F471038
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 632 | 261 | 632 | 227 |
Family's Representative Sequence
| Representative Sequence | 3300053136|Ga0500559_0001280|Ga0500559_0001280_12624_13295 |
| Length | 223 |
| Sequence | VITRIYLIRHGATVLSAEDRFAGATEVPLSDEGRRQASSLGQRLINKPITAIFASPMGRTIETAHLVAGTHRNLEVQVRDGLREINHGRWEGMTRAEVAMAFPQEVKDWDADPYTFSPEGGESGLSVTARALPVFMEIIRHHPGEHVAVISHKATIRLLLSSLLGFDPRRYRDNLDQSPAALNILDSRGPTLNRLMLFNDISHYESDDVVTPPVATRRLSKDW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 154 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 155 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 156 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 157 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 158 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 159 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 160 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 161 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 162 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 163 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 164 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 165 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 166 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 170 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 171 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 172 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 173 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 174 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 179 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 180 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 184 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 186 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 189 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 192 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 193 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 194 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 195 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 196 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 197 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 198 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 199 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 200 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 201 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 202 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 203 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 219 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 220 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 221 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 224 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 225 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 226 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 227 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 228 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 239 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 244 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 245 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 251 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 253 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 254 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 255 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 256 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 257 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 258 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 259 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 260 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.68 |
| Metatranscriptomes | 3.32 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.32 |
| Nodule | 0 |
| Rhizoplane | 2.37 |
| Rhizosphere | 92.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1000020 | 3300000545 | Bacteria | 33583 |
| 2 | JGI24744J21845_10002414 | 3300002077 | Unclassified | 3813 |
| 3 | JGI25406J46586_10014367 | 3300003203 | Bacteria | 3370 |
| 4 | rootH2_10002220 | 3300003320 | Bacteria | 2294 |
| 5 | rootH2_10004478 | 3300003320 | Bacteria | 9537 |
| 6 | rootH2_10046583 | 3300003320 | Bacteria | 12898 |
| 7 | rootH2_10083206 | 3300003320 | Bacteria | 2333 |
| 8 | rootL2_10028108 | 3300003322 | Bacteria | 7638 |
| 9 | rootL2_10029640 | 3300003322 | Bacteria | 7496 |
| 10 | rootL2_10062978 | 3300003322 | Bacteria | 25289 |
| 11 | rootH1_10263792 | 3300003323 | Unclassified | 1755 |
| 12 | JGI25404J52841_10015660 | 3300003659 | Unclassified | 1645 |
| 13 | JGI25405J52794_10007547 | 3300003911 | Unclassified | 2008 |
| 14 | JGI25405J52794_10013191 | 3300003911 | Bacteria | 1599 |
| 15 | Ga0065712_10213462 | 3300005290 | Bacteria | 1065 |
| 16 | Ga0065715_10268209 | 3300005293 | Bacteria | 1118 |
| 17 | Ga0070658_10010619 | 3300005327 | Bacteria | 7378 |
| 18 | Ga0070676_10002545 | 3300005328 | Bacteria | 9374 |
| 19 | Ga0070676_10080538 | 3300005328 | Bacteria | 1974 |
| 20 | Ga0070676_10183353 | 3300005328 | Unclassified | 1362 |
| 21 | Ga0070690_100017997 | 3300005330 | Bacteria | 4260 |
| 22 | Ga0070690_100024075 | 3300005330 | Bacteria | 3742 |
| 23 | Ga0070690_100029800 | 3300005330 | Unclassified | 3387 |
| 24 | Ga0070690_100038332 | 3300005330 | Bacteria | 3024 |
| 25 | Ga0070690_100110784 | 3300005330 | Bacteria | 1832 |
| 26 | Ga0070690_100658173 | 3300005330 | Bacteria | 801 |
| 27 | Ga0070670_100008244 | 3300005331 | Bacteria | 8874 |
| 28 | Ga0070670_100059560 | 3300005331 | Unclassified | 3278 |
| 29 | Ga0070670_100083360 | 3300005331 | Bacteria | 2747 |
| 30 | Ga0070670_100252591 | 3300005331 | Bacteria | 1536 |
| 31 | Ga0068869_100032605 | 3300005334 | Unclassified | 3672 |
| 32 | Ga0068869_100197360 | 3300005334 | Unclassified | 1585 |
| 33 | Ga0070666_10002759 | 3300005335 | Bacteria | 10614 |
| 34 | Ga0070666_10065992 | 3300005335 | Bacteria | 2455 |
| 35 | Ga0070666_10078025 | 3300005335 | Bacteria | 2261 |
| 36 | Ga0070666_10304644 | 3300005335 | Unclassified | 1135 |
| 37 | Ga0070666_10505728 | 3300005335 | Bacteria | 876 |
| 38 | Ga0068868_100009713 | 3300005338 | Bacteria | 6941 |
| 39 | Ga0068868_100319002 | 3300005338 | Bacteria | 1323 |
| 40 | Ga0070660_100013539 | 3300005339 | Bacteria | 5853 |
| 41 | Ga0070660_100066451 | 3300005339 | Bacteria | 2807 |
| 42 | Ga0070689_100121130 | 3300005340 | Bacteria | 2090 |
| 43 | Ga0070689_100358225 | 3300005340 | Unclassified | 1225 |
| 44 | Ga0070689_100379544 | 3300005340 | Bacteria | 1191 |
| 45 | Ga0070661_100003792 | 3300005344 | Bacteria | 10417 |
| 46 | Ga0070692_10000251 | 3300005345 | Bacteria | 14825 |
| 47 | Ga0070668_100000836 | 3300005347 | Bacteria | 21289 |
| 48 | Ga0070668_100014821 | 3300005347 | Bacteria | 5826 |
| 49 | Ga0070668_100019936 | 3300005347 | Bacteria | 5054 |
| 50 | Ga0070668_100069743 | 3300005347 | Bacteria | 2735 |
| 51 | Ga0070668_100451455 | 3300005347 | Unclassified | 1105 |
| 52 | Ga0070669_100002894 | 3300005353 | Bacteria | 12373 |
| 53 | Ga0070669_100008324 | 3300005353 | Bacteria | 7405 |
| 54 | Ga0070675_100003444 | 3300005354 | Bacteria | 11981 |
| 55 | Ga0070675_100022767 | 3300005354 | Bacteria | 5007 |
| 56 | Ga0070675_100100817 | 3300005354 | Bacteria | 2432 |
| 57 | Ga0070671_100001471 | 3300005355 | Bacteria | 17592 |
| 58 | Ga0070671_100008133 | 3300005355 | Bacteria | 8396 |
| 59 | Ga0070671_100014737 | 3300005355 | Bacteria | 6318 |
| 60 | Ga0070671_100034810 | 3300005355 | Bacteria | 4171 |
| 61 | Ga0070671_100135178 | 3300005355 | Bacteria | 2078 |
| 62 | Ga0070671_100618960 | 3300005355 | Bacteria | 936 |
| 63 | Ga0070674_100002811 | 3300005356 | Bacteria | 9630 |
| 64 | Ga0070674_100122278 | 3300005356 | Bacteria | 1929 |
| 65 | Ga0070674_100176804 | 3300005356 | Bacteria | 1631 |
| 66 | Ga0070674_100665639 | 3300005356 | Unclassified | 886 |
| 67 | Ga0070673_100021642 | 3300005364 | Bacteria | 4667 |
| 68 | Ga0070673_100039083 | 3300005364 | Bacteria | 3629 |
| 69 | Ga0070673_100067906 | 3300005364 | Bacteria | 2853 |
| 70 | Ga0070673_100071266 | 3300005364 | Bacteria | 2792 |
| 71 | Ga0070688_100011577 | 3300005365 | Bacteria | 4906 |
| 72 | Ga0070688_100062851 | 3300005365 | Bacteria | 2351 |
| 73 | Ga0070688_100140896 | 3300005365 | Bacteria | 1638 |
| 74 | Ga0070688_100271052 | 3300005365 | Bacteria | 1216 |
| 75 | Ga0070659_100011977 | 3300005366 | Bacteria | 6420 |
| 76 | Ga0070667_100007673 | 3300005367 | Bacteria | 8948 |
| 77 | Ga0070667_100010302 | 3300005367 | Bacteria | 7725 |
| 78 | Ga0070667_100014691 | 3300005367 | Bacteria | 6467 |
| 79 | Ga0070667_100175099 | 3300005367 | Bacteria | 1896 |
| 80 | Ga0070709_10367770 | 3300005434 | Unclassified | 1066 |
| 81 | Ga0070714_100135602 | 3300005435 | Unclassified | 2204 |
| 82 | Ga0070713_100326975 | 3300005436 | Bacteria | 1417 |
| 83 | Ga0070701_10152737 | 3300005438 | Bacteria | 1331 |
| 84 | Ga0070701_10335037 | 3300005438 | Bacteria | 940 |
| 85 | Ga0070700_100112531 | 3300005441 | Unclassified | 1812 |
| 86 | Ga0070708_100206735 | 3300005445 | Unclassified | 1839 |
| 87 | Ga0070708_100209563 | 3300005445 | Unclassified | 1826 |
| 88 | Ga0070708_100215155 | 3300005445 | Bacteria | 1801 |
| 89 | Ga0070708_100516305 | 3300005445 | Unclassified | 1127 |
| 90 | Ga0070708_100551578 | 3300005445 | Bacteria | 1087 |
| 91 | Ga0070708_100753791 | 3300005445 | Unclassified | 915 |
| 92 | Ga0070678_100002623 | 3300005456 | Bacteria | 9887 |
| 93 | Ga0070678_100086575 | 3300005456 | Bacteria | 2391 |
| 94 | Ga0070678_100101567 | 3300005456 | Bacteria | 2230 |
| 95 | Ga0070662_100008638 | 3300005457 | Bacteria | 6648 |
| 96 | Ga0070662_100465726 | 3300005457 | Unclassified | 1051 |
| 97 | Ga0070662_100585328 | 3300005457 | Unclassified | 938 |
| 98 | Ga0070662_100752744 | 3300005457 | Bacteria | 826 |
| 99 | Ga0068867_100035645 | 3300005459 | Bacteria | 3610 |
| 100 | Ga0068867_100191220 | 3300005459 | Bacteria | 1633 |
| 101 | Ga0068867_100208720 | 3300005459 | Bacteria | 1567 |
| 102 | Ga0070685_10037690 | 3300005466 | Bacteria | 2739 |
| 103 | Ga0070685_10180319 | 3300005466 | Bacteria | 1359 |
| 104 | Ga0070685_10242942 | 3300005466 | Unclassified | 1189 |
| 105 | Ga0070685_10363635 | 3300005466 | Bacteria | 992 |
| 106 | Ga0070706_100000462 | 3300005467 | Bacteria | 48224 |
| 107 | Ga0070706_100001662 | 3300005467 | Bacteria | 23155 |
| 108 | Ga0070706_100008351 | 3300005467 | Bacteria | 9647 |
| 109 | Ga0070706_100040362 | 3300005467 | Bacteria | 4308 |
| 110 | Ga0070706_100214755 | 3300005467 | Bacteria | 1795 |
| 111 | Ga0070706_101170542 | 3300005467 | Unclassified | 707 |
| 112 | Ga0070707_100000728 | 3300005468 | Bacteria | 32782 |
| 113 | Ga0070707_100069169 | 3300005468 | Bacteria | 3399 |
| 114 | Ga0070707_100098352 | 3300005468 | Bacteria | 2834 |
| 115 | Ga0070707_100110597 | 3300005468 | Bacteria | 2665 |
| 116 | Ga0070707_100158816 | 3300005468 | Bacteria | 2202 |
| 117 | Ga0070707_100159499 | 3300005468 | Unclassified | 2197 |
| 118 | Ga0070707_100211044 | 3300005468 | Bacteria | 1892 |
| 119 | Ga0070707_100319899 | 3300005468 | Unclassified | 1508 |
| 120 | Ga0070698_100001706 | 3300005471 | Bacteria | 24505 |
