga0316583_100407722 221
181 3300032137 Ga0316585_10003810 Ga0316585_100038103 221
182 3300032137 Ga0316585_10089526 Ga0316585_100895261 221
183 3300032139 Ga0316580_10000952 Ga0316580_100009526 221
184 3300032139 Ga0316580_10005501 Ga0316580_100055013 221
185 3300032139 Ga0316580_10010511 Ga0316580_100105111 221
186 3300032168 Ga0316593_10023454 Ga0316593_100234542 221
187 3300032168 Ga0316593_10035616 Ga0316593_100356161 221
188 3300032168 Ga0316593_10058452 Ga0316593_100584523 221
189 3300033524 Ga0316592_1001529 Ga0316592_10015293 221
190 3300033524 Ga0316592_1007953 Ga0316592_10079532 221
191 3300033524 Ga0316592_1027887 Ga0316592_10278872 221
192 3300033528 Ga0316588_1010251 Ga0316588_10102511 221
193 3300033528 Ga0316588_1017618 Ga0316588_10176182 221
194 3300033541 Ga0316596_1010783 Ga0316596_10107833 221
195 3300033541 Ga0316596_1017416 Ga0316596_10174162 221
196 3300035398 Ga0316574_0016875 Ga0316574_0016875_1663_2337 221
197 3300035398 Ga0316574_0064910 Ga0316574_0064910_1071_1745 221
198 3300036647 Ga0316582_0001255 Ga0316582_0001255_1794_2468 221
199 3300036647 Ga0316582_0149459 Ga0316582_0149459_645_1319 221
200 3300036712 Ga0316584_0015370 Ga0316584_0015370_72_746 221
201 3300036712 Ga0316584_0030621 Ga0316584_0030621_2015_2689 221
202 3300036712 Ga0316584_0035083 Ga0316584_0035083_1804_2478 221
203 3300036712 Ga0316584_0036350 Ga0316584_0036350_785_1459 221
204 3300046472 Ga0495580_0103449 Ga0495580_0103449_806_1483 221
205 3300046475 Ga0495639_0127273 Ga0495639_0127273_262_939 221
206 3300005334 Ga0068869_100032605 Ga0068869_1000326052 222
207 3300005338 Ga0068868_100009713 Ga0068868_1000097134 222
208 3300005339 Ga0070660_100013539 Ga0070660_1000135394 222
209 3300005340 Ga0070689_100379544 Ga0070689_1003795442 222
210 3300005345 Ga0070692_10000251 Ga0070692_1000025110 222
211 3300005354 Ga0070675_100003444 Ga0070675_1000034449 222
212 3300005356 Ga0070674_100122278 Ga0070674_1001222782 222
213 3300005365 Ga0070688_100140896 Ga0070688_1001408963 222
214 3300005366 Ga0070659_100011977 Ga0070659_1000119773 222
215 3300005367 Ga0070667_100014691 Ga0070667_1000146913 222
216 3300005438 Ga0070701_10152737 Ga0070701_101527372 222
217 3300005445 Ga0070708_100209563 Ga0070708_1002095632 222
218 3300005445 Ga0070708_100516305 Ga0070708_1005163051 222
219 3300005445 Ga0070708_100753791 Ga0070708_1007537911 222
220 3300005459 Ga0068867_100191220 Ga0068867_1001912202 222
221 3300005459 Ga0068867_100208720 Ga0068867_1002087202 222
222 3300005468 Ga0070707_100069169 Ga0070707_1000691692 222
223 3300005468 Ga0070707_100098352 Ga0070707_1000983522 222
224 3300005468 Ga0070707_100158816 Ga0070707_1001588162 222
225 3300005471 Ga0070698_100090490 Ga0070698_1000904903 222
226 3300005518 Ga0070699_100202216 Ga0070699_1002022162 222
227 3300005536 Ga0070697_100004042 Ga0070697_1000040428 222
228 3300005536 Ga0070697_100014749 Ga0070697_1000147494 222
229 3300005536 Ga0070697_100354463 Ga0070697_1003544632 222
230 3300005545 Ga0070695_100124604 Ga0070695_1001246042 222
231 3300005615 Ga0070702_100156852 Ga0070702_1001568522 222
232 3300005615 Ga0070702_100446696 Ga0070702_1004466961 222
233 3300005616 Ga0068852_100769966 Ga0068852_1007699662 222
234 3300005842 Ga0068858_100014124 Ga0068858_1000141242 222
235 3300005843 Ga0068860_100033602 Ga0068860_1000336022 222
236 3300005844 Ga0068862_100010875 Ga0068862_1000108759 222
237 3300006028 Ga0070717_10244434 Ga0070717_102444342 222
238 3300009176 Ga0105242_10093889 Ga0105242_100938892 222
239 3300013307 Ga0157372_10125590 Ga0157372_101255903 222
240 3300025907 Ga0207645_10019741 Ga0207645_100197412 222