| 121 | Ga0070698_100013186 | 3300005471 | Bacteria | 8746 |
| 122 | Ga0070698_100026402 | 3300005471 | Bacteria | 6045 |
| 123 | Ga0070698_100029808 | 3300005471 | Bacteria | 5662 |
| 124 | Ga0070698_100090490 | 3300005471 | Bacteria | 3043 |
| 125 | Ga0070698_100207785 | 3300005471 | Bacteria | 1893 |
| 126 | Ga0070698_100362291 | 3300005471 | Unclassified | 1382 |
| 127 | Ga0070699_100066584 | 3300005518 | Bacteria | 3127 |
| 128 | Ga0070699_100202216 | 3300005518 | Bacteria | 1767 |
| 129 | Ga0070697_100004042 | 3300005536 | Bacteria | 11255 |
| 130 | Ga0070697_100011674 | 3300005536 | Bacteria | 6868 |
| 131 | Ga0070697_100014749 | 3300005536 | Bacteria | 6134 |
| 132 | Ga0070697_100015653 | 3300005536 | Bacteria | 5956 |
| 133 | Ga0070697_100036425 | 3300005536 | Unclassified | 3975 |
| 134 | Ga0070697_100091863 | 3300005536 | Bacteria | 2510 |
| 135 | Ga0070697_100095222 | 3300005536 | Bacteria | 2468 |
| 136 | Ga0070697_100294857 | 3300005536 | Unclassified | 1393 |
| 137 | Ga0070697_100320805 | 3300005536 | Bacteria | 1334 |
| 138 | Ga0070697_100336171 | 3300005536 | Bacteria | 1303 |
| 139 | Ga0070697_100354463 | 3300005536 | Bacteria | 1268 |
| 140 | Ga0070697_100440831 | 3300005536 | Unclassified | 1133 |
| 141 | Ga0068853_100000019 | 3300005539 | Bacteria | 163178 |
| 142 | Ga0068853_100173445 | 3300005539 | Unclassified | 1952 |
| 143 | Ga0070672_100016223 | 3300005543 | Bacteria | 5327 |
| 144 | Ga0070672_100033406 | 3300005543 | Bacteria | 3896 |
| 145 | Ga0070672_100039902 | 3300005543 | Unclassified | 3599 |
| 146 | Ga0070672_100053547 | 3300005543 | Bacteria | 3155 |
| 147 | Ga0070672_100493668 | 3300005543 | Unclassified | 1058 |
| 148 | Ga0070686_100029044 | 3300005544 | Bacteria | 3359 |
| 149 | Ga0070686_100119057 | 3300005544 | Bacteria | 1811 |
| 150 | Ga0070686_100280561 | 3300005544 | Unclassified | 1228 |
| 151 | Ga0070695_100004317 | 3300005545 | Bacteria | 8327 |
| 152 | Ga0070695_100124604 | 3300005545 | Bacteria | 1768 |
| 153 | Ga0070665_100000149 | 3300005548 | Bacteria | 128375 |
| 154 | Ga0070665_100078522 | 3300005548 | Bacteria | 3307 |
| 155 | Ga0070665_100084767 | 3300005548 | Bacteria | 3174 |
| 156 | Ga0070665_100241670 | 3300005548 | Bacteria | 1806 |
| 157 | Ga0070665_100590118 | 3300005548 | Unclassified | 1124 |
| 158 | Ga0068855_100002454 | 3300005563 | Bacteria | 22918 |
| 159 | Ga0070664_100006182 | 3300005564 | Bacteria | 9677 |
| 160 | Ga0070664_100060567 | 3300005564 | Unclassified | 3224 |
| 161 | Ga0070664_100202533 | 3300005564 | Bacteria | 1771 |
| 162 | Ga0068857_100462146 | 3300005577 | Bacteria | 1188 |
| 163 | Ga0070702_100156852 | 3300005615 | Bacteria | 1467 |
| 164 | Ga0070702_100446696 | 3300005615 | Unclassified | 937 |
| 165 | Ga0068852_100769966 | 3300005616 | Unclassified | 975 |
| 166 | Ga0068859_100000038 | 3300005617 | Bacteria | 165071 |
| 167 | Ga0068859_100002012 | 3300005617 | Bacteria | 20744 |
| 168 | Ga0068859_100011947 | 3300005617 | Bacteria | 8722 |
| 169 | Ga0068859_100096163 | 3300005617 | Bacteria | 3015 |
| 170 | Ga0068859_101075666 | 3300005617 | Unclassified | 884 |
| 171 | Ga0068864_100018025 | 3300005618 | Bacteria | 5892 |
| 172 | Ga0068864_100075299 | 3300005618 | Unclassified | 2947 |
| 173 | Ga0068861_100038411 | 3300005719 | Unclassified | 3565 |
| 174 | Ga0068861_100295817 | 3300005719 | Unclassified | 1400 |
| 175 | Ga0068863_100001041 | 3300005841 | Bacteria | 27780 |
| 176 | Ga0068863_100040421 | 3300005841 | Bacteria | 4434 |
| 177 | Ga0068858_100014124 | 3300005842 | Bacteria | 7532 |
| 178 | Ga0068858_100027060 | 3300005842 | Bacteria | 5327 |
| 179 | Ga0068858_100043959 | 3300005842 | Bacteria | 4142 |
| 180 | Ga0068858_100102644 | 3300005842 | Bacteria | 2668 |
| 181 | Ga0068858_100105367 | 3300005842 | Bacteria | 2631 |
| 182 | Ga0068858_100153831 | 3300005842 | Bacteria | 2163 |
| 183 | Ga0068858_100466773 | 3300005842 | Unclassified | 1217 |
| 184 | Ga0068858_100592430 | 3300005842 | Unclassified | 1075 |
| 185 | Ga0068860_100000488 | 3300005843 | Bacteria | 48969 |
| 186 | Ga0068860_100033602 | 3300005843 | Unclassified | 4920 |
| 187 | Ga0068860_100172766 | 3300005843 | Bacteria | 2088 |
| 188 | Ga0068860_100333183 | 3300005843 | Unclassified | 1491 |
| 189 | Ga0068860_100752428 | 3300005843 | Bacteria | 986 |
| 190 | Ga0068862_100010875 | 3300005844 | Bacteria | 7514 |
| 191 | Ga0068862_100024112 | 3300005844 | Bacteria | 5102 |
| 192 | Ga0068862_100087197 | 3300005844 | Bacteria | 2715 |
| 193 | Ga0081455_10006035 | 3300005937 | Bacteria | 13117 |
| 194 | Ga0081455_10030553 | 3300005937 | Bacteria | 4892 |
| 195 | Ga0081455_10126934 | 3300005937 | Bacteria | 2000 |
| 196 | Ga0081538_10088579 | 3300005981 | Bacteria | 1610 |
| 197 | Ga0081540_1002277 | 3300005983 | Bacteria | 15780 |
| 198 | Ga0081540_1023881 | 3300005983 | Unclassified | 3562 |
| 199 | Ga0081539_10000971 | 3300005985 | Bacteria | 53608 |
| 200 | Ga0070717_10000793 | 3300006028 | Bacteria | 20762 |
| 201 | Ga0070717_10008409 | 3300006028 | Bacteria | 7708 |
| 202 | Ga0070717_10244434 | 3300006028 | Unclassified | 1583 |
| 203 | Ga0070717_10328253 | 3300006028 | Bacteria | 1364 |
| 204 | Ga0070715_10224975 | 3300006163 | Bacteria | 967 |
| 205 | Ga0070716_100138642 | 3300006173 | Bacteria | 1548 |
| 206 | Ga0070712_100165025 | 3300006175 | Unclassified | 1713 |
| 207 | Ga0070712_100219297 | 3300006175 | Bacteria | 1505 |
| 208 | Ga0070712_100380805 | 3300006175 | Bacteria | 1161 |
| 209 | Ga0075362_10043915 | 3300006177 | Bacteria | 1980 |
| 210 | Ga0075367_10187604 | 3300006178 | Unclassified | 1290 |
| 211 | Ga0075366_10012361 | 3300006195 | Bacteria | 4841 |
| 212 | Ga0075366_10180962 | 3300006195 | Bacteria | 1280 |
| 213 | Ga0097621_100002691 | 3300006237 | Bacteria | 12162 |
| 214 | Ga0097621_100054463 | 3300006237 | Unclassified | 3263 |
| 215 | Ga0097621_100074387 | 3300006237 | Bacteria | 2814 |
| 216 | Ga0097621_100092498 | 3300006237 | Bacteria | 2533 |
| 217 | Ga0097621_100269133 | 3300006237 | Bacteria | 1497 |
| 218 | Ga0097621_101007708 | 3300006237 | Bacteria | 779 |
| 219 | Ga0068871_100014049 | 3300006358 | Bacteria | 5955 |
| 220 | Ga0068871_100042774 | 3300006358 | Unclassified | 3638 |
| 221 | Ga0068871_100156598 | 3300006358 | Bacteria | 1946 |
| 222 | Ga0068871_100422712 | 3300006358 | Unclassified | 1190 |
| 223 | Ga0068871_100546119 | 3300006358 | Bacteria | 1049 |
| 224 | Ga0075431_100022731 | 3300006847 | Bacteria | 6410 |
| 225 | Ga0075434_100992486 | 3300006871 | Unclassified | 854 |
| 226 | Ga0068865_100073996 | 3300006881 | Unclassified | 2425 |
| 227 | Ga0068865_100160251 | 3300006881 | Unclassified | 1716 |
| 228 | Ga0097620_100000038 | 3300006931 | Bacteria | 165071 |
| 229 | Ga0097620_100002012 | 3300006931 | Bacteria | 20744 |
| 230 | Ga0097620_100011947 | 3300006931 | Bacteria | 8722 |
| 231 | Ga0097620_100029867 | 3300006931 | Bacteria | 5469 |
| 232 | Ga0097620_100096163 | 3300006931 | Bacteria | 3015 |
| 233 | Ga0097620_101075439 | 3300006931 | Unclassified | 884 |
| 234 | Ga0105240_10000550 | 3300009093 | Bacteria | 69293 |
| 235 | Ga0105240_10018350 | 3300009093 | Bacteria | 9398 |
| 236 | Ga0105240_10208176 | 3300009093 | Bacteria | 2287 |
| 237 | Ga0111539_10003567 | 3300009094 | Bacteria | 20512 |
| 238 | Ga0111539_10175676 | 3300009094 | Bacteria | 2502 |
| 239 | Ga0105245_10012225 | 3300009098 | Bacteria | 7469 |
| 240 | Ga0105245_10017205 | 3300009098 | Bacteria | 6307 |
| 241 | Ga0105245_10314670 | 3300009098 | Bacteria | 1540 |
| 242 | Ga0105247_10161478 | 3300009101 | Bacteria | 1484 |
| 243 | Ga0105247_10191337 | 3300009101 | Bacteria | 1370 |
| 244 | Ga0114129_11299423 | 3300009147 | Unclassified | 902 |
| 245 | Ga0105243_10000049 | 3300009148 | Bacteria | 145575 |
| 246 | Ga0105243_10037579 | 3300009148 | Bacteria | 3764 |
| 247 | Ga0105242_10006298 | 3300009176 | Bacteria | 9142 |
| 248 | Ga0105242_10093889 | 3300009176 | Bacteria | 2530 |
| 249 | Ga0105248_10218675 | 3300009177 | Bacteria | 2145 |
| 250 | Ga0105237_10016884 | 3300009545 | Bacteria | 7575 |
| 251 | Ga0105237_10460773 | 3300009545 | Bacteria | 1277 |
| 252 | Ga0105249_10424190 | 3300009553 | Unclassified | 1364 |
| 253 | Ga0105249_10712175 | 3300009553 | Bacteria | 1064 |
| 254 | Ga0105249_11226421 | 3300009553 | Unclassified | 821 |
| 255 | Ga0105239_10023770 | 3300010375 | Bacteria | 6749 |
| 256 | Ga0105239_10106245 | 3300010375 | Unclassified | 3110 |
| 257 | Ga0105239_10892810 | 3300010375 | Bacteria | 1020 |
| 258 | Ga0157371_10306208 | 3300013102 | Unclassified | 1151 |
| 259 | Ga0157374_10000028 | 3300013296 | Bacteria | 213725 |
| 260 | Ga0157374_10001798 | 3300013296 | Bacteria | 18044 |
| 261 | Ga0157374_10020178 | 3300013296 | Bacteria | 5909 |
| 262 | Ga0157374_10028926 | 3300013296 | Bacteria | 5010 |
| 263 | Ga0157374_10046247 | 3300013296 | Bacteria | 4029 |
| 264 | Ga0157374_10072924 | 3300013296 | Unclassified | 3240 |
| 265 | Ga0157378_10005095 | 3300013297 | Bacteria | 11542 |
| 266 | Ga0157378_10008102 | 3300013297 | Bacteria | 9170 |
| 267 | Ga0157378_10044813 | 3300013297 | Bacteria | 3929 |
| 268 | Ga0157378_10057599 | 3300013297 | Bacteria | 3463 |
| 269 | Ga0157378_10058710 | 3300013297 | Bacteria | 3431 |
| 270 | Ga0157378_10139072 | 3300013297 | Bacteria | 2254 |
| 271 | Ga0157378_10147206 | 3300013297 | Unclassified | 2192 |
| 272 | Ga0157378_10166322 | 3300013297 | Bacteria | 2066 |
| 273 | Ga0157378_10189601 | 3300013297 | Bacteria | 1938 |
| 274 | Ga0157378_10799018 | 3300013297 | Bacteria | 969 |
| 275 | Ga0157378_10976266 | 3300013297 | Bacteria | 880 |
| 276 | Ga0163162_10002102 | 3300013306 | Bacteria | 18695 |
| 277 | Ga0163162_10023532 | 3300013306 | Bacteria | 6080 |
| 278 | Ga0163162_10127752 | 3300013306 | Unclassified | 2649 |
| 279 | Ga0163162_10697674 | 3300013306 | Bacteria | 1137 |
| 280 | Ga0157372_10125590 | 3300013307 | Bacteria | 2950 |
| 281 | Ga0157372_10150807 | 3300013307 | Bacteria | 2683 |
| 282 | Ga0157372_10472634 | 3300013307 | Bacteria | 1461 |
| 283 | Ga0157375_10003368 | 3300013308 | Bacteria | 13855 |
| 284 | Ga0157375_10008590 | 3300013308 | Bacteria | 8943 |
| 285 | Ga0157375_10041718 | 3300013308 | Bacteria | 4434 |
| 286 | Ga0157375_10622198 | 3300013308 | Unclassified | 1238 |
| 287 | Ga0157375_10882396 | 3300013308 | Unclassified | 1039 |
| 288 | Ga0157375_11483703 | 3300013308 | Unclassified | 800 |
| 289 | Ga0163163_10023264 | 3300014325 | Bacteria | 5879 |
| 290 | Ga0163163_10153049 | 3300014325 | Bacteria | 2349 |
| 291 | Ga0157376_10000994 | 3300014969 | Bacteria | 18490 |
| 292 | Ga0157376_10024295 | 3300014969 | Bacteria | 4755 |
| 293 | Ga0157376_10327800 | 3300014969 | Bacteria | 1458 |
| 294 | Ga0157376_10580482 | 3300014969 | Bacteria | 1113 |
| 295 | Ga0207673_1019275 | 3300025290 | Unclassified | 916 |
| 296 | Ga0209050_1002359 | 3300025298 | Bacteria | 16471 |
| 297 | Ga0207697_10000118 | 3300025315 | Bacteria | 37510 |
| 298 | Ga0207697_10001277 | 3300025315 | Bacteria | 13811 |
| 299 | Ga0207697_10003302 | 3300025315 | Bacteria | 8028 |
| 300 | Ga0207697_10017742 | 3300025315 | Bacteria | 2924 |
| 301 | Ga0207697_10144829 | 3300025315 | Unclassified | 1032 |
| 302 | Ga0207680_10015363 | 3300025903 | Bacteria | 3995 |
| 303 | Ga0207680_10051110 | 3300025903 | Bacteria | 2470 |
| 304 | Ga0207680_10104097 | 3300025903 | Bacteria | 1829 |
| 305 | Ga0207680_10162745 | 3300025903 | Bacteria | 1498 |
| 306 | Ga0207685_10319980 | 3300025905 | Bacteria | 773 |
| 307 | Ga0207645_10002506 | 3300025907 | Bacteria | 14403 |
| 308 | Ga0207645_10004461 | 3300025907 | Bacteria | 10358 |
| 309 | Ga0207645_10019741 | 3300025907 | Bacteria | 4415 |
| 310 | Ga0207645_10178664 | 3300025907 | Unclassified | 1392 |
| 311 | Ga0207643_10008021 | 3300025908 | Bacteria | 5666 |
| 312 | Ga0207705_10058601 | 3300025909 | Bacteria | 2778 |
| 313 | Ga0207684_10000512 | 3300025910 | Bacteria | 48238 |
| 314 | Ga0207684_10001013 | 3300025910 | Bacteria | 31553 |
| 315 | Ga0207684_10010625 | 3300025910 | Bacteria | 8090 |
| 316 | Ga0207684_10015915 | 3300025910 | Bacteria | 6464 |
| 317 | Ga0207684_10017151 | 3300025910 | Bacteria | 6215 |
| 318 | Ga0207684_10060574 | 3300025910 | Bacteria | 3215 |
| 319 | Ga0207695_10000644 | 3300025913 | Bacteria | 69302 |
| 320 | Ga0207695_10024472 | 3300025913 | Bacteria | 6792 |
| 321 | Ga0207695_10123090 | 3300025913 | Unclassified | 2559 |
| 322 | Ga0207671_10021637 | 3300025914 | Bacteria | 4875 |
| 323 | Ga0207693_10046005 | 3300025915 | Bacteria | 3429 |
| 324 | Ga0207693_10242237 | 3300025915 | Bacteria | 1415 |
| 325 | Ga0207693_10293245 | 3300025915 | Unclassified | 1275 |
| 326 | Ga0207693_10326399 | 3300025915 | Unclassified | 1201 |
| 327 | Ga0207693_10634625 | 3300025915 | Unclassified | 830 |
| 328 | Ga0207663_10054682 | 3300025916 | Bacteria | 2501 |
| 329 | Ga0207662_10005566 | 3300025918 | Bacteria | 6728 |
| 330 | Ga0207657_10032943 | 3300025919 | Bacteria | 4674 |
| 331 | Ga0207649_10019063 | 3300025920 | Bacteria | 3917 |
| 332 | Ga0207646_10012322 | 3300025922 | Bacteria | 8223 |
| 333 | Ga0207646_10015828 | 3300025922 | Bacteria | 7101 |
| 334 | Ga0207646_10047918 | 3300025922 | Bacteria | 3832 |
| 335 | Ga0207646_10177010 | 3300025922 | Unclassified | 1927 |
| 336 | Ga0207646_10182156 | 3300025922 | Bacteria | 1897 |
| 337 | Ga0207646_10358323 | 3300025922 | Bacteria | 1318 |
| 338 | Ga0207646_10504663 | 3300025922 | Unclassified | 1090 |
| 339 | Ga0207681_10073138 | 3300025923 | Bacteria | 2396 |
| 340 | Ga0207650_10085099 | 3300025925 | Bacteria | 2405 |
| 341 | Ga0207650_10176949 | 3300025925 | Bacteria | 1698 |
| 342 | Ga0207650_10218693 | 3300025925 | Bacteria | 1532 |
| 343 | Ga0207659_10012073 | 3300025926 | Bacteria | 5477 |
| 344 | Ga0207659_10042972 | 3300025926 | Unclassified | 3171 |
| 345 | Ga0207659_10072530 | 3300025926 | Bacteria | 2517 |
| 346 | Ga0207659_10158838 | 3300025926 | Bacteria | 1773 |
| 347 | Ga0207659_10226522 | 3300025926 | Bacteria | 1506 |
| 348 | Ga0207687_10517146 | 3300025927 | Bacteria | 998 |
| 349 | Ga0207700_10454177 | 3300025928 | Bacteria | 1130 |
| 350 | Ga0207664_10242631 | 3300025929 | Bacteria | 1570 |
| 351 | Ga0207644_10003472 | 3300025931 | Bacteria | 10187 |
| 352 | Ga0207644_10012842 | 3300025931 | Bacteria | 5571 |
| 353 | Ga0207644_10132992 | 3300025931 | Bacteria | 1907 |
| 354 | Ga0207644_10213990 | 3300025931 | Bacteria | 1525 |
| 355 | Ga0207644_10370186 | 3300025931 | Bacteria | 1167 |
| 356 | Ga0207690_10031801 | 3300025932 | Bacteria | 3381 |
| 357 | Ga0207706_10001810 | 3300025933 | Bacteria | 20994 |
| 358 | Ga0207706_10283195 | 3300025933 | Bacteria | 1445 |
| 359 | Ga0207686_10058724 | 3300025934 | Bacteria | 2426 |
| 360 | Ga0207686_10113499 | 3300025934 | Bacteria | 1832 |
| 361 | Ga0207686_10181648 | 3300025934 | Bacteria | 1492 |
| 362 | Ga0207709_10000097 | 3300025935 | Bacteria | 136507 |
| 363 | Ga0207709_10033841 | 3300025935 | Bacteria | 3006 |
| 364 | Ga0207670_10009592 | 3300025936 | Bacteria | 5531 |
| 365 | Ga0207670_10079767 | 3300025936 | Bacteria | 2286 |
| 366 | Ga0207670_10085737 | 3300025936 | Bacteria | 2214 |
| 367 | Ga0207704_10158282 | 3300025938 | Bacteria | 1608 |
| 368 | Ga0207665_10000279 | 3300025939 | Bacteria | 35535 |
| 369 | Ga0207665_10132188 | 3300025939 | Unclassified | 1773 |
| 370 | Ga0207665_10534040 | 3300025939 | Unclassified | 910 |
| 371 | Ga0207691_10000359 | 3300025940 | Bacteria | 46053 |
| 372 | Ga0207691_10043986 | 3300025940 | Bacteria | 4113 |
| 373 | Ga0207691_10058924 | 3300025940 | Bacteria | 3493 |
| 374 | Ga0207691_10758619 | 3300025940 | Unclassified | 817 |
| 375 | Ga0207689_10005280 | 3300025942 | Bacteria | 11579 |
| 376 | Ga0207661_10590958 | 3300025944 | Bacteria | 1019 |
| 377 | Ga0207679_10000726 | 3300025945 | Bacteria | 21877 |
| 378 | Ga0207679_10171966 | 3300025945 | Bacteria | 1784 |
| 379 | Ga0207679_10411883 | 3300025945 | Bacteria | 1191 |
| 380 | Ga0207667_10001763 | 3300025949 | Bacteria | 27229 |
| 381 | Ga0207651_10023014 | 3300025960 | Bacteria | 3823 |
| 382 | Ga0207651_10042485 | 3300025960 | Bacteria | 3026 |
| 383 | Ga0207651_10051902 | 3300025960 | Bacteria | 2793 |
| 384 | Ga0207651_10053019 | 3300025960 | Bacteria | 2769 |
| 385 | Ga0207651_10287735 | 3300025960 | Unclassified | 1361 |
| 386 | Ga0207712_10016002 | 3300025961 | Bacteria | 4848 |
| 387 | Ga0207712_10079511 | 3300025961 | Bacteria | 2382 |
| 388 | Ga0207668_10001824 | 3300025972 | Bacteria | 12434 |
| 389 | Ga0207668_10488251 | 3300025972 | Bacteria | 1057 |
| 390 | Ga0207658_10015807 | 3300025986 | Bacteria | 5181 |
| 391 | Ga0207658_10023292 | 3300025986 | Bacteria | 4321 |
| 392 | Ga0207658_10121627 | 3300025986 | Bacteria | 2082 |
| 393 | Ga0207677_10056480 | 3300026023 | Bacteria | 2690 |
| 394 | Ga0207677_10090110 | 3300026023 | Bacteria | 2228 |
| 395 | Ga0207677_10091314 | 3300026023 | Bacteria | 2215 |
| 396 | Ga0207677_10336993 | 3300026023 | Bacteria | 1259 |
| 397 | Ga0207703_10011901 | 3300026035 | Bacteria | 6775 |
| 398 | Ga0207703_10208521 | 3300026035 | Bacteria | 1741 |
| 399 | Ga0207703_10288213 | 3300026035 | Bacteria | 1493 |
| 400 | Ga0207703_10363919 | 3300026035 | Unclassified | 1334 |
| 401 | Ga0207639_10000032 | 3300026041 | Bacteria | 163200 |
| 402 | Ga0207708_10047233 | 3300026075 | Bacteria | 3278 |
| 403 | Ga0207708_10123132 | 3300026075 | Bacteria | 2022 |
| 404 | Ga0207641_10003812 | 3300026088 | Bacteria | 13218 |
| 405 | Ga0207641_10438734 | 3300026088 | Unclassified | 1260 |
| 406 | Ga0207648_10002123 | 3300026089 | Bacteria | 21568 |
| 407 | Ga0207648_10050196 | 3300026089 | Bacteria | 3649 |
| 408 | Ga0207648_10134627 | 3300026089 | Bacteria | 2176 |
| 409 | Ga0207648_10590316 | 3300026089 | Unclassified | 1023 |
| 410 | Ga0207648_10714537 | 3300026089 | Bacteria | 929 |
| 411 | Ga0207676_10055323 | 3300026095 | Bacteria | 3115 |
| 412 | Ga0207674_10421850 | 3300026116 | Bacteria | 1289 |
| 413 | Ga0207675_100057606 | 3300026118 | Bacteria | 3626 |
| 414 | Ga0207675_100124915 | 3300026118 | Bacteria | 2437 |
| 415 | Ga0207675_100224558 | 3300026118 | Bacteria | 1810 |
| 416 | Ga0207683_10001130 | 3300026121 | Bacteria | 24282 |
| 417 | Ga0207683_10026280 | 3300026121 | Bacteria | 5025 |
| 418 | Ga0207683_10234296 | 3300026121 | Bacteria | 1674 |
| 419 | Ga0207428_10546861 | 3300027907 | Bacteria | 838 |
| 420 | Ga0268266_10000157 | 3300028379 | Bacteria | 128419 |
| 421 | Ga0268266_10002775 | 3300028379 | Bacteria | 18285 |
| 422 | Ga0268266_10035345 | 3300028379 | Bacteria | 4250 |
| 423 | Ga0268266_10150272 | 3300028379 | Bacteria | 2098 |
| 424 | Ga0268266_10215085 | 3300028379 | Bacteria | 1764 |
| 425 | Ga0268266_10332437 | 3300028379 | Bacteria | 1424 |
| 426 | Ga0268266_10479960 | 3300028379 | Unclassified | 1185 |
| 427 | Ga0268265_10039102 | 3300028380 | Bacteria | 3494 |
| 428 | Ga0268265_10982271 | 3300028380 | Bacteria | 833 |
| 429 | Ga0268264_10000730 | 3300028381 | Bacteria | 37595 |
| 430 | Ga0268264_10295838 | 3300028381 | Unclassified | 1522 |
| 431 | Ga0307511_10002085 | 3300030521 | Bacteria | 20944 |
| 432 | Ga0265325_10009202 | 3300031241 | Bacteria | 5783 |
| 433 | Ga0265327_10000878 | 3300031251 | Bacteria | 44430 |
| 434 | Ga0265316_10033091 | 3300031344 | Bacteria | 4214 |
| 435 | Ga0307513_10164379 | 3300031456 | Unclassified | 2106 |
| 436 | Ga0307408_100000021 | 3300031548 | Bacteria | 312158 |
| 437 | Ga0307408_100001793 | 3300031548 | Bacteria | 15669 |
| 438 | Ga0307508_10039241 | 3300031616 | Bacteria | 4255 |
| 439 | Ga0316579_10003862 | 3300031691 | Bacteria | 5904 |
| 440 | Ga0316579_10017919 | 3300031691 | Bacteria | 3112 |
| 441 | Ga0316579_10127077 | 3300031691 | Bacteria | 1227 |
| 442 | Ga0316576_10006878 | 3300031727 | Bacteria | 7111 |
| 443 | Ga0316576_10009889 | 3300031727 | Bacteria | 6174 |
| 444 | Ga0316576_10018123 | 3300031727 | Bacteria | 4800 |
| 445 | Ga0316576_10020426 | 3300031727 | Bacteria | 4558 |
| 446 | Ga0316576_10043537 | 3300031727 | Bacteria | 3239 |
| 447 | Ga0316576_10046299 | 3300031727 | Bacteria | 3147 |
| 448 | Ga0316576_10068594 | 3300031727 | Bacteria | 2613 |
| 449 | Ga0316576_10094993 | 3300031727 | Bacteria | 2223 |
| 450 | Ga0316576_10099102 | 3300031727 | Bacteria | 2176 |
| 451 | Ga0316576_10140818 | 3300031727 | Unclassified | 1816 |
| 452 | Ga0316576_10178368 | 3300031727 | Bacteria | 1602 |
| 453 | Ga0316578_10012145 | 3300031728 | Bacteria | 4534 |
| 454 | Ga0316578_10021019 | 3300031728 | Bacteria | 3617 |
| 455 | Ga0316578_10075493 | 3300031728 | Bacteria | 2000 |
| 456 | Ga0316578_10088721 | 3300031728 | Bacteria | 1845 |
| 457 | Ga0316578_10131411 | 3300031728 | Bacteria | 1506 |
| 458 | Ga0316578_10146869 | 3300031728 | Bacteria | 1420 |
| 459 | Ga0316578_10165763 | 3300031728 | Bacteria | 1332 |
| 460 | Ga0316577_10017218 | 3300031733 | Bacteria | 3988 |
| 461 | Ga0316577_10032187 | 3300031733 | Bacteria | 2929 |
| 462 | Ga0316577_10039732 | 3300031733 | Bacteria | 2632 |
| 463 | Ga0316577_10065333 | 3300031733 | Bacteria | 2031 |
| 464 | Ga0316577_10084711 | 3300031733 | Unclassified | 1773 |
| 465 | Ga0316577_10185269 | 3300031733 | Bacteria | 1176 |
| 466 | Ga0316577_10369066 | 3300031733 | Bacteria | 815 |
| 467 | Ga0307406_10000117 | 3300031901 | Bacteria | 46339 |
| 468 | Ga0307407_10000218 | 3300031903 | Bacteria | 17226 |
| 469 | Ga0307412_10000127 | 3300031911 | Bacteria | 56113 |
| 470 | Ga0307412_10390961 | 3300031911 | Unclassified | 1129 |
| 471 | Ga0307409_100001120 | 3300031995 | Bacteria | 12697 |
| 472 | Ga0307416_100020725 | 3300032002 | Bacteria | 4699 |
| 473 | Ga0307414_10000015 | 3300032004 | Bacteria | 268602 |
| 474 | Ga0307414_10281790 | 3300032004 | Bacteria | 1397 |
| 475 | Ga0307414_10318589 | 3300032004 | Bacteria | 1322 |
| 476 | Ga0307415_100275351 | 3300032126 | Bacteria | 1381 |
| 477 | Ga0316583_10002435 | 3300032133 | Bacteria | 6451 |
| 478 | Ga0316583_10003086 | 3300032133 | Bacteria | 5855 |
| 479 | Ga0316583_10040772 | 3300032133 | Unclassified | 1644 |
| 480 | Ga0316583_10054457 | 3300032133 | Bacteria | 1407 |
| 481 | Ga0316585_10003810 | 3300032137 | Bacteria | 4168 |
| 482 | Ga0316585_10089526 | 3300032137 | Bacteria | 1005 |
| 483 | Ga0316580_10000952 | 3300032139 | Bacteria | 7194 |
| 484 | Ga0316580_10005501 | 3300032139 | Bacteria | 3702 |
| 485 | Ga0316580_10010511 | 3300032139 | Bacteria | 2799 |
| 486 | Ga0316580_10013604 | 3300032139 | Unclassified | 2480 |
| 487 | Ga0316593_10016513 | 3300032168 | Unclassified | 2239 |