241 3300025908 Ga0207643_10008021 Ga0207643_100080213 222
242 3300025918 Ga0207662_10005566 Ga0207662_100055662 222
243 3300025923 Ga0207681_10073138 Ga0207681_100731382 222
244 3300025926 Ga0207659_10158838 Ga0207659_101588381 222
245 3300025932 Ga0207690_10031801 Ga0207690_100318013 222
246 3300025934 Ga0207686_10058724 Ga0207686_100587242 222
247 3300025935 Ga0207709_10033841 Ga0207709_100338413 222
248 3300025936 Ga0207670_10009592 Ga0207670_100095926 222
249 3300025938 Ga0207704_10158282 Ga0207704_101582822 222
250 3300025940 Ga0207691_10043986 Ga0207691_100439862 222
251 3300025942 Ga0207689_10005280 Ga0207689_100052804 222
252 3300025961 Ga0207712_10016002 Ga0207712_100160022 222
253 3300026023 Ga0207677_10090110 Ga0207677_100901102 222
254 3300026075 Ga0207708_10047233 Ga0207708_100472333 222
255 3300026089 Ga0207648_10714537 Ga0207648_107145372 222
256 3300026118 Ga0207675_100124915 Ga0207675_1001249153 222
257 3300026118 Ga0207675_100224558 Ga0207675_1002245582 222
258 3300031691 Ga0316579_10127077 Ga0316579_101270772 222
259 3300031727 Ga0316576_10009889 Ga0316576_100098894 222
260 3300031727 Ga0316576_10068594 Ga0316576_100685942 222
261 3300031733 Ga0316577_10065333 Ga0316577_100653334 222
262 3300032133 Ga0316583_10002435 Ga0316583_100024355 222
263 3300032139 Ga0316580_10013604 Ga0316580_100136041 222
264 3300035398 Ga0316574_0037555 Ga0316574_0037555_1489_2166 222
265 3300036647 Ga0316582_0032516 Ga0316582_0032516_1311_1988 222
266 3300050513 nmdc:mga0rr50_274239_c1 nmdc:mga0rr50_274239_c1_68_736 222
267 3300053122 Ga0500608_179069 Ga0500608_179069_19_690 222
268 3300053136 Ga0500559_0001280 Ga0500559_0001280_12624_13295 222
269 3300005436 Ga0070713_100326975 Ga0070713_1003269751 223
270 3300006237 Ga0097621_100002691 Ga0097621_10000269110 223
271 3300006847 Ga0075431_100022731 Ga0075431_1000227315 223
272 3300025915 Ga0207693_10242237 Ga0207693_102422372 223
273 3300025928 Ga0207700_10454177 Ga0207700_104541772 223
274 3300031241 Ga0265325_10009202 Ga0265325_100092027 223
275 3300035692 Ga0373935_0043668 Ga0373935_0043668_1567_2292 223
276 3300035695 Ga0373927_0226649 Ga0373927_0226649_444_1169 223
277 3300037471 Ga0395905_0226432 Ga0395905_0226432_761_1444 223
278 3300046475 Ga0495639_0245805 Ga0495639_0245805_14_739 223
279 3300048903 Ga0496100_0007845 Ga0496100_0007845_1219_1890 223
280 3300048904 Ga0496101_0095530 Ga0496101_0095530_630_1301 223
281 3300048908 Ga0496105_0203022 Ga0496105_0203022_163_834 223
282 3300048909 Ga0496106_0159448 Ga0496106_0159448_993_1664 223
283 3300048918 Ga0496115_0004254 Ga0496115_0004254_5710_6381 223
284 3300049744 Ga0501083_0016819 Ga0501083_0016819_3734_4408 223
285 3300003659 JGI25404J52841_10015660 JGI25404J52841_100156602 224
286 3300003911 JGI25405J52794_10007547 JGI25405J52794_100075472 224
287 3300003911 JGI25405J52794_10013191 JGI25405J52794_100131912 224
288 3300005290 Ga0065712_10213462 Ga0065712_102134621 224
289 3300005330 Ga0070690_100024075 Ga0070690_1000240754 224
290 3300005338 Ga0068868_100319002 Ga0068868_1003190023 224
291 3300005355 Ga0070671_100034810 Ga0070671_1000348102 224
292 3300005364 Ga0070673_100067906 Ga0070673_1000679063 224
293 3300005365 Ga0070688_100271052 Ga0070688_1002710521 224
294 3300005434 Ga0070709_10367770 Ga0070709_103677701 224
295 3300005456 Ga0070678_100086575 Ga0070678_1000865751 224
296 3300005466 Ga0070685_10363635 Ga0070685_103636352 224
297 3300005467 Ga0070706_100008351 Ga0070706_1000083513 224
298 3300005471 Ga0070698_100013186 Ga0070698_1000131868 224
299 3300005548 Ga0070665_100084767 Ga0070665_1000847673 224