| 488 | Ga0316593_10023454 | 3300032168 | Bacteria | 1947 |
| 489 | Ga0316593_10035616 | 3300032168 | Bacteria | 1638 |
| 490 | Ga0316593_10058452 | 3300032168 | Bacteria | 1315 |
| 491 | Ga0316593_10070412 | 3300032168 | Bacteria | 1209 |
| 492 | Ga0316593_10148033 | 3300032168 | Bacteria | 853 |
| 493 | Ga0316592_1000854 | 3300033524 | Unclassified | 4599 |
| 494 | Ga0316592_1001529 | 3300033524 | Bacteria | 3753 |
| 495 | Ga0316592_1007953 | 3300033524 | Bacteria | 2082 |
| 496 | Ga0316592_1027887 | 3300033524 | Bacteria | 1222 |
| 497 | Ga0316586_1001462 | 3300033527 | Unclassified | 2719 |
| 498 | Ga0316586_1024949 | 3300033527 | Bacteria | 1005 |
| 499 | Ga0316588_1002069 | 3300033528 | Unclassified | 3436 |
| 500 | Ga0316588_1010251 | 3300033528 | Bacteria | 1971 |
| 501 | Ga0316588_1017618 | 3300033528 | Bacteria | 1593 |
| 502 | Ga0316588_1019482 | 3300033528 | Bacteria | 1528 |
| 503 | Ga0316587_1002217 | 3300033529 | Unclassified | 2561 |
| 504 | Ga0316587_1031560 | 3300033529 | Bacteria | 937 |
| 505 | Ga0316596_1010783 | 3300033541 | Bacteria | 2221 |
| 506 | Ga0316596_1017416 | 3300033541 | Bacteria | 1806 |
| 507 | Ga0316596_1026339 | 3300033541 | Bacteria | 1499 |
| 508 | Ga0373943_0245608 | 3300035170 | Bacteria | 1004 |
| 509 | Ga0373946_0252225 | 3300035171 | Bacteria | 861 |
| 510 | Ga0373955_0012899 | 3300035172 | Bacteria | 4029 |
| 511 | Ga0316574_0014773 | 3300035398 | Bacteria | 4519 |
| 512 | Ga0316574_0016875 | 3300035398 | Bacteria | 4262 |
| 513 | Ga0316574_0037555 | 3300035398 | Bacteria | 2971 |
| 514 | Ga0316574_0057990 | 3300035398 | Unclassified | 2425 |
| 515 | Ga0316574_0064910 | 3300035398 | Bacteria | 2298 |
| 516 | Ga0373935_0043668 | 3300035692 | Unclassified | 2822 |
| 517 | Ga0373935_0074285 | 3300035692 | Bacteria | 2198 |
| 518 | Ga0373927_0226649 | 3300035695 | Bacteria | 1228 |
| 519 | Ga0373947_0021763 | 3300035725 | Unclassified | 3714 |
| 520 | Ga0373937_0074152 | 3300036401 | Bacteria | 3140 |
| 521 | Ga0373937_0174964 | 3300036401 | Bacteria | 2015 |
| 522 | Ga0373937_0409540 | 3300036401 | Bacteria | 1286 |
| 523 | Ga0373937_0542395 | 3300036401 | Bacteria | 1105 |
| 524 | Ga0316582_0001255 | 3300036647 | Bacteria | 10953 |
| 525 | Ga0316582_0032516 | 3300036647 | Bacteria | 3197 |
| 526 | Ga0316582_0149459 | 3300036647 | Bacteria | 1578 |
| 527 | Ga0316584_0015370 | 3300036712 | Bacteria | 5473 |
| 528 | Ga0316584_0030621 | 3300036712 | Bacteria | 3974 |
| 529 | Ga0316584_0035083 | 3300036712 | Bacteria | 3720 |
| 530 | Ga0316584_0036350 | 3300036712 | Bacteria | 3654 |
| 531 | Ga0316584_0130623 | 3300036712 | Bacteria | 1876 |
| 532 | Ga0316584_0184782 | 3300036712 | Bacteria | 1542 |
| 533 | Ga0316584_0384415 | 3300036712 | Bacteria | 1002 |
| 534 | Ga0373925_0370601 | 3300037068 | Unclassified | 1165 |
| 535 | Ga0395899_0157168 | 3300037312 | Bacteria | 1608 |
| 536 | Ga0395900_0005116 | 3300037418 | Bacteria | 13770 |
| 537 | Ga0395900_0170690 | 3300037418 | Bacteria | 2215 |
| 538 | Ga0395898_0005956 | 3300037466 | Bacteria | 13088 |
| 539 | Ga0395905_0088257 | 3300037471 | Bacteria | 2907 |
| 540 | Ga0395905_0226432 | 3300037471 | Unclassified | 1749 |
| 541 | Ga0395901_0001211 | 3300038443 | Bacteria | 27435 |
| 542 | Ga0436365_0155704 | 3300039437 | Bacteria | 7574 |
| 543 | Ga0439453_0002049 | 3300041408 | Bacteria | 2718 |
| 544 | Ga0450890_000103 | 3300042127 | Bacteria | 14138 |
| 545 | Ga0450891_000326 | 3300042129 | Bacteria | 4877 |
| 546 | Ga0450889_013135 | 3300042144 | Unclassified | 874 |
| 547 | Ga0450893_0000014 | 3300042532 | Bacteria | 17445 |
| 548 | Ga0451576_0000140 | 3300045051 | Bacteria | 183279 |
| 549 | Ga0451576_0022372 | 3300045051 | Bacteria | 6855 |
| 550 | Ga0451576_0039281 | 3300045051 | Bacteria | 5009 |
| 551 | Ga0495629_0129293 | 3300046459 | Unclassified | 1759 |
| 552 | Ga0495651_0003824 | 3300046462 | Bacteria | 11512 |
| 553 | Ga0495580_0103449 | 3300046472 | Bacteria | 1979 |
| 554 | Ga0495639_0013137 | 3300046475 | Bacteria | 3572 |
| 555 | Ga0495639_0127273 | 3300046475 | Bacteria | 1218 |
| 556 | Ga0495639_0245805 | 3300046475 | Unclassified | 884 |
| 557 | Ga0495594_0078938 | 3300046499 | Unclassified | 1837 |
| 558 | Ga0495630_0062676 | 3300046517 | Bacteria | 2793 |
| 559 | Ga0495643_0000176 | 3300046522 | Bacteria | 102034 |
| 560 | Ga0495652_0007139 | 3300046529 | Bacteria | 10306 |
| 561 | Ga0495587_0168178 | 3300046536 | Bacteria | 1246 |
| 562 | Ga0495645_0128687 | 3300046543 | Unclassified | 1777 |
| 563 | Ga0495635_0225106 | 3300046663 | Bacteria | 1268 |
| 564 | Ga0495658_0043444 | 3300046683 | Bacteria | 2514 |
| 565 | Ga0495680_0129895 | 3300047322 | Bacteria | 1852 |
| 566 | Ga0495680_0159774 | 3300047322 | Unclassified | 1637 |
| 567 | Ga0496100_0007845 | 3300048903 | Bacteria | 5925 |
| 568 | Ga0496101_0095530 | 3300048904 | Bacteria | 2217 |
| 569 | Ga0496104_0436756 | 3300048907 | Unclassified | 1221 |
| 570 | Ga0496105_0203022 | 3300048908 | Bacteria | 1617 |
| 571 | Ga0496106_0159448 | 3300048909 | Unclassified | 1784 |
| 572 | Ga0496108_0062750 | 3300048911 | Bacteria | 3129 |
| 573 | Ga0496109_0023561 | 3300048912 | Bacteria | 5465 |
| 574 | Ga0496112_0028358 | 3300048915 | Bacteria | 5404 |
| 575 | Ga0496112_0081502 | 3300048915 | Bacteria | 3200 |
| 576 | Ga0496112_0098973 | 3300048915 | Bacteria | 2886 |
| 577 | Ga0496113_0200955 | 3300048916 | Bacteria | 1584 |
| 578 | Ga0496113_0236857 | 3300048916 | Bacteria | 1456 |
| 579 | Ga0496114_0843477 | 3300048917 | Unclassified | 796 |
| 580 | Ga0496115_0004254 | 3300048918 | Bacteria | 10353 |
| 581 | Ga0496115_0020210 | 3300048918 | Bacteria | 5134 |
| 582 | Ga0496125_0322375 | 3300048928 | Bacteria | 936 |
| 583 | Ga0501032_0008182 | 3300049569 | Bacteria | 7622 |
| 584 | Ga0501037_0045111 | 3300049573 | Bacteria | 3236 |
| 585 | Ga0501037_0269392 | 3300049573 | Unclassified | 1189 |
| 586 | Ga0501038_0001708 | 3300049574 | Bacteria | 20393 |
| 587 | Ga0501043_0083134 | 3300049579 | Bacteria | 2517 |
| 588 | Ga0501047_0009905 | 3300049581 | Bacteria | 9010 |
| 589 | Ga0501047_0049179 | 3300049581 | Bacteria | 4071 |
| 590 | Ga0501047_0074388 | 3300049581 | Bacteria | 3271 |
| 591 | Ga0501067_0153153 | 3300049583 | Bacteria | 1284 |
| 592 | Ga0501069_0278626 | 3300049585 | Bacteria | 978 |
| 593 | Ga0501070_0326627 | 3300049586 | Bacteria | 1247 |
| 594 | Ga0501073_0139274 | 3300049589 | Unclassified | 1681 |
| 595 | Ga0501077_0039049 | 3300049593 | Unclassified | 3023 |
| 596 | Ga0501227_002158 | 3300049665 | Bacteria | 4356 |
| 597 | Ga0501080_0005607 | 3300049742 | Bacteria | 11220 |
| 598 | Ga0501080_0046191 | 3300049742 | Bacteria | 4056 |
| 599 | Ga0501080_0302718 | 3300049742 | Bacteria | 1450 |
| 600 | Ga0501083_0016819 | 3300049744 | Bacteria | 5110 |
| 601 | Ga0501035_0086999 | 3300049822 | Bacteria | 2754 |
| 602 | Ga0501044_0008540 | 3300049823 | Bacteria | 11224 |
| 603 | Ga0501044_0258964 | 3300049823 | Bacteria | 1678 |
| 604 | nmdc:mga03683_37261_c1 | 3300050489 | Unclassified | 1981 |
| 605 | nmdc:mga0k408_24895_c2 | 3300050493 | Bacteria | 1996 |
| 606 | nmdc:mga0k408_337755_c1 | 3300050493 | Unclassified | 898 |
| 607 | nmdc:mga0k408_60713_c1 | 3300050493 | Bacteria | 2197 |
| 608 | nmdc:mga05p37_1321216_c1 | 3300050507 | Unclassified | 733 |
| 609 | nmdc:mga05p37_917302_c1 | 3300050507 | Unclassified | 942 |
| 610 | nmdc:mga06r32_492094_c1 | 3300050510 | Bacteria | 1204 |
| 611 | nmdc:mga08y16_144897_c1 | 3300050511 | Unclassified | 2469 |
| 612 | nmdc:mga08y16_25666_c1 | 3300050511 | Bacteria | 6217 |
| 613 | nmdc:mga08y16_402222_c1 | 3300050511 | Bacteria | 1401 |
| 614 | nmdc:mga08y16_44722_c1 | 3300050511 | Bacteria | 4640 |
| 615 | nmdc:mga08y16_763614_c1 | 3300050511 | Bacteria | 962 |
| 616 | nmdc:mga0rr50_274239_c1 | 3300050513 | Unclassified | 1406 |
| 617 | Ga0495601_0096671 | 3300053077 | Bacteria | 1905 |
| 618 | Ga0500635_0029516 | 3300053080 | Bacteria | 1761 |
| 619 | Ga0495619_0092465 | 3300053085 | Bacteria | 2049 |
| 620 | Ga0500643_020371 | 3300053087 | Bacteria | 2170 |
| 621 | Ga0500555_000015 | 3300053103 | Bacteria | 230204 |
| 622 | Ga0500595_020650 | 3300053119 | Unclassified | 2366 |
| 623 | Ga0500608_179069 | 3300053122 | Bacteria | 900 |
| 624 | Ga0500559_0001280 | 3300053136 | Bacteria | 14650 |
| 625 | Ga0500573_0244258 | 3300053140 | Bacteria | 929 |
| 626 | Ga0500616_0001787 | 3300053153 | Bacteria | 19618 |
| 627 | Ga0500616_0003083 | 3300053153 | Bacteria | 13089 |
| 628 | Ga0500616_0005407 | 3300053153 | Bacteria | 8668 |
| 629 | Ga0500616_0195740 | 3300053153 | Bacteria | 899 |
| 630 | Ga0500645_005103 | 3300053730 | Unclassified | 4899 |
| 631 | Ga0501084_0255296 | 3300054114 | Bacteria | 1480 |
| 632 | Ga0501082_0387791 | 3300060353 | Bacteria | 1219 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005364 | Ga0070673_100021642 | Ga0070673_1000216422 | 208 |
| 2 | 3300005543 | Ga0070672_100053547 | Ga0070672_1000535472 | 208 |
| 3 | 3300006358 | Ga0068871_100422712 | Ga0068871_1004227122 | 208 |
| 4 | 3300013308 | Ga0157375_10882396 | Ga0157375_108823962 | 208 |
| 5 | 3300025931 | Ga0207644_10012842 | Ga0207644_100128423 | 208 |
| 6 | 3300025960 | Ga0207651_10053019 | Ga0207651_100530192 | 208 |
| 7 | 3300005843 | Ga0068860_100752428 | Ga0068860_1007524282 | 209 |
| 8 | 3300005438 | Ga0070701_10335037 | Ga0070701_103350372 | 212 |
| 9 | 3300005545 | Ga0070695_100004317 | Ga0070695_1000043172 | 212 |
| 10 | 3300025315 | Ga0207697_10144829 | Ga0207697_101448292 | 212 |
| 11 | 3300005347 | Ga0070668_100451455 | Ga0070668_1004514551 | 213 |
| 12 | 3300005983 | Ga0081540_1023881 | Ga0081540_10238813 | 213 |
| 13 | 3300048912 | Ga0496109_0023561 | Ga0496109_0023561_560_1201 | 213 |
| 14 | 3300048915 | Ga0496112_0098973 | Ga0496112_0098973_1023_1706 | 213 |
| 15 | 3300048916 | Ga0496113_0200955 | Ga0496113_0200955_540_1181 | 213 |
| 16 | 3300048918 | Ga0496115_0020210 | Ga0496115_0020210_982_1623 | 213 |
| 17 | 3300005331 | Ga0070670_100252591 | Ga0070670_1002525911 | 214 |
| 18 | 3300005355 | Ga0070671_100618960 | Ga0070671_1006189602 | 214 |
| 19 | 3300005365 | Ga0070688_100062851 | Ga0070688_1000628512 | 214 |
| 20 | 3300005466 | Ga0070685_10180319 | Ga0070685_101803191 | 214 |
| 21 | 3300005617 | Ga0068859_101075666 | Ga0068859_1010756661 | 214 |
| 22 | 3300006931 | Ga0097620_101075439 | Ga0097620_1010754392 | 214 |
| 23 | 3300009553 | Ga0105249_11226421 | Ga0105249_112264211 | 214 |
| 24 | 3300013297 | Ga0157378_10976266 | Ga0157378_109762661 | 214 |
| 25 | 3300013308 | Ga0157375_11483703 | Ga0157375_114837031 | 214 |
| 26 | 3300025931 | Ga0207644_10370186 | Ga0207644_103701861 | 214 |
| 27 | 3300035171 | Ga0373946_0252225 | Ga0373946_0252225_20_676 | 214 |
| 28 | 3300035172 | Ga0373955_0012899 | Ga0373955_0012899_3247_3903 | 214 |
| 29 | 3300035692 | Ga0373935_0074285 | Ga0373935_0074285_97_753 | 214 |
| 30 | 3300036401 | Ga0373937_0409540 | Ga0373937_0409540_471_1127 | 214 |
| 31 | 3300046462 | Ga0495651_0003824 | Ga0495651_0003824_4766_5422 | 214 |
| 32 | 3300046517 | Ga0495630_0062676 | Ga0495630_0062676_2122_2778 | 214 |
| 33 | 3300046522 | Ga0495643_0000176 | Ga0495643_0000176_52253_52936 | 214 |
| 34 | 3300046529 | Ga0495652_0007139 | Ga0495652_0007139_5715_6371 | 214 |
| 35 | 3300046536 | Ga0495587_0168178 | Ga0495587_0168178_437_1093 | 214 |
| 36 | 3300046543 | Ga0495645_0128687 | Ga0495645_0128687_198_854 | 214 |
| 37 | 3300047322 | Ga0495680_0159774 | Ga0495680_0159774_880_1536 | 214 |
| 38 | 3300053077 | Ga0495601_0096671 | Ga0495601_0096671_727_1383 | 214 |
| 39 | 3300003322 | rootL2_10062978 | rootL2_100629785 | 217 |
| 40 | 3300003323 | rootH1_10263792 | rootH1_102637921 | 217 |
| 41 | 3300005330 | Ga0070690_100017997 | Ga0070690_1000179972 | 217 |
| 42 | 3300005335 | Ga0070666_10304644 | Ga0070666_103046441 | 217 |
| 43 | 3300005354 | Ga0070675_100022767 | Ga0070675_1000227673 | 217 |
| 44 | 3300005367 | Ga0070667_100175099 | Ga0070667_1001750992 | 217 |
| 45 | 3300005543 | Ga0070672_100016223 | Ga0070672_1000162232 | 217 |
| 46 | 3300005544 | Ga0070686_100119057 | Ga0070686_1001190572 | 217 |
| 47 | 3300005617 | Ga0068859_100096163 | Ga0068859_1000961634 | 217 |
| 48 | 3300005842 | Ga0068858_100027060 | Ga0068858_1000270605 | 217 |
| 49 | 3300005843 | Ga0068860_100172766 | Ga0068860_1001727662 | 217 |
| 50 | 3300006931 | Ga0097620_100096163 | Ga0097620_1000961634 | 217 |
| 51 | 3300009098 | Ga0105245_10017205 | Ga0105245_100172055 | 217 |
| 52 | 3300009101 | Ga0105247_10191337 | Ga0105247_101913372 | 217 |
| 53 | 3300009148 | Ga0105243_10037579 | Ga0105243_100375792 | 217 |
| 54 | 3300013297 | Ga0157378_10005095 | Ga0157378_100050959 | 217 |
| 55 | 3300026023 | Ga0207677_10336993 | Ga0207677_103369931 | 217 |
| 56 | 3300036401 | Ga0373937_0174964 | Ga0373937_0174964_263_967 | 217 |
| 57 | 3300005983 | Ga0081540_1002277 | Ga0081540_10022773 | 218 |
| 58 | 3300006175 | Ga0070712_100380805 | Ga0070712_1003808052 | 218 |
| 59 | 3300009553 | Ga0105249_10424190 | Ga0105249_104241902 | 218 |
| 60 | 3300013306 | Ga0163162_10127752 | Ga0163162_101277522 | 218 |
| 61 | 3300025315 | Ga0207697_10003302 | Ga0207697_100033022 | 218 |
| 62 | 3300025915 | Ga0207693_10293245 | Ga0207693_102932452 | 218 |
| 63 | 3300025916 | Ga0207663_10054682 | Ga0207663_100546822 | 218 |
| 64 | 3300025929 | Ga0207664_10242631 | Ga0207664_102426312 | 218 |
| 65 | 3300026035 | Ga0207703_10011901 | Ga0207703_100119015 | 218 |
| 66 | 3300026088 | Ga0207641_10438734 | Ga0207641_104387341 | 218 |
| 67 | 3300027907 | Ga0207428_10546861 | Ga0207428_105468611 | 218 |
| 68 | 3300049581 | Ga0501047_0074388 | Ga0501047_0074388_1543_2205 | 218 |
| 69 | 3300050511 | nmdc:mga08y16_44722_c1 | nmdc:mga08y16_44722_c1_990_1646 | 218 |
| 70 | 3300005340 | Ga0070689_100358225 | Ga0070689_1003582252 | 219 |
| 71 | 3300005364 | Ga0070673_100071266 | Ga0070673_1000712663 | 219 |
| 72 | 3300005441 | Ga0070700_100112531 | Ga0070700_1001125312 | 219 |
| 73 | 3300005457 | Ga0070662_100752744 | Ga0070662_1007527441 | 219 |
| 74 | 3300005466 | Ga0070685_10242942 | Ga0070685_102429422 | 219 |
| 75 | 3300005543 | Ga0070672_100493668 | Ga0070672_1004936682 | 219 |
| 76 | 3300005544 | Ga0070686_100029044 | Ga0070686_1000290445 | 219 |
| 77 | 3300005544 | Ga0070686_100280561 | Ga0070686_1002805612 | 219 |
| 78 | 3300005617 | Ga0068859_100002012 | Ga0068859_1000020128 | 219 |
| 79 | 3300005617 | Ga0068859_100011947 | Ga0068859_1000119476 | 219 |
| 80 | 3300005719 | Ga0068861_100038411 | Ga0068861_1000384112 | 219 |
| 81 | 3300005719 | Ga0068861_100295817 | Ga0068861_1002958172 | 219 |
| 82 | 3300005842 | Ga0068858_100466773 | Ga0068858_1004667731 | 219 |
| 83 | 3300005843 | Ga0068860_100333183 | Ga0068860_1003331832 | 219 |
| 84 | 3300006195 | Ga0075366_10012361 | Ga0075366_100123616 | 219 |
| 85 | 3300006931 | Ga0097620_100002012 | Ga0097620_1000020128 | 219 |
| 86 | 3300006931 | Ga0097620_100011947 | Ga0097620_1000119476 | 219 |
| 87 | 3300006931 | Ga0097620_100029867 | Ga0097620_1000298676 | 219 |
| 88 | 3300009553 | Ga0105249_10712175 | Ga0105249_107121752 | 219 |
| 89 | 3300013308 | Ga0157375_10041718 | Ga0157375_100417183 | 219 |
| 90 | 3300025940 | Ga0207691_10758619 | Ga0207691_107586191 | 219 |
| 91 | 3300025960 | Ga0207651_10287735 | Ga0207651_102877353 | 219 |
| 92 | 3300026075 | Ga0207708_10123132 | Ga0207708_101231323 | 219 |
| 93 | 3300026095 | Ga0207676_10055323 | Ga0207676_100553233 | 219 |
| 94 | 3300026116 | Ga0207674_10421850 | Ga0207674_104218502 | 219 |
| 95 | 3300026118 | Ga0207675_100057606 | Ga0207675_1000576062 | 219 |
| 96 | 3300028381 | Ga0268264_10295838 | Ga0268264_102958381 | 219 |
| 97 | 3300031616 | Ga0307508_10039241 | Ga0307508_100392413 | 219 |
| 98 | 3300031727 | Ga0316576_10178368 | Ga0316576_101783681 | 219 |
| 99 | 3300035398 | Ga0316574_0014773 | Ga0316574_0014773_322_990 | 219 |
| 100 | 3300036401 | Ga0373937_0074152 | Ga0373937_0074152_2113_2772 | 219 |
| 101 | 3300036712 | Ga0316584_0384415 | Ga0316584_0384415_292_960 | 219 |
| 102 | 3300046459 | Ga0495629_0129293 | Ga0495629_0129293_852_1511 | 219 |
| 103 | 3300046475 | Ga0495639_0013137 | Ga0495639_0013137_2474_3133 | 219 |
| 104 | 3300046499 | Ga0495594_0078938 | Ga0495594_0078938_277_936 | 219 |
| 105 | 3300046663 | Ga0495635_0225106 | Ga0495635_0225106_489_1148 | 219 |
| 106 | 3300046683 | Ga0495658_0043444 | Ga0495658_0043444_383_1042 | 219 |
| 107 | 3300047322 | Ga0495680_0129895 | Ga0495680_0129895_115_774 | 219 |
| 108 | 3300050493 | nmdc:mga0k408_24895_c2 | nmdc:mga0k408_24895_c2_284_943 | 219 |
| 109 | 3300050511 | nmdc:mga08y16_144897_c1 | nmdc:mga08y16_144897_c1_1651_2310 | 219 |
| 110 | 3300053080 | Ga0500635_0029516 | Ga0500635_0029516_390_1049 | 219 |
| 111 | 3300053085 | Ga0495619_0092465 | Ga0495619_0092465_916_1575 | 219 |
| 112 | 3300005536 | Ga0070697_100091863 | Ga0070697_1000918632 | 220 |
| 113 | 3300005536 | Ga0070697_100336171 | Ga0070697_1003361712 | 220 |
| 114 | 3300005548 | Ga0070665_100241670 | Ga0070665_1002416702 | 220 |
| 115 | 3300005842 | Ga0068858_100592430 | Ga0068858_1005924302 | 220 |
| 116 | 3300006028 | Ga0070717_10000793 | Ga0070717_1000079325 | 220 |
| 117 | 3300006175 | Ga0070712_100165025 | Ga0070712_1001650252 | 220 |
| 118 | 3300025915 | Ga0207693_10326399 | Ga0207693_103263992 | 220 |
| 119 | 3300025922 | Ga0207646_10504663 | Ga0207646_105046632 | 220 |
| 120 | 3300026035 | Ga0207703_10363919 | Ga0207703_103639192 | 220 |
| 121 | 3300028379 | Ga0268266_10332437 | Ga0268266_103324372 | 220 |
| 122 | 3300031728 | Ga0316578_10146869 | Ga0316578_101468691 | 220 |
| 123 | 3300031733 | Ga0316577_10084711 | Ga0316577_100847113 | 220 |
| 124 | 3300032133 | Ga0316583_10054457 | Ga0316583_100544571 | 220 |
| 125 | 3300032168 | Ga0316593_10016513 | Ga0316593_100165132 | 220 |
| 126 | 3300032168 | Ga0316593_10070412 | Ga0316593_100704122 | 220 |
| 127 | 3300032168 | Ga0316593_10148033 | Ga0316593_101480331 | 220 |
| 128 | 3300033524 | Ga0316592_1000854 | Ga0316592_10008544 | 220 |
| 129 | 3300033527 | Ga0316586_1001462 | Ga0316586_10014623 | 220 |
| 130 | 3300033527 | Ga0316586_1024949 | Ga0316586_10249491 | 220 |
| 131 | 3300033528 | Ga0316588_1002069 | Ga0316588_10020692 | 220 |
| 132 | 3300033528 | Ga0316588_1019482 | Ga0316588_10194822 | 220 |
| 133 | 3300033529 | Ga0316587_1002217 | Ga0316587_10022172 | 220 |
| 134 | 3300033529 | Ga0316587_1031560 | Ga0316587_10315601 | 220 |
| 135 | 3300033541 | Ga0316596_1026339 | Ga0316596_10263392 | 220 |
| 136 | 3300035398 | Ga0316574_0057990 | Ga0316574_0057990_1627_2298 | 220 |
| 137 | 3300036712 | Ga0316584_0130623 | Ga0316584_0130623_1195_1866 | 220 |
| 138 | 3300036712 | Ga0316584_0184782 | Ga0316584_0184782_571_1242 | 220 |
| 139 | 3300045051 | Ga0451576_0000140 | Ga0451576_0000140_138353_139024 | 220 |
| 140 | 3300049589 | Ga0501073_0139274 | Ga0501073_0139274_186_851 | 220 |
| 141 | 3300049593 | Ga0501077_0039049 | Ga0501077_0039049_38_703 | 220 |
| 142 | 3300054114 | Ga0501084_0255296 | Ga0501084_0255296_800_1465 | 220 |
| 143 | 3300060353 | Ga0501082_0387791 | Ga0501082_0387791_176_841 | 220 |
| 144 | 3300005356 | Ga0070674_100665639 | Ga0070674_1006656391 | 221 |
| 145 | 3300005467 | Ga0070706_100000462 | Ga0070706_10000046219 | 221 |
| 146 | 3300005467 | Ga0070706_100040362 | Ga0070706_1000403623 | 221 |
| 147 | 3300005467 | Ga0070706_101170542 | Ga0070706_1011705421 | 221 |
| 148 | 3300005468 | Ga0070707_100110597 | Ga0070707_1001105972 | 221 |
| 149 | 3300005468 | Ga0070707_100211044 | Ga0070707_1002110442 | 221 |
| 150 | 3300005471 | Ga0070698_100001706 | Ga0070698_10000170626 | 221 |
| 151 | 3300005536 | Ga0070697_100440831 | Ga0070697_1004408312 | 221 |
| 152 | 3300006028 | Ga0070717_10328253 | Ga0070717_103282532 | 221 |
| 153 | 3300009098 | Ga0105245_10012225 | Ga0105245_100122254 | 221 |
| 154 | 3300025910 | Ga0207684_10000512 | Ga0207684_1000051220 | 221 |
| 155 | 3300025915 | Ga0207693_10634625 | Ga0207693_106346251 | 221 |
| 156 | 3300025922 | Ga0207646_10047918 | Ga0207646_100479184 | 221 |
| 157 | 3300025939 | Ga0207665_10534040 | Ga0207665_105340401 | 221 |
| 158 | 3300031691 | Ga0316579_10003862 | Ga0316579_100038623 | 221 |
| 159 | 3300031691 | Ga0316579_10017919 | Ga0316579_100179193 | 221 |
| 160 | 3300031727 | Ga0316576_10006878 | Ga0316576_100068783 | 221 |
| 161 | 3300031727 | Ga0316576_10018123 | Ga0316576_100181233 | 221 |
| 162 | 3300031727 | Ga0316576_10020426 | Ga0316576_100204261 | 221 |
| 163 | 3300031727 | Ga0316576_10043537 | Ga0316576_100435373 | 221 |
| 164 | 3300031727 | Ga0316576_10046299 | Ga0316576_100462994 | 221 |
| 165 | 3300031727 | Ga0316576_10094993 | Ga0316576_100949931 | 221 |
| 166 | 3300031727 | Ga0316576_10099102 | Ga0316576_100991023 | 221 |
| 167 | 3300031727 | Ga0316576_10140818 | Ga0316576_101408181 | 221 |
| 168 | 3300031728 | Ga0316578_10012145 | Ga0316578_100121453 | 221 |
| 169 | 3300031728 | Ga0316578_10021019 | Ga0316578_100210193 | 221 |
| 170 | 3300031728 | Ga0316578_10075493 | Ga0316578_100754933 | 221 |
| 171 | 3300031728 | Ga0316578_10088721 | Ga0316578_100887212 | 221 |
| 172 | 3300031728 | Ga0316578_10131411 | Ga0316578_101314111 | 221 |
| 173 | 3300031728 | Ga0316578_10165763 | Ga0316578_101657631 | 221 |
| 174 | 3300031733 | Ga0316577_10017218 | Ga0316577_100172183 | 221 |
| 175 | 3300031733 | Ga0316577_10032187 | Ga0316577_100321873 | 221 |
| 176 | 3300031733 | Ga0316577_10039732 | Ga0316577_100397322 | 221 |
| 177 | 3300031733 | Ga0316577_10185269 | Ga0316577_101852692 | 221 |
| 178 | 3300031733 | Ga0316577_10369066 | Ga0316577_103690661 | 221 |
| 179 | 3300032133 | Ga0316583_10003086 | Ga0316583_100030863 | 221 |
| 180 | 3300032133 | Ga0316583_10040772 | Ga0316583_100407722 | 221 |
| 181 | 3300032137 | Ga0316585_10003810 | Ga0316585_100038103 | 221 |
| 182 | 3300032137 | Ga0316585_10089526 | Ga0316585_100895261 | 221 |
| 183 | 3300032139 | Ga0316580_10000952 | Ga0316580_100009526 | 221 |
| 184 | 3300032139 | Ga0316580_10005501 | Ga0316580_100055013 | 221 |
| 185 | 3300032139 | Ga0316580_10010511 | Ga0316580_100105111 | 221 |
| 186 | 3300032168 | Ga0316593_10023454 | Ga0316593_100234542 | 221 |
| 187 | 3300032168 | Ga0316593_10035616 | Ga0316593_100356161 | 221 |
| 188 | 3300032168 | Ga0316593_10058452 | Ga0316593_100584523 | 221 |
| 189 | 3300033524 | Ga0316592_1001529 | Ga0316592_10015293 | 221 |
| 190 | 3300033524 | Ga0316592_1007953 | Ga0316592_10079532 | 221 |
| 191 | 3300033524 | Ga0316592_1027887 | Ga0316592_10278872 | 221 |