300 3300005617 Ga0068859_100000038 Ga0068859_10000003846 224
301 3300005618 Ga0068864_100018025 Ga0068864_1000180253 224
302 3300005841 Ga0068863_100040421 Ga0068863_1000404212 224
303 3300005842 Ga0068858_100102644 Ga0068858_1001026442 224
304 3300005937 Ga0081455_10006035 Ga0081455_100060355 224
305 3300005937 Ga0081455_10030553 Ga0081455_100305533 224
306 3300006163 Ga0070715_10224975 Ga0070715_102249752 224
307 3300006237 Ga0097621_100269133 Ga0097621_1002691333 224
308 3300006237 Ga0097621_101007708 Ga0097621_1010077081 224
309 3300006358 Ga0068871_100546119 Ga0068871_1005461191 224
310 3300006931 Ga0097620_100000038 Ga0097620_10000003846 224
311 3300009093 Ga0105240_10208176 Ga0105240_102081762 224
312 3300009094 Ga0111539_10003567 Ga0111539_1000356712 224
313 3300009101 Ga0105247_10161478 Ga0105247_101614782 224
314 3300009177 Ga0105248_10218675 Ga0105248_102186752 224
315 3300013296 Ga0157374_10046247 Ga0157374_100462473 224
316 3300013297 Ga0157378_10799018 Ga0157378_107990181 224
317 3300013306 Ga0163162_10697674 Ga0163162_106976742 224
318 3300014325 Ga0163163_10023264 Ga0163163_100232643 224
319 3300014969 Ga0157376_10024295 Ga0157376_100242954 224
320 3300025903 Ga0207680_10104097 Ga0207680_101040972 224
321 3300025905 Ga0207685_10319980 Ga0207685_103199801 224
322 3300025910 Ga0207684_10010625 Ga0207684_100106257 224
323 3300025925 Ga0207650_10218693 Ga0207650_102186932 224
324 3300025926 Ga0207659_10012073 Ga0207659_100120734 224
325 3300025931 Ga0207644_10213990 Ga0207644_102139902 224
326 3300025939 Ga0207665_10132188 Ga0207665_101321882 224
327 3300025944 Ga0207661_10590958 Ga0207661_105909581 224
328 3300025960 Ga0207651_10042485 Ga0207651_100424853 224
329 3300026023 Ga0207677_10056480 Ga0207677_100564802 224
330 3300026035 Ga0207703_10208521 Ga0207703_102085212 224
331 3300026035 Ga0207703_10288213 Ga0207703_102882132 224
332 3300026121 Ga0207683_10001130 Ga0207683_100011302 224
333 3300028379 Ga0268266_10150272 Ga0268266_101502722 224
334 3300028379 Ga0268266_10215085 Ga0268266_102150852 224
335 3300032004 Ga0307414_10318589 Ga0307414_103185892 224
336 3300037312 Ga0395899_0157168 Ga0395899_0157168_683_1366 224
337 3300037418 Ga0395900_0005116 Ga0395900_0005116_7980_8663 224
338 3300037418 Ga0395900_0170690 Ga0395900_0170690_120_803 224
339 3300037466 Ga0395898_0005956 Ga0395898_0005956_238_921 224
340 3300037471 Ga0395905_0088257 Ga0395905_0088257_2176_2859 224
341 3300038443 Ga0395901_0001211 Ga0395901_0001211_22360_23043 224
342 3300049574 Ga0501038_0001708 Ga0501038_0001708_5263_5970 224
343 3300049742 Ga0501080_0302718 Ga0501080_0302718_362_1042 224
344 3300050507 nmdc:mga05p37_917302_c1 nmdc:mga05p37_917302_c1_154_834 224
345 3300050511 nmdc:mga08y16_25666_c1 nmdc:mga08y16_25666_c1_5008_5688 224
346 3300053153 Ga0500616_0001787 Ga0500616_0001787_2588_3271 224
347 3300053153 Ga0500616_0195740 Ga0500616_0195740_63_809 224
348 3300005471 Ga0070698_100362291 Ga0070698_1003622911 225
349 3300005536 Ga0070697_100294857 Ga0070697_1002948571 225
350 3300009545 Ga0105237_10460773 Ga0105237_104607732 225
351 3300025934 Ga0207686_10181648 Ga0207686_101816482 225
352 3300030521 Ga0307511_10002085 Ga0307511_100020854 225
353 3300032004 Ga0307414_10000015 Ga0307414_10000015227 225
354 3300005355 Ga0070671_100135178 Ga0070671_1001351782 226
355 3300005445 Ga0070708_100215155 Ga0070708_1002151552 226
356 3300005467 Ga0070706_100001662 Ga0070706_10000166218 226
357 3300005467 Ga0070706_100214755 Ga0070706_1002147552 226
358 3300005468 Ga0070707_100159499 Ga0070707_1001594991 226
359 3300005468 Ga0070707_100319899 Ga0070707_1003198991 226