| 192 | 3300033528 | Ga0316588_1010251 | Ga0316588_10102511 | 221 |
| 193 | 3300033528 | Ga0316588_1017618 | Ga0316588_10176182 | 221 |
| 194 | 3300033541 | Ga0316596_1010783 | Ga0316596_10107833 | 221 |
| 195 | 3300033541 | Ga0316596_1017416 | Ga0316596_10174162 | 221 |
| 196 | 3300035398 | Ga0316574_0016875 | Ga0316574_0016875_1663_2337 | 221 |
| 197 | 3300035398 | Ga0316574_0064910 | Ga0316574_0064910_1071_1745 | 221 |
| 198 | 3300036647 | Ga0316582_0001255 | Ga0316582_0001255_1794_2468 | 221 |
| 199 | 3300036647 | Ga0316582_0149459 | Ga0316582_0149459_645_1319 | 221 |
| 200 | 3300036712 | Ga0316584_0015370 | Ga0316584_0015370_72_746 | 221 |
| 201 | 3300036712 | Ga0316584_0030621 | Ga0316584_0030621_2015_2689 | 221 |
| 202 | 3300036712 | Ga0316584_0035083 | Ga0316584_0035083_1804_2478 | 221 |
| 203 | 3300036712 | Ga0316584_0036350 | Ga0316584_0036350_785_1459 | 221 |
| 204 | 3300046472 | Ga0495580_0103449 | Ga0495580_0103449_806_1483 | 221 |
| 205 | 3300046475 | Ga0495639_0127273 | Ga0495639_0127273_262_939 | 221 |
| 206 | 3300005334 | Ga0068869_100032605 | Ga0068869_1000326052 | 222 |
| 207 | 3300005338 | Ga0068868_100009713 | Ga0068868_1000097134 | 222 |
| 208 | 3300005339 | Ga0070660_100013539 | Ga0070660_1000135394 | 222 |
| 209 | 3300005340 | Ga0070689_100379544 | Ga0070689_1003795442 | 222 |
| 210 | 3300005345 | Ga0070692_10000251 | Ga0070692_1000025110 | 222 |
| 211 | 3300005354 | Ga0070675_100003444 | Ga0070675_1000034449 | 222 |
| 212 | 3300005356 | Ga0070674_100122278 | Ga0070674_1001222782 | 222 |
| 213 | 3300005365 | Ga0070688_100140896 | Ga0070688_1001408963 | 222 |
| 214 | 3300005366 | Ga0070659_100011977 | Ga0070659_1000119773 | 222 |
| 215 | 3300005367 | Ga0070667_100014691 | Ga0070667_1000146913 | 222 |
| 216 | 3300005438 | Ga0070701_10152737 | Ga0070701_101527372 | 222 |
| 217 | 3300005445 | Ga0070708_100209563 | Ga0070708_1002095632 | 222 |
| 218 | 3300005445 | Ga0070708_100516305 | Ga0070708_1005163051 | 222 |
| 219 | 3300005445 | Ga0070708_100753791 | Ga0070708_1007537911 | 222 |
| 220 | 3300005459 | Ga0068867_100191220 | Ga0068867_1001912202 | 222 |
| 221 | 3300005459 | Ga0068867_100208720 | Ga0068867_1002087202 | 222 |
| 222 | 3300005468 | Ga0070707_100069169 | Ga0070707_1000691692 | 222 |
| 223 | 3300005468 | Ga0070707_100098352 | Ga0070707_1000983522 | 222 |
| 224 | 3300005468 | Ga0070707_100158816 | Ga0070707_1001588162 | 222 |
| 225 | 3300005471 | Ga0070698_100090490 | Ga0070698_1000904903 | 222 |
| 226 | 3300005518 | Ga0070699_100202216 | Ga0070699_1002022162 | 222 |
| 227 | 3300005536 | Ga0070697_100004042 | Ga0070697_1000040428 | 222 |
| 228 | 3300005536 | Ga0070697_100014749 | Ga0070697_1000147494 | 222 |
| 229 | 3300005536 | Ga0070697_100354463 | Ga0070697_1003544632 | 222 |
| 230 | 3300005545 | Ga0070695_100124604 | Ga0070695_1001246042 | 222 |
| 231 | 3300005615 | Ga0070702_100156852 | Ga0070702_1001568522 | 222 |
| 232 | 3300005615 | Ga0070702_100446696 | Ga0070702_1004466961 | 222 |
| 233 | 3300005616 | Ga0068852_100769966 | Ga0068852_1007699662 | 222 |
| 234 | 3300005842 | Ga0068858_100014124 | Ga0068858_1000141242 | 222 |
| 235 | 3300005843 | Ga0068860_100033602 | Ga0068860_1000336022 | 222 |
| 236 | 3300005844 | Ga0068862_100010875 | Ga0068862_1000108759 | 222 |
| 237 | 3300006028 | Ga0070717_10244434 | Ga0070717_102444342 | 222 |
| 238 | 3300009176 | Ga0105242_10093889 | Ga0105242_100938892 | 222 |
| 239 | 3300013307 | Ga0157372_10125590 | Ga0157372_101255903 | 222 |
| 240 | 3300025907 | Ga0207645_10019741 | Ga0207645_100197412 | 222 |
| 241 | 3300025908 | Ga0207643_10008021 | Ga0207643_100080213 | 222 |
| 242 | 3300025918 | Ga0207662_10005566 | Ga0207662_100055662 | 222 |
| 243 | 3300025923 | Ga0207681_10073138 | Ga0207681_100731382 | 222 |
| 244 | 3300025926 | Ga0207659_10158838 | Ga0207659_101588381 | 222 |
| 245 | 3300025932 | Ga0207690_10031801 | Ga0207690_100318013 | 222 |
| 246 | 3300025934 | Ga0207686_10058724 | Ga0207686_100587242 | 222 |
| 247 | 3300025935 | Ga0207709_10033841 | Ga0207709_100338413 | 222 |
| 248 | 3300025936 | Ga0207670_10009592 | Ga0207670_100095926 | 222 |
| 249 | 3300025938 | Ga0207704_10158282 | Ga0207704_101582822 | 222 |
| 250 | 3300025940 | Ga0207691_10043986 | Ga0207691_100439862 | 222 |
| 251 | 3300025942 | Ga0207689_10005280 | Ga0207689_100052804 | 222 |
| 252 | 3300025961 | Ga0207712_10016002 | Ga0207712_100160022 | 222 |
| 253 | 3300026023 | Ga0207677_10090110 | Ga0207677_100901102 | 222 |
| 254 | 3300026075 | Ga0207708_10047233 | Ga0207708_100472333 | 222 |
| 255 | 3300026089 | Ga0207648_10714537 | Ga0207648_107145372 | 222 |
| 256 | 3300026118 | Ga0207675_100124915 | Ga0207675_1001249153 | 222 |
| 257 | 3300026118 | Ga0207675_100224558 | Ga0207675_1002245582 | 222 |
| 258 | 3300031691 | Ga0316579_10127077 | Ga0316579_101270772 | 222 |
| 259 | 3300031727 | Ga0316576_10009889 | Ga0316576_100098894 | 222 |
| 260 | 3300031727 | Ga0316576_10068594 | Ga0316576_100685942 | 222 |
| 261 | 3300031733 | Ga0316577_10065333 | Ga0316577_100653334 | 222 |
| 262 | 3300032133 | Ga0316583_10002435 | Ga0316583_100024355 | 222 |
| 263 | 3300032139 | Ga0316580_10013604 | Ga0316580_100136041 | 222 |
| 264 | 3300035398 | Ga0316574_0037555 | Ga0316574_0037555_1489_2166 | 222 |
| 265 | 3300036647 | Ga0316582_0032516 | Ga0316582_0032516_1311_1988 | 222 |
| 266 | 3300050513 | nmdc:mga0rr50_274239_c1 | nmdc:mga0rr50_274239_c1_68_736 | 222 |
| 267 | 3300053122 | Ga0500608_179069 | Ga0500608_179069_19_690 | 222 |
| 268 | 3300053136 | Ga0500559_0001280 | Ga0500559_0001280_12624_13295 | 222 |
| 269 | 3300005436 | Ga0070713_100326975 | Ga0070713_1003269751 | 223 |
| 270 | 3300006237 | Ga0097621_100002691 | Ga0097621_10000269110 | 223 |
| 271 | 3300006847 | Ga0075431_100022731 | Ga0075431_1000227315 | 223 |
| 272 | 3300025915 | Ga0207693_10242237 | Ga0207693_102422372 | 223 |
| 273 | 3300025928 | Ga0207700_10454177 | Ga0207700_104541772 | 223 |
| 274 | 3300031241 | Ga0265325_10009202 | Ga0265325_100092027 | 223 |
| 275 | 3300035692 | Ga0373935_0043668 | Ga0373935_0043668_1567_2292 | 223 |
| 276 | 3300035695 | Ga0373927_0226649 | Ga0373927_0226649_444_1169 | 223 |
| 277 | 3300037471 | Ga0395905_0226432 | Ga0395905_0226432_761_1444 | 223 |
| 278 | 3300046475 | Ga0495639_0245805 | Ga0495639_0245805_14_739 | 223 |
| 279 | 3300048903 | Ga0496100_0007845 | Ga0496100_0007845_1219_1890 | 223 |
| 280 | 3300048904 | Ga0496101_0095530 | Ga0496101_0095530_630_1301 | 223 |
| 281 | 3300048908 | Ga0496105_0203022 | Ga0496105_0203022_163_834 | 223 |
| 282 | 3300048909 | Ga0496106_0159448 | Ga0496106_0159448_993_1664 | 223 |
| 283 | 3300048918 | Ga0496115_0004254 | Ga0496115_0004254_5710_6381 | 223 |
| 284 | 3300049744 | Ga0501083_0016819 | Ga0501083_0016819_3734_4408 | 223 |
| 285 | 3300003659 | JGI25404J52841_10015660 | JGI25404J52841_100156602 | 224 |
| 286 | 3300003911 | JGI25405J52794_10007547 | JGI25405J52794_100075472 | 224 |
| 287 | 3300003911 | JGI25405J52794_10013191 | JGI25405J52794_100131912 | 224 |
| 288 | 3300005290 | Ga0065712_10213462 | Ga0065712_102134621 | 224 |
| 289 | 3300005330 | Ga0070690_100024075 | Ga0070690_1000240754 | 224 |
| 290 | 3300005338 | Ga0068868_100319002 | Ga0068868_1003190023 | 224 |
| 291 | 3300005355 | Ga0070671_100034810 | Ga0070671_1000348102 | 224 |
| 292 | 3300005364 | Ga0070673_100067906 | Ga0070673_1000679063 | 224 |
| 293 | 3300005365 | Ga0070688_100271052 | Ga0070688_1002710521 | 224 |
| 294 | 3300005434 | Ga0070709_10367770 | Ga0070709_103677701 | 224 |
| 295 | 3300005456 | Ga0070678_100086575 | Ga0070678_1000865751 | 224 |
| 296 | 3300005466 | Ga0070685_10363635 | Ga0070685_103636352 | 224 |
| 297 | 3300005467 | Ga0070706_100008351 | Ga0070706_1000083513 | 224 |
| 298 | 3300005471 | Ga0070698_100013186 | Ga0070698_1000131868 | 224 |
| 299 | 3300005548 | Ga0070665_100084767 | Ga0070665_1000847673 | 224 |
| 300 | 3300005617 | Ga0068859_100000038 | Ga0068859_10000003846 | 224 |
| 301 | 3300005618 | Ga0068864_100018025 | Ga0068864_1000180253 | 224 |
| 302 | 3300005841 | Ga0068863_100040421 | Ga0068863_1000404212 | 224 |
| 303 | 3300005842 | Ga0068858_100102644 | Ga0068858_1001026442 | 224 |
| 304 | 3300005937 | Ga0081455_10006035 | Ga0081455_100060355 | 224 |
| 305 | 3300005937 | Ga0081455_10030553 | Ga0081455_100305533 | 224 |
| 306 | 3300006163 | Ga0070715_10224975 | Ga0070715_102249752 | 224 |
| 307 | 3300006237 | Ga0097621_100269133 | Ga0097621_1002691333 | 224 |
| 308 | 3300006237 | Ga0097621_101007708 | Ga0097621_1010077081 | 224 |
| 309 | 3300006358 | Ga0068871_100546119 | Ga0068871_1005461191 | 224 |
| 310 | 3300006931 | Ga0097620_100000038 | Ga0097620_10000003846 | 224 |
| 311 | 3300009093 | Ga0105240_10208176 | Ga0105240_102081762 | 224 |
| 312 | 3300009094 | Ga0111539_10003567 | Ga0111539_1000356712 | 224 |
| 313 | 3300009101 | Ga0105247_10161478 | Ga0105247_101614782 | 224 |
| 314 | 3300009177 | Ga0105248_10218675 | Ga0105248_102186752 | 224 |
| 315 | 3300013296 | Ga0157374_10046247 | Ga0157374_100462473 | 224 |
| 316 | 3300013297 | Ga0157378_10799018 | Ga0157378_107990181 | 224 |
| 317 | 3300013306 | Ga0163162_10697674 | Ga0163162_106976742 | 224 |
| 318 | 3300014325 | Ga0163163_10023264 | Ga0163163_100232643 | 224 |
| 319 | 3300014969 | Ga0157376_10024295 | Ga0157376_100242954 | 224 |
| 320 | 3300025903 | Ga0207680_10104097 | Ga0207680_101040972 | 224 |
| 321 | 3300025905 | Ga0207685_10319980 | Ga0207685_103199801 | 224 |
| 322 | 3300025910 | Ga0207684_10010625 | Ga0207684_100106257 | 224 |
| 323 | 3300025925 | Ga0207650_10218693 | Ga0207650_102186932 | 224 |
| 324 | 3300025926 | Ga0207659_10012073 | Ga0207659_100120734 | 224 |
| 325 | 3300025931 | Ga0207644_10213990 | Ga0207644_102139902 | 224 |
| 326 | 3300025939 | Ga0207665_10132188 | Ga0207665_101321882 | 224 |
| 327 | 3300025944 | Ga0207661_10590958 | Ga0207661_105909581 | 224 |
| 328 | 3300025960 | Ga0207651_10042485 | Ga0207651_100424853 | 224 |
| 329 | 3300026023 | Ga0207677_10056480 | Ga0207677_100564802 | 224 |
| 330 | 3300026035 | Ga0207703_10208521 | Ga0207703_102085212 | 224 |
| 331 | 3300026035 | Ga0207703_10288213 | Ga0207703_102882132 | 224 |
| 332 | 3300026121 | Ga0207683_10001130 | Ga0207683_100011302 | 224 |
| 333 | 3300028379 | Ga0268266_10150272 | Ga0268266_101502722 | 224 |
| 334 | 3300028379 | Ga0268266_10215085 | Ga0268266_102150852 | 224 |
| 335 | 3300032004 | Ga0307414_10318589 | Ga0307414_103185892 | 224 |
| 336 | 3300037312 | Ga0395899_0157168 | Ga0395899_0157168_683_1366 | 224 |
| 337 | 3300037418 | Ga0395900_0005116 | Ga0395900_0005116_7980_8663 | 224 |
| 338 | 3300037418 | Ga0395900_0170690 | Ga0395900_0170690_120_803 | 224 |
| 339 | 3300037466 | Ga0395898_0005956 | Ga0395898_0005956_238_921 | 224 |
| 340 | 3300037471 | Ga0395905_0088257 | Ga0395905_0088257_2176_2859 | 224 |
| 341 | 3300038443 | Ga0395901_0001211 | Ga0395901_0001211_22360_23043 | 224 |
| 342 | 3300049574 | Ga0501038_0001708 | Ga0501038_0001708_5263_5970 | 224 |
| 343 | 3300049742 | Ga0501080_0302718 | Ga0501080_0302718_362_1042 | 224 |
| 344 | 3300050507 | nmdc:mga05p37_917302_c1 | nmdc:mga05p37_917302_c1_154_834 | 224 |
| 345 | 3300050511 | nmdc:mga08y16_25666_c1 | nmdc:mga08y16_25666_c1_5008_5688 | 224 |
| 346 | 3300053153 | Ga0500616_0001787 | Ga0500616_0001787_2588_3271 | 224 |
| 347 | 3300053153 | Ga0500616_0195740 | Ga0500616_0195740_63_809 | 224 |
| 348 | 3300005471 | Ga0070698_100362291 | Ga0070698_1003622911 | 225 |
| 349 | 3300005536 | Ga0070697_100294857 | Ga0070697_1002948571 | 225 |
| 350 | 3300009545 | Ga0105237_10460773 | Ga0105237_104607732 | 225 |
| 351 | 3300025934 | Ga0207686_10181648 | Ga0207686_101816482 | 225 |
| 352 | 3300030521 | Ga0307511_10002085 | Ga0307511_100020854 | 225 |
| 353 | 3300032004 | Ga0307414_10000015 | Ga0307414_10000015227 | 225 |
| 354 | 3300005355 | Ga0070671_100135178 | Ga0070671_1001351782 | 226 |
| 355 | 3300005445 | Ga0070708_100215155 | Ga0070708_1002151552 | 226 |
| 356 | 3300005467 | Ga0070706_100001662 | Ga0070706_10000166218 | 226 |
| 357 | 3300005467 | Ga0070706_100214755 | Ga0070706_1002147552 | 226 |
| 358 | 3300005468 | Ga0070707_100159499 | Ga0070707_1001594991 | 226 |
| 359 | 3300005468 | Ga0070707_100319899 | Ga0070707_1003198991 | 226 |
| 360 | 3300005471 | Ga0070698_100026402 | Ga0070698_1000264021 | 226 |
| 361 | 3300005471 | Ga0070698_100029808 | Ga0070698_1000298082 | 226 |
| 362 | 3300005536 | Ga0070697_100011674 | Ga0070697_1000116743 | 226 |
| 363 | 3300005536 | Ga0070697_100320805 | Ga0070697_1003208052 | 226 |
| 364 | 3300005981 | Ga0081538_10088579 | Ga0081538_100885792 | 226 |
| 365 | 3300009093 | Ga0105240_10000550 | Ga0105240_1000055056 | 226 |
| 366 | 3300010375 | Ga0105239_10106245 | Ga0105239_101062452 | 226 |
| 367 | 3300013297 | Ga0157378_10166322 | Ga0157378_101663222 | 226 |
| 368 | 3300013307 | Ga0157372_10472634 | Ga0157372_104726342 | 226 |
| 369 | 3300025910 | Ga0207684_10001013 | Ga0207684_1000101318 | 226 |
| 370 | 3300025913 | Ga0207695_10000644 | Ga0207695_1000064456 | 226 |
| 371 | 3300025922 | Ga0207646_10015828 | Ga0207646_100158285 | 226 |
| 372 | 3300025922 | Ga0207646_10177010 | Ga0207646_101770101 | 226 |
| 373 | 3300025931 | Ga0207644_10132992 | Ga0207644_101329922 | 226 |
| 374 | 3300037068 | Ga0373925_0370601 | Ga0373925_0370601_443_1138 | 226 |
| 375 | 3300045051 | Ga0451576_0039281 | Ga0451576_0039281_4035_4736 | 226 |
| 376 | 3300048916 | Ga0496113_0236857 | Ga0496113_0236857_361_1044 | 226 |
| 377 | 3300049573 | Ga0501037_0269392 | Ga0501037_0269392_453_1142 | 226 |
| 378 | 3300049581 | Ga0501047_0009905 | Ga0501047_0009905_501_1190 | 226 |
| 379 | 3300049583 | Ga0501067_0153153 | Ga0501067_0153153_100_783 | 226 |
| 380 | 3300049585 | Ga0501069_0278626 | Ga0501069_0278626_135_818 | 226 |
| 381 | 3300049823 | Ga0501044_0008540 | Ga0501044_0008540_6462_7151 | 226 |
| 382 | 3300053087 | Ga0500643_020371 | Ga0500643_020371_1257_1940 | 226 |
| 383 | 3300053103 | Ga0500555_000015 | Ga0500555_000015_208463_209146 | 226 |
| 384 | 3300002077 | JGI24744J21845_10002414 | JGI24744J21845_100024141 | 227 |
| 385 | 3300003320 | rootH2_10046583 | rootH2_100465838 | 227 |
| 386 | 3300003320 | rootH2_10083206 | rootH2_100832062 | 227 |
| 387 | 3300005328 | Ga0070676_10183353 | Ga0070676_101833532 | 227 |
| 388 | 3300005330 | Ga0070690_100029800 | Ga0070690_1000298002 | 227 |
| 389 | 3300005330 | Ga0070690_100110784 | Ga0070690_1001107842 | 227 |
| 390 | 3300005331 | Ga0070670_100008244 | Ga0070670_1000082447 | 227 |
| 391 | 3300005331 | Ga0070670_100059560 | Ga0070670_1000595602 | 227 |
| 392 | 3300005335 | Ga0070666_10002759 | Ga0070666_100027598 | 227 |
| 393 | 3300005335 | Ga0070666_10065992 | Ga0070666_100659921 | 227 |
| 394 | 3300005347 | Ga0070668_100000836 | Ga0070668_1000008365 | 227 |
| 395 | 3300005347 | Ga0070668_100014821 | Ga0070668_1000148214 | 227 |
| 396 | 3300005353 | Ga0070669_100002894 | Ga0070669_1000028946 | 227 |
| 397 | 3300005355 | Ga0070671_100001471 | Ga0070671_1000014719 | 227 |
| 398 | 3300005355 | Ga0070671_100008133 | Ga0070671_1000081334 | 227 |
| 399 | 3300005356 | Ga0070674_100002811 | Ga0070674_1000028118 | 227 |
| 400 | 3300005356 | Ga0070674_100176804 | Ga0070674_1001768042 | 227 |
| 401 | 3300005364 | Ga0070673_100039083 | Ga0070673_1000390834 | 227 |
| 402 | 3300005365 | Ga0070688_100011577 | Ga0070688_1000115772 | 227 |
| 403 | 3300005367 | Ga0070667_100010302 | Ga0070667_1000103024 | 227 |
| 404 | 3300005456 | Ga0070678_100002623 | Ga0070678_1000026232 | 227 |
| 405 | 3300005456 | Ga0070678_100101567 | Ga0070678_1001015672 | 227 |
| 406 | 3300005457 | Ga0070662_100465726 | Ga0070662_1004657261 | 227 |
| 407 | 3300005457 | Ga0070662_100585328 | Ga0070662_1005853281 | 227 |
| 408 | 3300005466 | Ga0070685_10037690 | Ga0070685_100376902 | 227 |
| 409 | 3300005471 | Ga0070698_100207785 | Ga0070698_1002077851 | 227 |
| 410 | 3300005536 | Ga0070697_100015653 | Ga0070697_1000156534 | 227 |
| 411 | 3300005543 | Ga0070672_100033406 | Ga0070672_1000334063 | 227 |
| 412 | 3300005548 | Ga0070665_100000149 | Ga0070665_10000014978 | 227 |
| 413 | 3300005548 | Ga0070665_100078522 | Ga0070665_1000785222 | 227 |
| 414 | 3300005564 | Ga0070664_100060567 | Ga0070664_1000605671 | 227 |
| 415 | 3300005564 | Ga0070664_100202533 | Ga0070664_1002025332 | 227 |
| 416 | 3300005618 | Ga0068864_100075299 | Ga0068864_1000752992 | 227 |
| 417 | 3300005841 | Ga0068863_100001041 | Ga0068863_1000010412 | 227 |
| 418 | 3300005842 | Ga0068858_100043959 | Ga0068858_1000439593 | 227 |
| 419 | 3300005842 | Ga0068858_100153831 | Ga0068858_1001538312 | 227 |
| 420 | 3300005844 | Ga0068862_100024112 | Ga0068862_1000241123 | 227 |
| 421 | 3300006175 | Ga0070712_100219297 | Ga0070712_1002192972 | 227 |
| 422 | 3300006237 | Ga0097621_100054463 | Ga0097621_1000544631 | 227 |
| 423 | 3300006358 | Ga0068871_100014049 | Ga0068871_1000140493 | 227 |
| 424 | 3300006358 | Ga0068871_100156598 | Ga0068871_1001565982 | 227 |
| 425 | 3300006881 | Ga0068865_100160251 | Ga0068865_1001602512 | 227 |
| 426 | 3300009093 | Ga0105240_10018350 | Ga0105240_100183502 | 227 |
| 427 | 3300009147 | Ga0114129_11299423 | Ga0114129_112994231 | 227 |
| 428 | 3300013296 | Ga0157374_10001798 | Ga0157374_100017989 | 227 |
| 429 | 3300013296 | Ga0157374_10072924 | Ga0157374_100729243 | 227 |
| 430 | 3300013297 | Ga0157378_10044813 | Ga0157378_100448133 | 227 |
| 431 | 3300013297 | Ga0157378_10057599 | Ga0157378_100575992 | 227 |
| 432 | 3300013297 | Ga0157378_10058710 | Ga0157378_100587103 | 227 |
| 433 | 3300013297 | Ga0157378_10139072 | Ga0157378_101390721 | 227 |
| 434 | 3300013306 | Ga0163162_10002102 | Ga0163162_1000210215 | 227 |
| 435 | 3300013308 | Ga0157375_10003368 | Ga0157375_100033687 | 227 |
| 436 | 3300013308 | Ga0157375_10622198 | Ga0157375_106221982 | 227 |
| 437 | 3300014325 | Ga0163163_10153049 | Ga0163163_101530493 | 227 |
| 438 | 3300014969 | Ga0157376_10580482 | Ga0157376_105804821 | 227 |
| 439 | 3300025290 | Ga0207673_1019275 | Ga0207673_10192751 | 227 |
| 440 | 3300025315 | Ga0207697_10000118 | Ga0207697_1000011818 | 227 |
| 441 | 3300025315 | Ga0207697_10017742 | Ga0207697_100177423 | 227 |
| 442 | 3300025903 | Ga0207680_10015363 | Ga0207680_100153632 | 227 |
| 443 | 3300025903 | Ga0207680_10051110 | Ga0207680_100511103 | 227 |
| 444 | 3300025907 | Ga0207645_10004461 | Ga0207645_100044619 | 227 |
| 445 | 3300025907 | Ga0207645_10178664 | Ga0207645_101786641 | 227 |
| 446 | 3300025910 | Ga0207684_10060574 | Ga0207684_100605743 | 227 |
| 447 | 3300025913 | Ga0207695_10024472 | Ga0207695_100244727 | 227 |
| 448 | 3300025915 | Ga0207693_10046005 | Ga0207693_100460054 | 227 |
| 449 | 3300025922 | Ga0207646_10182156 | Ga0207646_101821562 | 227 |
| 450 | 3300025926 | Ga0207659_10072530 | Ga0207659_100725302 | 227 |
| 451 | 3300025931 | Ga0207644_10003472 | Ga0207644_100034723 | 227 |
| 452 | 3300025933 | Ga0207706_10283195 | Ga0207706_102831951 | 227 |
| 453 | 3300025936 | Ga0207670_10079767 | Ga0207670_100797672 | 227 |
| 454 | 3300025940 | Ga0207691_10000359 | Ga0207691_1000035914 | 227 |
| 455 | 3300025940 | Ga0207691_10058924 | Ga0207691_100589242 | 227 |
| 456 | 3300025945 | Ga0207679_10171966 | Ga0207679_101719662 | 227 |
| 457 | 3300025945 | Ga0207679_10411883 | Ga0207679_104118832 | 227 |
| 458 | 3300025960 | Ga0207651_10023014 | Ga0207651_100230142 | 227 |
| 459 | 3300025960 | Ga0207651_10051902 | Ga0207651_100519024 | 227 |
| 460 | 3300025972 | Ga0207668_10488251 | Ga0207668_104882512 | 227 |
| 461 | 3300025986 | Ga0207658_10121627 | Ga0207658_101216272 | 227 |
| 462 | 3300026088 | Ga0207641_10003812 | Ga0207641_100038126 | 227 |
| 463 | 3300026089 | Ga0207648_10002123 | Ga0207648_100021237 | 227 |
| 464 | 3300026121 | Ga0207683_10026280 | Ga0207683_100262804 | 227 |
| 465 | 3300026121 | Ga0207683_10234296 | Ga0207683_102342962 | 227 |
| 466 | 3300028379 | Ga0268266_10000157 | Ga0268266_1000015774 | 227 |
| 467 | 3300028379 | Ga0268266_10002775 | Ga0268266_1000277519 | 227 |
| 468 | 3300028379 | Ga0268266_10035345 | Ga0268266_100353453 | 227 |
| 469 | 3300028380 | Ga0268265_10039102 | Ga0268265_100391023 | 227 |
| 470 | 3300035170 | Ga0373943_0245608 | Ga0373943_0245608_170_853 | 227 |
| 471 | 3300036401 | Ga0373937_0542395 | Ga0373937_0542395_174_857 | 227 |
| 472 | 3300048907 | Ga0496104_0436756 | Ga0496104_0436756_338_1021 | 227 |
| 473 | 3300048911 | Ga0496108_0062750 | Ga0496108_0062750_217_900 | 227 |
| 474 | 3300048915 | Ga0496112_0081502 | Ga0496112_0081502_818_1501 | 227 |
| 475 | 3300048917 | Ga0496114_0843477 | Ga0496114_0843477_52_735 | 227 |
| 476 | 3300049573 | Ga0501037_0045111 | Ga0501037_0045111_161_853 | 227 |
| 477 | 3300049579 | Ga0501043_0083134 | Ga0501043_0083134_731_1423 | 227 |
| 478 | 3300049581 | Ga0501047_0049179 | Ga0501047_0049179_1668_2360 | 227 |
| 479 | 3300049742 | Ga0501080_0005607 | Ga0501080_0005607_5347_6033 | 227 |
| 480 | 3300049822 | Ga0501035_0086999 | Ga0501035_0086999_123_815 | 227 |
| 481 | 3300049823 | Ga0501044_0258964 | Ga0501044_0258964_12_704 | 227 |
| 482 | 3300050493 | nmdc:mga0k408_337755_c1 | nmdc:mga0k408_337755_c1_160_849 | 227 |
| 483 | 3300050507 | nmdc:mga05p37_1321216_c1 | nmdc:mga05p37_1321216_c1_35_718 | 227 |
| 484 | 3300050511 | nmdc:mga08y16_402222_c1 | nmdc:mga08y16_402222_c1_702_1385 | 227 |
| 485 | 3300053119 | Ga0500595_020650 | Ga0500595_020650_886_1590 | 227 |
| 486 | 3300053140 | Ga0500573_0244258 | Ga0500573_0244258_154_858 | 227 |
| 487 | 3300053153 | Ga0500616_0003083 | Ga0500616_0003083_11204_11896 | 227 |
| 488 | 3300053153 | Ga0500616_0005407 | Ga0500616_0005407_1116_1802 | 227 |
| 489 | 3300053730 | Ga0500645_005103 | Ga0500645_005103_209_901 | 227 |
| 490 | 3300000545 | CNXas_1000020 | CNXas_100002032 | 228 |
| 491 | 3300003203 | JGI25406J46586_10014367 | JGI25406J46586_100143673 | 228 |
| 492 | 3300003320 | rootH2_10002220 | rootH2_100022201 | 228 |
| 493 | 3300003320 | rootH2_10004478 | rootH2_100044788 | 228 |
| 494 | 3300003322 | rootL2_10028108 | rootL2_100281086 | 228 |
| 495 | 3300003322 | rootL2_10029640 | rootL2_100296402 | 228 |
| 496 | 3300005293 | Ga0065715_10268209 | Ga0065715_102682092 | 228 |
| 497 | 3300005327 | Ga0070658_10010619 | Ga0070658_100106194 | 228 |
| 498 | 3300005328 | Ga0070676_10002545 | Ga0070676_100025452 | 228 |
| 499 | 3300005328 | Ga0070676_10080538 | Ga0070676_100805381 | 228 |
| 500 | 3300005330 | Ga0070690_100038332 | Ga0070690_1000383324 | 228 |
| 501 | 3300005330 | Ga0070690_100658173 | Ga0070690_1006581731 | 228 |