360 3300005471 Ga0070698_100026402 Ga0070698_1000264021 226
361 3300005471 Ga0070698_100029808 Ga0070698_1000298082 226
362 3300005536 Ga0070697_100011674 Ga0070697_1000116743 226
363 3300005536 Ga0070697_100320805 Ga0070697_1003208052 226
364 3300005981 Ga0081538_10088579 Ga0081538_100885792 226
365 3300009093 Ga0105240_10000550 Ga0105240_1000055056 226
366 3300010375 Ga0105239_10106245 Ga0105239_101062452 226
367 3300013297 Ga0157378_10166322 Ga0157378_101663222 226
368 3300013307 Ga0157372_10472634 Ga0157372_104726342 226
369 3300025910 Ga0207684_10001013 Ga0207684_1000101318 226
370 3300025913 Ga0207695_10000644 Ga0207695_1000064456 226
371 3300025922 Ga0207646_10015828 Ga0207646_100158285 226
372 3300025922 Ga0207646_10177010 Ga0207646_101770101 226
373 3300025931 Ga0207644_10132992 Ga0207644_101329922 226
374 3300037068 Ga0373925_0370601 Ga0373925_0370601_443_1138 226
375 3300045051 Ga0451576_0039281 Ga0451576_0039281_4035_4736 226
376 3300048916 Ga0496113_0236857 Ga0496113_0236857_361_1044 226
377 3300049573 Ga0501037_0269392 Ga0501037_0269392_453_1142 226
378 3300049581 Ga0501047_0009905 Ga0501047_0009905_501_1190 226
379 3300049583 Ga0501067_0153153 Ga0501067_0153153_100_783 226
380 3300049585 Ga0501069_0278626 Ga0501069_0278626_135_818 226
381 3300049823 Ga0501044_0008540 Ga0501044_0008540_6462_7151 226
382 3300053087 Ga0500643_020371 Ga0500643_020371_1257_1940 226
383 3300053103 Ga0500555_000015 Ga0500555_000015_208463_209146 226
384 3300002077 JGI24744J21845_10002414 JGI24744J21845_100024141 227
385 3300003320 rootH2_10046583 rootH2_100465838 227
386 3300003320 rootH2_10083206 rootH2_100832062 227
387 3300005328 Ga0070676_10183353 Ga0070676_101833532 227
388 3300005330 Ga0070690_100029800 Ga0070690_1000298002 227
389 3300005330 Ga0070690_100110784 Ga0070690_1001107842 227
390 3300005331 Ga0070670_100008244 Ga0070670_1000082447 227
391 3300005331 Ga0070670_100059560 Ga0070670_1000595602 227
392 3300005335 Ga0070666_10002759 Ga0070666_100027598 227
393 3300005335 Ga0070666_10065992 Ga0070666_100659921 227
394 3300005347 Ga0070668_100000836 Ga0070668_1000008365 227
395 3300005347 Ga0070668_100014821 Ga0070668_1000148214 227
396 3300005353 Ga0070669_100002894 Ga0070669_1000028946 227
397 3300005355 Ga0070671_100001471 Ga0070671_1000014719 227
398 3300005355 Ga0070671_100008133 Ga0070671_1000081334 227
399 3300005356 Ga0070674_100002811 Ga0070674_1000028118 227
400 3300005356 Ga0070674_100176804 Ga0070674_1001768042 227
401 3300005364 Ga0070673_100039083 Ga0070673_1000390834 227
402 3300005365 Ga0070688_100011577 Ga0070688_1000115772 227
403 3300005367 Ga0070667_100010302 Ga0070667_1000103024 227
404 3300005456 Ga0070678_100002623 Ga0070678_1000026232 227
405 3300005456 Ga0070678_100101567 Ga0070678_1001015672 227
406 3300005457 Ga0070662_100465726 Ga0070662_1004657261 227
407 3300005457 Ga0070662_100585328 Ga0070662_1005853281 227
408 3300005466 Ga0070685_10037690 Ga0070685_100376902 227
409 3300005471 Ga0070698_100207785 Ga0070698_1002077851 227
410 3300005536 Ga0070697_100015653 Ga0070697_1000156534 227
411 3300005543 Ga0070672_100033406 Ga0070672_1000334063 227
412 3300005548 Ga0070665_100000149 Ga0070665_10000014978 227
413 3300005548 Ga0070665_100078522 Ga0070665_1000785222 227
414 3300005564 Ga0070664_100060567 Ga0070664_1000605671 227
415 3300005564 Ga0070664_100202533 Ga0070664_1002025332 227
416 3300005618 Ga0068864_100075299 Ga0068864_1000752992 227
417 3300005841 Ga0068863_100001041 Ga0068863_1000010412 227
418 3300005842 Ga0068858_100043959 Ga0068858_1000439593 227
419 3300005842 Ga0068858_100153831 Ga0068858_1001538312 227
420 3300005844 Ga0068862_100024112 Ga0068862_1000241123 227
421 3300006175 Ga0070712_100219297 Ga0070712_1002192972 227
422 3300006237 Ga0097621_100054463 Ga0097621_1000544631 227
423 3300006358 Ga0068871_100014049 Ga0068871_1000140493 227
424 3300006358 Ga0068871_100156598 Ga0068871_1001565982 227
425 3300006881 Ga0068865_100160251 Ga0068865_1001602512 227
426 3300009093 Ga0105240_10018350 Ga0105240_100183502 227
427 3300009147 Ga0114129_11299423 Ga0114129_112994231 227
428 3300013296 Ga0157374_10001798 Ga0157374_100017989 227
429 3300013296 Ga0157374_10072924 Ga0157374_100729243 227
430 3300013297 Ga0157378_10044813 Ga0157378_100448133 227
431 3300013297 Ga0157378_10057599 Ga0157378_100575992 227
432 3300013297 Ga0157378_10058710 Ga0157378_100587103 227
433 3300013297 Ga0157378_10139072 Ga0157378_101390721 227
434 3300013306 Ga0163162_10002102 Ga0163162_1000210215 227
435 3300013308 Ga0157375_10003368 Ga0157375_100033687 227
436 3300013308 Ga0157375_10622198 Ga0157375_106221982 227
437 3300014325 Ga0163163_10153049 Ga0163163_101530493 227
438 3300014969 Ga0157376_10580482 Ga0157376_105804821 227
439 3300025290 Ga0207673_1019275 Ga0207673_10192751 227
440 3300025315 Ga0207697_10000118 Ga0207697_1000011818 227
441 3300025315 Ga0207697_10017742 Ga0207697_100177423 227
442 3300025903 Ga0207680_10015363 Ga0207680_100153632 227
443 3300025903 Ga0207680_10051110 Ga0207680_100511103 227
444 3300025907 Ga0207645_10004461 Ga0207645_100044619 227
445 3300025907 Ga0207645_10178664 Ga0207645_101786641 227
446 3300025910 Ga0207684_10060574 Ga0207684_100605743 227
447 3300025913 Ga0207695_10024472 Ga0207695_100244727 227
448 3300025915 Ga0207693_10046005 Ga0207693_100460054 227
449 3300025922 Ga0207646_10182156 Ga0207646_101821562 227
450 3300025926 Ga0207659_10072530 Ga0207659_100725302 227
451 3300025931 Ga0207644_10003472 Ga0207644_100034723 227
452 3300025933 Ga0207706_10283195 Ga0207706_102831951 227
453 3300025936 Ga0207670_10079767 Ga0207670_100797672 227
454 3300025940 Ga0207691_10000359 Ga0207691_1000035914 227
455 3300025940 Ga0207691_10058924 Ga0207691_100589242 227
456 3300025945 Ga0207679_10171966 Ga0207679_101719662 227
457 3300025945 Ga0207679_10411883 Ga0207679_104118832 227
458 3300025960 Ga0207651_10023014 Ga0207651_100230142 227
459 3300025960 Ga0207651_10051902 Ga0207651_100519024 227
460 3300025972 Ga0207668_10488251 Ga0207668_104882512 227
461 3300025986 Ga0207658_10121627 Ga0207658_101216272 227
462 3300026088 Ga0207641_10003812 Ga0207641_100038126 227
463 3300026089 Ga0207648_10002123 Ga0207648_100021237 227
464 3300026121 Ga0207683_10026280 Ga0207683_100262804 227
465 3300026121 Ga0207683_10234296 Ga0207683_102342962 227
466 3300028379 Ga0268266_10000157 Ga0268266_1000015774 227
467 3300028379 Ga0268266_10002775 Ga0268266_1000277519 227
468 3300028379 Ga0268266_10035345 Ga0268266_100353453 227
469 3300028380 Ga0268265_10039102 Ga0268265_100391023 227
470 3300035170 Ga0373943_0245608 Ga0373943_0245608_170_853 227
471 3300036401 Ga0373937_0542395 Ga0373937_0542395_174_857 227
472 3300048907 Ga0496104_0436756 Ga0496104_0436756_338_1021 227
473 3300048911 Ga0496108_0062750 Ga0496108_0062750_217_900 227
474 3300048915 Ga0496112_0081502 Ga0496112_0081502_818_1501 227
475 3300048917 Ga0496114_0843477 Ga0496114_0843477_52_735 227
476 3300049573 Ga0501037_0045111 Ga0501037_0045111_161_853 227
477 3300049579 Ga0501043_0083134 Ga0501043_0083134_731_1423 227
478 3300049581 Ga0501047_0049179 Ga0501047_0049179_1668_2360 227
479 3300049742 Ga0501080_0005607 Ga0501080_0005607_5347_6033 227
480 3300049822 Ga0501035_0086999 Ga0501035_0086999_123_815 227
481 3300049823 Ga0501044_0258964 Ga0501044_0258964_12_704 227
482 3300050493 nmdc:mga0k408_337755_c1 nmdc:mga0k408_337755_c1_160_849 227
483 3300050507 nmdc:mga05p37_1321216_c1 nmdc:mga05p37_1321216_c1_35_718 227
484 3300050511 nmdc:mga08y16_402222_c1 nmdc:mga08y16_402222_c1_702_1385 227
485 3300053119 Ga0500595_020650 Ga0500595_020650_886_1590 227
486 3300053140 Ga0500573_0244258 Ga0500573_0244258_154_858 227
487 3300053153 Ga0500616_0003083 Ga0500616_0003083_11204_11896 227
488 3300053153 Ga0500616_0005407 Ga0500616_0005407_1116_1802 227
489 3300053730 Ga0500645_005103 Ga0500645_005103_209_901 227
490 3300000545 CNXas_1000020 CNXas_100002032 228
491 3300003203 JGI25406J46586_10014367 JGI25406J46586_100143673 228
492 3300003320 rootH2_10002220 rootH2_100022201 228
493 3300003320 rootH2_10004478 rootH2_100044788 228
494 3300003322 rootL2_10028108 rootL2_100281086 228
495 3300003322 rootL2_10029640 rootL2_100296402 228
496 3300005293 Ga0065715_10268209 Ga0065715_102682092 228
497 3300005327 Ga0070658_10010619 Ga0070658_100106194 228
498 3300005328 Ga0070676_10002545 Ga0070676_100025452 228
499 3300005328 Ga0070676_10080538 Ga0070676_100805381 228
500 3300005330 Ga0070690_100038332 Ga0070690_1000383324 228
501 3300005330 Ga0070690_100658173 Ga0070690_1006581731 228
502 3300005331 Ga0070670_100083360 Ga0070670_1000833602 228
503 3300005334 Ga0068869_100197360 Ga0068869_1001973602 228
504 3300005335 Ga0070666_10078025 Ga0070666_100780252 228
505 3300005335 Ga0070666_10505728 Ga0070666_105057281 228
506 3300005339 Ga0070660_100066451 Ga0070660_1000664511 228
507 3300005340 Ga0070689_100121130 Ga0070689_1001211302 228
508 3300005344 Ga0070661_100003792 Ga0070661_1000037926 228
509 3300005347 Ga0070668_100019936 Ga0070668_1000199362 228
510 3300005347 Ga0070668_100069743 Ga0070668_1000697434 228
511 3300005353 Ga0070669_100008324 Ga0070669_1000083243 228
512 3300005354 Ga0070675_100100817 Ga0070675_1001008173 228
513 3300005355 Ga0070671_100014737 Ga0070671_1000147373 228
514 3300005367 Ga0070667_100007673 Ga0070667_1000076737 228
515 3300005435 Ga0070714_100135602 Ga0070714_1001356022 228
516 3300005445 Ga0070708_100206735 Ga0070708_1002067352 228
517 3300005445 Ga0070708_100551578 Ga0070708_1005515781 228
518 3300005457 Ga0070662_100008638 Ga0070662_1000086389 228
519 3300005459 Ga0068867_100035645 Ga0068867_1000356454 228
520 3300005468 Ga0070707_100000728 Ga0070707_1000007287 228
521 3300005518 Ga0070699_100066584 Ga0070699_1000665842 228
522 3300005536 Ga0070697_100036425 Ga0070697_1000364254 228
523 3300005536 Ga0070697_100095222 Ga0070697_1000952222 228
524 3300005539 Ga0068853_100000019 Ga0068853_10000001920 228
525 3300005539 Ga0068853_100173445 Ga0068853_1001734452 228
526 3300005543 Ga0070672_100039902 Ga0070672_1000399023 228
527 3300005548 Ga0070665_100590118 Ga0070665_1005901182 228
528 3300005563 Ga0068855_100002454 Ga0068855_10000245413 228
529 3300005564 Ga0070664_100006182 Ga0070664_1000061824 228
530 3300005577 Ga0068857_100462146 Ga0068857_1004621461 228
531 3300005842 Ga0068858_100105367 Ga0068858_1001053672 228
532 3300005843 Ga0068860_100000488 Ga0068860_10000048853 228
533 3300005844 Ga0068862_100087197 Ga0068862_1000871972 228
534 3300005937 Ga0081455_10126934 Ga0081455_101269342 228
535 3300005985 Ga0081539_10000971 Ga0081539_1000097114 228
536 3300006028 Ga0070717_10008409 Ga0070717_100084096 228
537 3300006173 Ga0070716_100138642 Ga0070716_1001386422 228
538 3300006177 Ga0075362_10043915 Ga0075362_100439152 228
539 3300006178 Ga0075367_10187604 Ga0075367_101876042 228
540 3300006195 Ga0075366_10180962 Ga0075366_101809622 228
541 3300006237 Ga0097621_100074387 Ga0097621_1000743872 228
542 3300006237 Ga0097621_100092498 Ga0097621_1000924982 228
543 3300006358 Ga0068871_100042774 Ga0068871_1000427743 228
544 3300006871 Ga0075434_100992486 Ga0075434_1009924861 228
545 3300006881 Ga0068865_100073996 Ga0068865_1000739963 228
546 3300009094 Ga0111539_10175676 Ga0111539_101756762 228
547 3300009098 Ga0105245_10314670 Ga0105245_103146702 228
548 3300009148 Ga0105243_10000049 Ga0105243_1000004962 228
549 3300009176 Ga0105242_10006298 Ga0105242_100062989 228
550 3300009545 Ga0105237_10016884 Ga0105237_100168844 228
551 3300010375 Ga0105239_10023770 Ga0105239_100237704 228
552 3300010375 Ga0105239_10892810 Ga0105239_108928101 228
553 3300013102 Ga0157371_10306208 Ga0157371_103062082 228
554 3300013296 Ga0157374_10000028 Ga0157374_1000002878 228
555 3300013296 Ga0157374_10020178 Ga0157374_100201785 228
556 3300013296 Ga0157374_10028926 Ga0157374_100289263 228
557 3300013297 Ga0157378_10008102 Ga0157378_100081028 228
558 3300013297 Ga0157378_10147206 Ga0157378_101472062 228
559 3300013297 Ga0157378_10189601 Ga0157378_101896013 228
560 3300013306 Ga0163162_10023532 Ga0163162_100235323 228
561 3300013307 Ga0157372_10150807 Ga0157372_101508073 228
562 3300013308 Ga0157375_10008590 Ga0157375_100085906 228
563 3300014969 Ga0157376_10000994 Ga0157376_1000099421 228
564 3300014969 Ga0157376_10327800 Ga0157376_103278002 228
565 3300025298 Ga0209050_1002359 Ga0209050_100235913 228
566 3300025315 Ga0207697_10001277 Ga0207697_100012774 228
567 3300025903 Ga0207680_10162745 Ga0207680_101627452 228
568 3300025907 Ga0207645_10002506 Ga0207645_100025068 228
569 3300025909 Ga0207705_10058601 Ga0207705_100586012 228
570 3300025910 Ga0207684_10015915 Ga0207684_100159152 228
571 3300025910 Ga0207684_10017151 Ga0207684_100171513 228
572 3300025913 Ga0207695_10123090 Ga0207695_101230903 228
573 3300025914 Ga0207671_10021637 Ga0207671_100216372 228
574 3300025919 Ga0207657_10032943 Ga0207657_100329433 228
575 3300025920 Ga0207649_10019063 Ga0207649_100190633 228
576 3300025922 Ga0207646_10012322 Ga0207646_100123225 228
577 3300025922 Ga0207646_10358323 Ga0207646_103583232 228
578 3300025925 Ga0207650_10085099 Ga0207650_100850992 228
579 3300025925 Ga0207650_10176949 Ga0207650_101769492 228
580 3300025926 Ga0207659_10042972 Ga0207659_100429723 228
581 3300025926 Ga0207659_10226522 Ga0207659_102265221 228
582 3300025927 Ga0207687_10517146 Ga0207687_105171462 228
583 3300025933 Ga0207706_10001810 Ga0207706_100018109 228
584 3300025934 Ga0207686_10113499 Ga0207686_101134992 228
585 3300025935 Ga0207709_10000097 Ga0207709_1000009792 228
586 3300025936 Ga0207670_10085737 Ga0207670_100857372 228
587 3300025939 Ga0207665_10000279 Ga0207665_100002792 228
588 3300025945 Ga0207679_10000726 Ga0207679_1000072620 228
589 3300025949 Ga0207667_10001763 Ga0207667_1000176313 228
590 3300025961 Ga0207712_10079511 Ga0207712_100795112 228
591 3300025972 Ga0207668_10001824 Ga0207668_100018245 228
592 3300025986 Ga0207658_10015807 Ga0207658_100158076 228
593 3300025986 Ga0207658_10023292 Ga0207658_100232922 228
594 3300026023 Ga0207677_10091314 Ga0207677_100913143 228
595 3300026041 Ga0207639_10000032 Ga0207639_1000003221 228
596 3300026089 Ga0207648_10050196 Ga0207648_100501963 228
597 3300026089 Ga0207648_10134627 Ga0207648_101346272 228
598 3300026089 Ga0207648_10590316 Ga0207648_105903162 228
599 3300028379 Ga0268266_10479960 Ga0268266_104799601 228
600 3300028380 Ga0268265_10982271 Ga0268265_109822711 228
601 3300028381 Ga0268264_10000730 Ga0268264_1000073030 228
602 3300031251 Ga0265327_10000878 Ga0265327_1000087839 228
603 3300031344 Ga0265316_10033091 Ga0265316_100330912 228
604 3300031456 Ga0307513_10164379 Ga0307513_101643792 228
605 3300031548 Ga0307408_100000021 Ga0307408_10000002133 228
606 3300031548 Ga0307408_100001793 Ga0307408_10000179312 228
607 3300031901 Ga0307406_10000117 Ga0307406_1000011718 228
608 3300031903 Ga0307407_10000218 Ga0307407_1000021821 228
609 3300031911 Ga0307412_10000127 Ga0307412_1000012734 228
610 3300031911 Ga0307412_10390961 Ga0307412_103909611 228
611 3300031995 Ga0307409_100001120 Ga0307409_10000112013 228
612 3300032002 Ga0307416_100020725 Ga0307416_1000207255 228
613 3300032004 Ga0307414_10281790 Ga0307414_102817902 228
614 3300032126 Ga0307415_100275351 Ga0307415_1002753512 228
615 3300035725 Ga0373947_0021763 Ga0373947_0021763_1212_1916 228
616 3300039437 Ga0436365_0155704 Ga0436365_0155704_5500_6216 228
617 3300041408 Ga0439453_0002049 Ga0439453_0002049_1568_2269 228
618 3300042127 Ga0450890_000103 Ga0450890_000103_11813_12514 228
619 3300042129 Ga0450891_000326 Ga0450891_000326_1284_1985 228
620 3300042144 Ga0450889_013135 Ga0450889_013135_22_723 228
621 3300042532 Ga0450893_0000014 Ga0450893_0000014_4684_5385 228
622 3300045051 Ga0451576_0022372 Ga0451576_0022372_1500_2207 228
623 3300048915 Ga0496112_0028358 Ga0496112_0028358_3942_4640 228
624 3300048928 Ga0496125_0322375 Ga0496125_0322375_138_842 228
625 3300049569 Ga0501032_0008182 Ga0501032_0008182_570_1268 228
626 3300049586 Ga0501070_0326627 Ga0501070_0326627_55_753 228
627 3300049665 Ga0501227_002158 Ga0501227_002158_1842_2531 228
628 3300049742 Ga0501080_0046191 Ga0501080_0046191_2521_3213 228
629 3300050489 nmdc:mga03683_37261_c1 nmdc:mga03683_37261_c1_564_1250 228
630 3300050493 nmdc:mga0k408_60713_c1 nmdc:mga0k408_60713_c1_1306_1992 228
631 3300050510 nmdc:mga06r32_492094_c1 nmdc:mga06r32_492094_c1_181_894 228
632 3300050511 nmdc:mga08y16_763614_c1 nmdc:mga08y16_763614_c1_197_892 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

5

201

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ebb-assembly1.cif.gz_A bacillus stearothermophilus yhfr 0.9466 3 204
4ij6-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine 0.9427 3 203
4ij5-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase from <i>hydrogenobacter thermophilus</i> tk-6 0.9398 3 203
1ebb-assembly1.cif.gz_A bacillus stearothermophilus yhfr 0.9376 3 204
4ij6-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine 0.9205 3 203
ID Description Score Start End Superfamily
af_P9WLH5_165_364_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9515 4 202 3.40.50.1240
1ebbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9466 3 204 3.40.50.1240
4ij6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9427 3 203 3.40.50.1240
af_P9WLH5_165_364_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9377 4 202 3.40.50.1240
1ebbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9376 3 204 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A838TMC7-F1-model_v4 Histidine phosphatase family protein 0.9949 3 164 GO:0005737
GO:0016791
AF-A0A2V7WJG4-F1-model_v4 Histidine phosphatase family protein 0.9935 3 202 GO:0005737
GO:0016791
AF-A0A2V5YYY0-F1-model_v4 Histidine phosphatase family protein 0.9921 2 206 GO:0016791
AF-A0A0S7X131-F1-model_v4 Alpha-ribazole phosphatase (EC 3.1.3.73) 0.9827 2 198 GO:0009236
GO:0043755
AF-A0A0K1Q737-F1-model_v4 Alpha-ribazole-5'-phosphate phosphatase 0.9821 1 220 GO:0005737
GO:0016791

Feature Viewer

pLDDT pTM Quality
92.39 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map