| 502 | 3300005331 | Ga0070670_100083360 | Ga0070670_1000833602 | 228 |
| 503 | 3300005334 | Ga0068869_100197360 | Ga0068869_1001973602 | 228 |
| 504 | 3300005335 | Ga0070666_10078025 | Ga0070666_100780252 | 228 |
| 505 | 3300005335 | Ga0070666_10505728 | Ga0070666_105057281 | 228 |
| 506 | 3300005339 | Ga0070660_100066451 | Ga0070660_1000664511 | 228 |
| 507 | 3300005340 | Ga0070689_100121130 | Ga0070689_1001211302 | 228 |
| 508 | 3300005344 | Ga0070661_100003792 | Ga0070661_1000037926 | 228 |
| 509 | 3300005347 | Ga0070668_100019936 | Ga0070668_1000199362 | 228 |
| 510 | 3300005347 | Ga0070668_100069743 | Ga0070668_1000697434 | 228 |
| 511 | 3300005353 | Ga0070669_100008324 | Ga0070669_1000083243 | 228 |
| 512 | 3300005354 | Ga0070675_100100817 | Ga0070675_1001008173 | 228 |
| 513 | 3300005355 | Ga0070671_100014737 | Ga0070671_1000147373 | 228 |
| 514 | 3300005367 | Ga0070667_100007673 | Ga0070667_1000076737 | 228 |
| 515 | 3300005435 | Ga0070714_100135602 | Ga0070714_1001356022 | 228 |
| 516 | 3300005445 | Ga0070708_100206735 | Ga0070708_1002067352 | 228 |
| 517 | 3300005445 | Ga0070708_100551578 | Ga0070708_1005515781 | 228 |
| 518 | 3300005457 | Ga0070662_100008638 | Ga0070662_1000086389 | 228 |
| 519 | 3300005459 | Ga0068867_100035645 | Ga0068867_1000356454 | 228 |
| 520 | 3300005468 | Ga0070707_100000728 | Ga0070707_1000007287 | 228 |
| 521 | 3300005518 | Ga0070699_100066584 | Ga0070699_1000665842 | 228 |
| 522 | 3300005536 | Ga0070697_100036425 | Ga0070697_1000364254 | 228 |
| 523 | 3300005536 | Ga0070697_100095222 | Ga0070697_1000952222 | 228 |
| 524 | 3300005539 | Ga0068853_100000019 | Ga0068853_10000001920 | 228 |
| 525 | 3300005539 | Ga0068853_100173445 | Ga0068853_1001734452 | 228 |
| 526 | 3300005543 | Ga0070672_100039902 | Ga0070672_1000399023 | 228 |
| 527 | 3300005548 | Ga0070665_100590118 | Ga0070665_1005901182 | 228 |
| 528 | 3300005563 | Ga0068855_100002454 | Ga0068855_10000245413 | 228 |
| 529 | 3300005564 | Ga0070664_100006182 | Ga0070664_1000061824 | 228 |
| 530 | 3300005577 | Ga0068857_100462146 | Ga0068857_1004621461 | 228 |
| 531 | 3300005842 | Ga0068858_100105367 | Ga0068858_1001053672 | 228 |
| 532 | 3300005843 | Ga0068860_100000488 | Ga0068860_10000048853 | 228 |
| 533 | 3300005844 | Ga0068862_100087197 | Ga0068862_1000871972 | 228 |
| 534 | 3300005937 | Ga0081455_10126934 | Ga0081455_101269342 | 228 |
| 535 | 3300005985 | Ga0081539_10000971 | Ga0081539_1000097114 | 228 |
| 536 | 3300006028 | Ga0070717_10008409 | Ga0070717_100084096 | 228 |
| 537 | 3300006173 | Ga0070716_100138642 | Ga0070716_1001386422 | 228 |
| 538 | 3300006177 | Ga0075362_10043915 | Ga0075362_100439152 | 228 |
| 539 | 3300006178 | Ga0075367_10187604 | Ga0075367_101876042 | 228 |
| 540 | 3300006195 | Ga0075366_10180962 | Ga0075366_101809622 | 228 |
| 541 | 3300006237 | Ga0097621_100074387 | Ga0097621_1000743872 | 228 |
| 542 | 3300006237 | Ga0097621_100092498 | Ga0097621_1000924982 | 228 |
| 543 | 3300006358 | Ga0068871_100042774 | Ga0068871_1000427743 | 228 |
| 544 | 3300006871 | Ga0075434_100992486 | Ga0075434_1009924861 | 228 |
| 545 | 3300006881 | Ga0068865_100073996 | Ga0068865_1000739963 | 228 |
| 546 | 3300009094 | Ga0111539_10175676 | Ga0111539_101756762 | 228 |
| 547 | 3300009098 | Ga0105245_10314670 | Ga0105245_103146702 | 228 |
| 548 | 3300009148 | Ga0105243_10000049 | Ga0105243_1000004962 | 228 |
| 549 | 3300009176 | Ga0105242_10006298 | Ga0105242_100062989 | 228 |
| 550 | 3300009545 | Ga0105237_10016884 | Ga0105237_100168844 | 228 |
| 551 | 3300010375 | Ga0105239_10023770 | Ga0105239_100237704 | 228 |
| 552 | 3300010375 | Ga0105239_10892810 | Ga0105239_108928101 | 228 |
| 553 | 3300013102 | Ga0157371_10306208 | Ga0157371_103062082 | 228 |
| 554 | 3300013296 | Ga0157374_10000028 | Ga0157374_1000002878 | 228 |
| 555 | 3300013296 | Ga0157374_10020178 | Ga0157374_100201785 | 228 |
| 556 | 3300013296 | Ga0157374_10028926 | Ga0157374_100289263 | 228 |
| 557 | 3300013297 | Ga0157378_10008102 | Ga0157378_100081028 | 228 |
| 558 | 3300013297 | Ga0157378_10147206 | Ga0157378_101472062 | 228 |
| 559 | 3300013297 | Ga0157378_10189601 | Ga0157378_101896013 | 228 |
| 560 | 3300013306 | Ga0163162_10023532 | Ga0163162_100235323 | 228 |
| 561 | 3300013307 | Ga0157372_10150807 | Ga0157372_101508073 | 228 |
| 562 | 3300013308 | Ga0157375_10008590 | Ga0157375_100085906 | 228 |
| 563 | 3300014969 | Ga0157376_10000994 | Ga0157376_1000099421 | 228 |
| 564 | 3300014969 | Ga0157376_10327800 | Ga0157376_103278002 | 228 |
| 565 | 3300025298 | Ga0209050_1002359 | Ga0209050_100235913 | 228 |
| 566 | 3300025315 | Ga0207697_10001277 | Ga0207697_100012774 | 228 |
| 567 | 3300025903 | Ga0207680_10162745 | Ga0207680_101627452 | 228 |
| 568 | 3300025907 | Ga0207645_10002506 | Ga0207645_100025068 | 228 |
| 569 | 3300025909 | Ga0207705_10058601 | Ga0207705_100586012 | 228 |
| 570 | 3300025910 | Ga0207684_10015915 | Ga0207684_100159152 | 228 |
| 571 | 3300025910 | Ga0207684_10017151 | Ga0207684_100171513 | 228 |
| 572 | 3300025913 | Ga0207695_10123090 | Ga0207695_101230903 | 228 |
| 573 | 3300025914 | Ga0207671_10021637 | Ga0207671_100216372 | 228 |
| 574 | 3300025919 | Ga0207657_10032943 | Ga0207657_100329433 | 228 |
| 575 | 3300025920 | Ga0207649_10019063 | Ga0207649_100190633 | 228 |
| 576 | 3300025922 | Ga0207646_10012322 | Ga0207646_100123225 | 228 |
| 577 | 3300025922 | Ga0207646_10358323 | Ga0207646_103583232 | 228 |
| 578 | 3300025925 | Ga0207650_10085099 | Ga0207650_100850992 | 228 |
| 579 | 3300025925 | Ga0207650_10176949 | Ga0207650_101769492 | 228 |
| 580 | 3300025926 | Ga0207659_10042972 | Ga0207659_100429723 | 228 |
| 581 | 3300025926 | Ga0207659_10226522 | Ga0207659_102265221 | 228 |
| 582 | 3300025927 | Ga0207687_10517146 | Ga0207687_105171462 | 228 |
| 583 | 3300025933 | Ga0207706_10001810 | Ga0207706_100018109 | 228 |
| 584 | 3300025934 | Ga0207686_10113499 | Ga0207686_101134992 | 228 |
| 585 | 3300025935 | Ga0207709_10000097 | Ga0207709_1000009792 | 228 |
| 586 | 3300025936 | Ga0207670_10085737 | Ga0207670_100857372 | 228 |
| 587 | 3300025939 | Ga0207665_10000279 | Ga0207665_100002792 | 228 |
| 588 | 3300025945 | Ga0207679_10000726 | Ga0207679_1000072620 | 228 |
| 589 | 3300025949 | Ga0207667_10001763 | Ga0207667_1000176313 | 228 |
| 590 | 3300025961 | Ga0207712_10079511 | Ga0207712_100795112 | 228 |
| 591 | 3300025972 | Ga0207668_10001824 | Ga0207668_100018245 | 228 |
| 592 | 3300025986 | Ga0207658_10015807 | Ga0207658_100158076 | 228 |
| 593 | 3300025986 | Ga0207658_10023292 | Ga0207658_100232922 | 228 |
| 594 | 3300026023 | Ga0207677_10091314 | Ga0207677_100913143 | 228 |
| 595 | 3300026041 | Ga0207639_10000032 | Ga0207639_1000003221 | 228 |
| 596 | 3300026089 | Ga0207648_10050196 | Ga0207648_100501963 | 228 |
| 597 | 3300026089 | Ga0207648_10134627 | Ga0207648_101346272 | 228 |
| 598 | 3300026089 | Ga0207648_10590316 | Ga0207648_105903162 | 228 |
| 599 | 3300028379 | Ga0268266_10479960 | Ga0268266_104799601 | 228 |
| 600 | 3300028380 | Ga0268265_10982271 | Ga0268265_109822711 | 228 |
| 601 | 3300028381 | Ga0268264_10000730 | Ga0268264_1000073030 | 228 |
| 602 | 3300031251 | Ga0265327_10000878 | Ga0265327_1000087839 | 228 |
| 603 | 3300031344 | Ga0265316_10033091 | Ga0265316_100330912 | 228 |
| 604 | 3300031456 | Ga0307513_10164379 | Ga0307513_101643792 | 228 |
| 605 | 3300031548 | Ga0307408_100000021 | Ga0307408_10000002133 | 228 |
| 606 | 3300031548 | Ga0307408_100001793 | Ga0307408_10000179312 | 228 |
| 607 | 3300031901 | Ga0307406_10000117 | Ga0307406_1000011718 | 228 |
| 608 | 3300031903 | Ga0307407_10000218 | Ga0307407_1000021821 | 228 |
| 609 | 3300031911 | Ga0307412_10000127 | Ga0307412_1000012734 | 228 |
| 610 | 3300031911 | Ga0307412_10390961 | Ga0307412_103909611 | 228 |
| 611 | 3300031995 | Ga0307409_100001120 | Ga0307409_10000112013 | 228 |
| 612 | 3300032002 | Ga0307416_100020725 | Ga0307416_1000207255 | 228 |
| 613 | 3300032004 | Ga0307414_10281790 | Ga0307414_102817902 | 228 |
| 614 | 3300032126 | Ga0307415_100275351 | Ga0307415_1002753512 | 228 |
| 615 | 3300035725 | Ga0373947_0021763 | Ga0373947_0021763_1212_1916 | 228 |
| 616 | 3300039437 | Ga0436365_0155704 | Ga0436365_0155704_5500_6216 | 228 |
| 617 | 3300041408 | Ga0439453_0002049 | Ga0439453_0002049_1568_2269 | 228 |
| 618 | 3300042127 | Ga0450890_000103 | Ga0450890_000103_11813_12514 | 228 |
| 619 | 3300042129 | Ga0450891_000326 | Ga0450891_000326_1284_1985 | 228 |
| 620 | 3300042144 | Ga0450889_013135 | Ga0450889_013135_22_723 | 228 |
| 621 | 3300042532 | Ga0450893_0000014 | Ga0450893_0000014_4684_5385 | 228 |
| 622 | 3300045051 | Ga0451576_0022372 | Ga0451576_0022372_1500_2207 | 228 |
| 623 | 3300048915 | Ga0496112_0028358 | Ga0496112_0028358_3942_4640 | 228 |
| 624 | 3300048928 | Ga0496125_0322375 | Ga0496125_0322375_138_842 | 228 |
| 625 | 3300049569 | Ga0501032_0008182 | Ga0501032_0008182_570_1268 | 228 |
| 626 | 3300049586 | Ga0501070_0326627 | Ga0501070_0326627_55_753 | 228 |
| 627 | 3300049665 | Ga0501227_002158 | Ga0501227_002158_1842_2531 | 228 |
| 628 | 3300049742 | Ga0501080_0046191 | Ga0501080_0046191_2521_3213 | 228 |
| 629 | 3300050489 | nmdc:mga03683_37261_c1 | nmdc:mga03683_37261_c1_564_1250 | 228 |
| 630 | 3300050493 | nmdc:mga0k408_60713_c1 | nmdc:mga0k408_60713_c1_1306_1992 | 228 |
| 631 | 3300050510 | nmdc:mga06r32_492094_c1 | nmdc:mga06r32_492094_c1_181_894 | 228 |
| 632 | 3300050511 | nmdc:mga08y16_763614_c1 | nmdc:mga08y16_763614_c1_197_892 | 228 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ebb-assembly1.cif.gz_A | bacillus stearothermophilus yhfr | 0.9466 | 3 | 204 |
| 4ij6-assembly1.cif.gz_B | crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine | 0.9427 | 3 | 203 |
| 4ij5-assembly1.cif.gz_B | crystal structure of a novel-type phosphoserine phosphatase from <i>hydrogenobacter thermophilus</i> tk-6 | 0.9398 | 3 | 203 |
| 1ebb-assembly1.cif.gz_A | bacillus stearothermophilus yhfr | 0.9376 | 3 | 204 |
| 4ij6-assembly1.cif.gz_B | crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine | 0.9205 | 3 | 203 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WLH5_165_364_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.9515 | 4 | 202 | 3.40.50.1240 |
| 1ebbA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.9466 | 3 | 204 | 3.40.50.1240 |
| 4ij6B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.9427 | 3 | 203 | 3.40.50.1240 |
| af_P9WLH5_165_364_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.9377 | 4 | 202 | 3.40.50.1240 |
| 1ebbA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.9376 | 3 | 204 | 3.40.50.1240 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838TMC7-F1-model_v4 | Histidine phosphatase family protein | 0.9949 | 3 | 164 |
GO:0005737
GO:0016791 |
| AF-A0A2V7WJG4-F1-model_v4 | Histidine phosphatase family protein | 0.9935 | 3 | 202 |
GO:0005737
GO:0016791 |
| AF-A0A2V5YYY0-F1-model_v4 | Histidine phosphatase family protein | 0.9921 | 2 | 206 |
GO:0016791
|
| AF-A0A0S7X131-F1-model_v4 | Alpha-ribazole phosphatase (EC 3.1.3.73) | 0.9827 | 2 | 198 |
GO:0009236
GO:0043755 |
| AF-A0A0K1Q737-F1-model_v4 | Alpha-ribazole-5'-phosphate phosphatase | 0.9821 | 1 | 220 |
GO:0005737
GO:0016791 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar