F470938

General Info

Members Datasets Scaffolds Average Seq Length
631 292 1262 242

Family's Representative Sequence

Representative Sequence 3300035170|Ga0373943_0106745|Ga0373943_0106745_626_1414
Length 262
Sequence MAVAPRHLRQHAAGSALMAEPLLHVDNLGKRFGGFVALDGINLSVQPGERVGLIGPNGSGKSTLVNCMCGTLHNETGTVRFDGQIVDGLAANQRTHRGMARSFQLPRPFHTLSVAENLRIPLLFTAHSRSGRHLTRDESESRCHELAGLVGLSAKANKLPRDLTQVEMRKLELARAMAADPKLLIADEAMAGLSQSEVTDIVDLLIKLNERGVTIILIEHIMRAVMSFSQRLVVLVSGKKIADGAPDQVVNTREVIGAYLGE

Samples

Sample ID Description Type Environment
1 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
134 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
135 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
138 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
141 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
156 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
157 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
158 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
159 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
162 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
163 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
166 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
180 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
183 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
184 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
185 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
186 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
187 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
190 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
212 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
255 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
263 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
269 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
277 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
278 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
279 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
283 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
284 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
285 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
286 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
287 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
288 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
289 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
290 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
292 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.77
Nodule 0
Rhizoplane 3.49
Rhizosphere 87.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373943_0106745 3300035170 Bacteria 1472
2 JGI25406J46586_10007267 3300003203 Bacteria 5065
3 JGI25153J46596_10001658 3300003215 Bacteria 13194
4 JGI25405J52794_10001500 3300003911 Bacteria 3856
5 Ga0070658_10020347 3300005327 Bacteria 5318
6 Ga0070676_10081315 3300005328 Bacteria 1966
7 Ga0070676_10218046 3300005328 Bacteria 1259
8 Ga0070690_100009684 3300005330 Bacteria 5588
9 Ga0070680_100005498 3300005336 Bacteria 9590
10 Ga0070680_100044708 3300005336 Bacteria 3599
11 Ga0070680_100057211 3300005336 Bacteria 3188
12 Ga0068868_100129277 3300005338 Bacteria 2066
13 Ga0070660_100500543 3300005339 Bacteria 1011
14 Ga0070660_100544148 3300005339 Bacteria 968
15 Ga0070689_100004975 3300005340 Bacteria 9028
16 Ga0070689_100218907 3300005340 Bacteria 1561
17 Ga0070689_100534924 3300005340 Bacteria 1008
18 Ga0070687_100231756 3300005343 Bacteria 1137
19 Ga0070668_100392158 3300005347 Bacteria 1184
20 Ga0070669_100103416 3300005353 Bacteria 2152
21 Ga0070675_100110130 3300005354 Bacteria 2328
22 Ga0070671_100333169 3300005355 Bacteria 1294
23 Ga0070674_100031325 3300005356 Bacteria 3524
24 Ga0070688_100005526 3300005365 Bacteria 6671
25 Ga0070667_100459505 3300005367 Bacteria 1164
26 Ga0070703_10015714 3300005406 Bacteria 2168
27 Ga0070709_10375446 3300005434 Bacteria 1056
28 Ga0070714_100551888 3300005435 Bacteria 1103
29 Ga0070713_100228082 3300005436 Bacteria 1692
30 Ga0070713_100285279 3300005436 Bacteria 1516
31 Ga0070713_100902943 3300005436 Bacteria 850
32 Ga0070711_100047935 3300005439 Bacteria 2919
33 Ga0070700_100235692 3300005441 Bacteria 1305
34 Ga0070694_100088041 3300005444 Bacteria 2173
35 Ga0070694_100101824 3300005444 Bacteria 2033
36 Ga0070708_100020159 3300005445 Bacteria 5617
37 Ga0070708_100223375 3300005445 Bacteria 1767
38 Ga0070708_100290703 3300005445 Bacteria 1538
39 Ga0070708_100317099 3300005445 Bacteria 1468
40 Ga0070708_100669606 3300005445 Bacteria 977
41 Ga0070663_100352429 3300005455 Bacteria 1192
42 Ga0070678_100101789 3300005456 Bacteria 2228
43 Ga0070678_100424195 3300005456 Bacteria 1160
44 Ga0070681_10002673 3300005458 Bacteria 16371
45 Ga0070681_10081524 3300005458 Bacteria 3191
46 Ga0068867_100286799 3300005459 Bacteria 1352
47 Ga0070706_100059498 3300005467 Bacteria 3526
48 Ga0070706_100213006 3300005467 Bacteria 1804
49 Ga0070706_100447964 3300005467 Bacteria 1201
50 Ga0070707_100001672 3300005468 Bacteria 21429
51 Ga0070707_100356668 3300005468 Bacteria 1420
52 Ga0070707_100501552 3300005468 Bacteria 1175
53 Ga0070698_100012716 3300005471 Bacteria 8912
54 Ga0070698_100239769 3300005471 Bacteria 1746
55 Ga0070698_100486327 3300005471 Bacteria 1172
56 Ga0070699_100011860 3300005518 Bacteria 7522
57 Ga0070699_100190570 3300005518 Bacteria 1821
58 Ga0070679_100002188 3300005530 Bacteria 17646
59 Ga0070679_100037432 3300005530 Bacteria 4820
60 Ga0070679_100547536 3300005530 Bacteria 1101
61 Ga0070697_100014969 3300005536 Bacteria 6088
62 Ga0070672_100281689 3300005543 Bacteria 1406
63 Ga0070695_100072723 3300005545 Bacteria 2255
64 Ga0070696_100093317 3300005546 Bacteria 2146
65 Ga0070696_100537538 3300005546 Bacteria 935
66 Ga0068855_100162684 3300005563 Bacteria 2532
67 Ga0068857_100040330 3300005577 Bacteria 4139
68 Ga0068856_100113642 3300005614 Bacteria 2706
69 Ga0068856_100342607 3300005614 Bacteria 1513
70 Ga0070702_100220815 3300005615 Bacteria 1267
71 Ga0068859_100039096 3300005617 Bacteria 4758
72 Ga0068859_100076507 3300005617 Bacteria 3388
73 Ga0068861_100711590 3300005719 Bacteria 934
74 Ga0068863_100299394 3300005841 Bacteria 1560
75 Ga0068858_100178301 3300005842 Bacteria 2005
76 Ga0068858_100235240 3300005842 Bacteria 1737
77 Ga0068858_100267184 3300005842 Bacteria 1627
78 Ga0068858_100810261 3300005842 Bacteria 914
79 Ga0068862_101036476 3300005844 Bacteria 813
80 Ga0081455_10000368 3300005937 Bacteria 59452
81 Ga0081455_10001577 3300005937 Bacteria 27997
82 Ga0081455_10060167 3300005937 Bacteria 3204
83 Ga0081455_10115944 3300005937 Bacteria 2119
84 Ga0081455_10136206 3300005937 Bacteria 1913
85 Ga0081538_10015221 3300005981 Bacteria 5968
86 Ga0081538_10031367 3300005981 Bacteria 3586
87 Ga0081538_10033443 3300005981 Bacteria 3422
88 Ga0081538_10039314 3300005981 Bacteria 3035
89 Ga0081538_10057021 3300005981 Bacteria 2282
90 Ga0081538_10128182 3300005981 Bacteria 1200
91 Ga0081540_1026400 3300005983 Bacteria 3315
92 Ga0081540_1081857 3300005983 Bacteria 1450
93 Ga0081539_10000396 3300005985 Bacteria 93686
94 Ga0081539_10086589 3300005985 Bacteria 1630
95 Ga0081539_10146289 3300005985 Bacteria 1142
96 Ga0075365_10018201 3300006038 Bacteria 4315
97 Ga0075365_10084825 3300006038 Bacteria 2150
98 Ga0075365_10301717 3300006038 Bacteria 1127
99 Ga0075368_10003775 3300006042 Bacteria 5091
100 Ga0075364_10005251 3300006051 Bacteria 7516
101 Ga0075432_10070305 3300006058 Bacteria 1257
102 Ga0075432_10103596 3300006058 Bacteria 1054
103 Ga0070716_100016208 3300006173 Bacteria 3842
104 Ga0075362_10047884 3300006177 Bacteria 1905
105 Ga0075362_10063835 3300006177 Bacteria 1671
106 Ga0075362_10197925 3300006177 Bacteria 977
107 Ga0075367_10116643 3300006178 Bacteria 1643
108 Ga0075367_10301277 3300006178 Bacteria 1009
109 Ga0075369_10010495 3300006186 Bacteria 3623
110 Ga0075369_10016282 3300006186 Bacteria 2998
111 Ga0075369_10074096 3300006186 Bacteria 1502
112 Ga0075366_10047370 3300006195 Bacteria 2548
113 Ga0075366_10116699 3300006195 Bacteria 1607
114 Ga0075370_10022325 3300006353 Bacteria 3474
115 Ga0075370_10123550 3300006353 Bacteria 1508
116 Ga0075428_100000434 3300006844 Bacteria 41550
117 Ga0075428_100010067 3300006844 Bacteria 10506
118 Ga0075428_100048916 3300006844 Bacteria 4640
119 Ga0075428_100091128 3300006844 Bacteria 3325
120 Ga0075428_100110293 3300006844 Bacteria 2997
121 Ga0075428_100126250 3300006844 Bacteria 2784
122 Ga0075430_100000421 3300006846 Bacteria 31581
123 Ga0075430_100005233 3300006846 Bacteria 10943
124 Ga0075430_100027640 3300006846 Bacteria 4819
125 Ga0075431_100003282 3300006847 Bacteria 15654
126 Ga0075431_100003781 3300006847 Bacteria 14716
127 Ga0075431_100041288 3300006847 Bacteria 4755
128 Ga0075431_100071708 3300006847 Bacteria 3574
129 Ga0075431_100080828 3300006847 Bacteria 3356
130 Ga0075431_100128503 3300006847 Bacteria 2615
131 Ga0075431_100196556 3300006847 Bacteria 2065
132 Ga0075431_100210058 3300006847 Bacteria 1988
133 Ga0075431_100223418 3300006847 Bacteria 1921
134 Ga0075431_100362929 3300006847 Bacteria 1454
135 Ga0075431_100559306 3300006847 Bacteria 1131
136 Ga0075433_10000715 3300006852 Bacteria 22715
137 Ga0075433_10004325 3300006852 Bacteria 11031
138 Ga0075433_10043268 3300006852 Bacteria 3908
139 Ga0075433_10049839 3300006852 Bacteria 3643
140 Ga0075433_10055724 3300006852 Bacteria 3451
141 Ga0075433_10196262 3300006852 Bacteria 1795
142 Ga0075433_10424304 3300006852 Bacteria 1173
143 Ga0075433_10484924 3300006852 Bacteria 1089
144 Ga0075433_10745871 3300006852 Bacteria 857
145 Ga0075434_100004132 3300006871 Bacteria 13019
146 Ga0075434_100006316 3300006871 Bacteria 10863
147 Ga0075434_100014007 3300006871 Bacteria 7654
148 Ga0075434_100019577 3300006871 Bacteria 6552
149 Ga0075434_100019591 3300006871 Bacteria 6550
150 Ga0075434_100024595 3300006871 Bacteria 5888
151 Ga0075434_100032219 3300006871 Bacteria 5167
152 Ga0075434_100068594 3300006871 Bacteria 3533
153 Ga0075434_100088796 3300006871 Bacteria 3093
154 Ga0075434_100477513 3300006871 Bacteria 1268
155 Ga0075429_100000553 3300006880 Bacteria 28584
156 Ga0075429_100002159 3300006880 Bacteria 16411
157 Ga0075429_100011933 3300006880 Bacteria 7533
158 Ga0075429_100040638 3300006880 Bacteria 4050
159 Ga0075429_100041281 3300006880 Bacteria 4018
160 Ga0075429_100086458 3300006880 Bacteria 2733
161 Ga0075429_100137242 3300006880 Bacteria 2140
162 Ga0075429_100276397 3300006880 Bacteria 1471
163 Ga0075436_100002160 3300006914 Bacteria 13558
164 Ga0075436_100038901 3300006914 Bacteria 3282
165 Ga0075436_100101134 3300006914 Bacteria 2007
166 Ga0075436_100113970 3300006914 Bacteria 1888
167 Ga0097620_100039095 3300006931 Bacteria 4758
168 Ga0097620_100076508 3300006931 Bacteria 3388
169 Ga0075435_100011792 3300007076 Bacteria 6450
170 Ga0075435_100016181 3300007076 Bacteria 5620
171 Ga0075435_100019645 3300007076 Bacteria 5166
172 Ga0075435_100034499 3300007076 Bacteria 4010
173 Ga0075435_100580290 3300007076 Bacteria 972
174 Ga0099794_10005153 3300007265 Bacteria 5218
175 Ga0105240_10030893 3300009093 Bacteria 6958
176 Ga0111539_10000124 3300009094 Bacteria 86595
177 Ga0111539_10011628 3300009094 Bacteria 11044
178 Ga0111539_10062922 3300009094 Bacteria 4391
179 Ga0111539_10139605 3300009094 Bacteria 2837
180 Ga0111539_10191658 3300009094 Bacteria 2385
181 Ga0111539_10354709 3300009094 Bacteria 1707
182 Ga0111539_10557713 3300009094 Bacteria 1334
183 Ga0111539_11284559 3300009094 Bacteria 849
184 Ga0105245_10341081 3300009098 Bacteria 1482
185 Ga0114129_10002493 3300009147 Bacteria 25548
186 Ga0114129_10003512 3300009147 Bacteria 22054
187 Ga0114129_10017718 3300009147 Bacteria 10142
188 Ga0114129_10018084 3300009147 Bacteria 10040
189 Ga0114129_10024655 3300009147 Bacteria 8525
190 Ga0114129_10046962 3300009147 Bacteria 6068
191 Ga0114129_10053944 3300009147 Bacteria 5638
192 Ga0114129_10065912 3300009147 Bacteria 5052
193 Ga0114129_10068989 3300009147 Bacteria 4928
194 Ga0114129_10076475 3300009147 Bacteria 4660
195 Ga0114129_10082363 3300009147 Bacteria 4471
196 Ga0114129_10083508 3300009147 Bacteria 4436
197 Ga0114129_10162467 3300009147 Bacteria 3050
198 Ga0114129_10231231 3300009147 Bacteria 2490
199 Ga0114129_10307857 3300009147 Bacteria 2110
200 Ga0114129_10456418 3300009147 Bacteria 1675
201 Ga0114129_10512182 3300009147 Bacteria 1565
202 Ga0114129_10633547 3300009147 Bacteria 1382
203 Ga0114129_10674153 3300009147 Bacteria 1332
204 Ga0114129_10940271 3300009147 Bacteria 1093
205 Ga0105248_10090902 3300009177 Bacteria 3438
206 Ga0105238_10024989 3300009551 Bacteria 6089
207 Ga0105249_10082774 3300009553 Bacteria 2986
208 Ga0105249_10176399 3300009553 Bacteria 2076
209 Ga0105249_10241503 3300009553 Bacteria 1786
210 Ga0105028_106941 3300009993 Bacteria 1183
211 Ga0157371_10052121 3300013102 Bacteria 2906
212 Ga0157370_10012658 3300013104 Bacteria 8737
213 Ga0157374_10054046 3300013296 Bacteria 3745
214 Ga0157378_10072734 3300013297 Bacteria 3090
215 Ga0157378_10078063 3300013297 Bacteria 2986
216 Ga0157378_10448501 3300013297 Bacteria 1280
217 Ga0163162_10057974 3300013306 Bacteria 3901
218 Ga0163162_10166588 3300013306 Bacteria 2328
219 Ga0157372_10346592 3300013307 Bacteria 1730
220 Ga0157372_10919948 3300013307 Bacteria 1014
221 Ga0157375_10340579 3300013308 Bacteria 1665
222 Ga0163163_10004299 3300014325 Bacteria 12135
223 Ga0182008_10030915 3300014497 Bacteria 2697
224 Ga0182008_10046953 3300014497 Bacteria 2146
225 Ga0157379_10450326 3300014968 Bacteria 1188
226 Ga0182007_10039054 3300015262 Bacteria 1590
227 Ga0213871_10027502 3300021441 Bacteria 1461
228 Ga0209758_1000244 3300025297 Bacteria 112497
229 Ga0207426_1040099 3300025302 Bacteria 1461
230 Ga0207642_10028504 3300025899 Bacteria 2300
231 Ga0207699_10141831 3300025906 Bacteria 1580
232 Ga0207645_10039151 3300025907 Bacteria 3038
233 Ga0207684_10002639 3300025910 Bacteria 17937
234 Ga0207684_10004470 3300025910 Bacteria 13164
235 Ga0207684_10026421 3300025910 Bacteria 4949
236 Ga0207684_10096148 3300025910 Bacteria 2528
237 Ga0207707_10010790 3300025912 Bacteria 7939
238 Ga0207707_10184718 3300025912 Bacteria 1820
239 Ga0207707_10203717 3300025912 Bacteria 1725
240 Ga0207695_10178844 3300025913 Bacteria 2043
241 Ga0207693_10183323 3300025915 Bacteria 1648
242 Ga0207660_10032358 3300025917 Bacteria 3610
243 Ga0207660_10099254 3300025917 Bacteria 2172
244 Ga0207660_10216640 3300025917 Bacteria 1501
245 Ga0207660_10516454 3300025917 Bacteria 970
246 Ga0207657_10180238 3300025919 Bacteria 1708
247 Ga0207657_10470614 3300025919 Bacteria 986
248 Ga0207652_10010541 3300025921 Bacteria 7440
249 Ga0207652_10046211 3300025921 Bacteria 3714
250 Ga0207646_10001883 3300025922 Bacteria 25291
251 Ga0207646_10279814 3300025922 Bacteria 1508
252 Ga0207646_10660455 3300025922 Bacteria 936
253 Ga0207681_10303897 3300025923 Bacteria 1263
254 Ga0207687_10098417 3300025927 Bacteria 2147
255 Ga0207687_10389126 3300025927 Bacteria 1144
256 Ga0207700_10191700 3300025928 Bacteria 1718
257 Ga0207700_10408953 3300025928 Bacteria 1190
258 Ga0207644_10330925 3300025931 Bacteria 1233
259 Ga0207670_10007280 3300025936 Bacteria 6164
260 Ga0207670_10158132 3300025936 Bacteria 1689
261 Ga0207670_10224554 3300025936 Bacteria 1439
262 Ga0207670_10440674 3300025936 Bacteria 1049
263 Ga0207665_10000418 3300025939 Bacteria 29273
264 Ga0207665_10422987 3300025939 Bacteria 1018
265 Ga0207691_10148122 3300025940 Bacteria 2065
266 Ga0207711_10007320 3300025941 Bacteria 9239
267 Ga0207667_10146465 3300025949 Bacteria 2431
268 Ga0207712_10377779 3300025961 Bacteria 1185
269 Ga0207668_10295784 3300025972 Bacteria 1334
270 Ga0207640_10605961 3300025981 Bacteria 928
271 Ga0207677_10367247 3300026023 Bacteria 1211
272 Ga0207703_10241908 3300026035 Bacteria 1623
273 Ga0207703_10886614 3300026035 Bacteria 854
274 Ga0207678_10124814 3300026067 Bacteria 2196
275 Ga0207708_10288542 3300026075 Bacteria 1331
276 Ga0207708_10372557 3300026075 Bacteria 1176
277 Ga0207641_10186149 3300026088 Bacteria 1905
278 Ga0207641_10818034 3300026088 Bacteria 922
279 Ga0207648_10420020 3300026089 Bacteria 1214
280 Ga0207648_10509218 3300026089 Bacteria 1102
281 Ga0207676_10013655 3300026095 Bacteria 5832
282 Ga0207676_10605405 3300026095 Bacteria 1053
283 Ga0207674_10040228 3300026116 Bacteria 4845
284 Ga0207675_100433392 3300026118 Bacteria 1300
285 Ga0207683_10040272 3300026121 Bacteria 4076
286 Ga0207683_10046643 3300026121 Bacteria 3793
287 Ga0207683_10479925 3300026121 Bacteria 1147
288 Ga0209588_1019247 3300027671 Bacteria 2130
289 Ga0209588_1047994 3300027671 Bacteria 1381
290 Ga0209813_10022443 3300027866 Bacteria 1785
291 Ga0209813_10022663 3300027866 Bacteria 1779
292 Ga0207428_10000314 3300027907 Bacteria 64160
293 Ga0207428_10005435 3300027907 Bacteria 11883
294 Ga0207428_10138809 3300027907 Bacteria 1857
295 Ga0268265_10912030 3300028380 Bacteria 863
296 Ga0265337_1001072 3300028556 Bacteria 14099
297 Ga0265334_10032868 3300028573 Bacteria 2067
298 Ga0265318_10002015 3300028577 Bacteria 11243
299 Ga0265338_10008257 3300028800 Bacteria 12676
300 Ga0307511_10000103 3300030521 Bacteria 75234
301 Ga0265330_10037629 3300031235 Bacteria 2153
302 Ga0265332_10014798 3300031238 Bacteria 3449
303 Ga0265328_10052595 3300031239 Bacteria 1495
304 Ga0265320_10022186 3300031240 Bacteria 3399
305 Ga0265320_10097662 3300031240 Bacteria 1355
306 Ga0265325_10004654 3300031241 Bacteria 8610
307 Ga0265325_10021089 3300031241 Bacteria 3584
308 Ga0265329_10005759 3300031242 Bacteria 4976
309 Ga0265329_10013968 3300031242 Bacteria 2847
310 Ga0265340_10001737 3300031247 Bacteria 12497
311 Ga0265340_10013957 3300031247 Bacteria 4209
312 Ga0265340_10036729 3300031247 Bacteria 2427
313 Ga0265339_10000837 3300031249 Bacteria 23753
314 Ga0265339_10010326 3300031249 Bacteria 5805
315 Ga0265339_10082570 3300031249 Bacteria 1696
316 Ga0265339_10096237 3300031249 Bacteria 1545
317 Ga0265331_10091382 3300031250 Bacteria 1406
318 Ga0265327_10070759 3300031251 Bacteria 1747
319 Ga0265316_10122775 3300031344 Bacteria 1961
320 Ga0265313_10008850 3300031595 Bacteria 6627
321 Ga0265313_10060460 3300031595 Bacteria 1777
322 Ga0265342_10001224 3300031712 Bacteria 24306
323 Ga0265342_10010536 3300031712 Bacteria 6401
324 Ga0265342_10012965 3300031712 Bacteria 5620
325 Ga0316577_10228515 3300031733 Bacteria 1052
326 Ga0307406_10066867 3300031901 Bacteria 2341
327 Ga0307416_100320496 3300032002 Bacteria 1552
328 Ga0307415_100352285 3300032126 Bacteria 1240
329 Ga0373930_0037452 3300034816 Bacteria 1021
330 Ga0373958_0008473 3300034819 Bacteria 1667
331 Ga0373938_0005630 3300034957 Bacteria 2136
332 Ga0373934_0053818 3300035086 Bacteria 1597
333 Ga0373949_0015833 3300035090 Bacteria 1688
334 Ga0373936_0020581 3300035113 Bacteria 2564
335 Ga0373939_0020324 3300035114 Bacteria 1802
336 Ga0373939_0048063 3300035114 Bacteria 1313
337 Ga0373941_0012508 3300035115 Bacteria 2221
338 Ga0373941_0159436 3300035115 Bacteria 833
339 Ga0373945_0121911 3300035116 Bacteria 1037
340 Ga0373956_0038866 3300035119 Bacteria 2107
341 Ga0373942_0071574 3300035207 Bacteria 1013
342 Ga0373961_0009443 3300035241 Bacteria 2387
343 Ga0373961_0048021 3300035241 Bacteria 1256
344 Ga0373924_0105682 3300035410 Bacteria 1213
345 Ga0373931_0000725 3300035691 Bacteria 13714
346 Ga0373931_0002681 3300035691 Bacteria 7920
347 Ga0373931_0030209 3300035691 Bacteria 2788
348 Ga0373931_0167182 3300035691 Bacteria 1293
349 Ga0373931_0278101 3300035691 Bacteria 1027
350 Ga0373935_0014949 3300035692 Bacteria 4687
351 Ga0373935_0213144 3300035692 Bacteria 1339
352 Ga0373927_0021395 3300035695 Bacteria 4239
353 Ga0373933_0031795 3300035724 Bacteria 3063
354 Ga0373933_0137475 3300035724 Bacteria 1540
355 Ga0373937_0004611 3300036401 Bacteria 11701
356 Ga0373937_0006097 3300036401 Bacteria 10381
357 Ga0373937_0022491 3300036401 Bacteria 5669
358 Ga0373937_0235427 3300036401 Bacteria 1725
359 Ga0316584_0005489 3300036712 Bacteria 8515
360 Ga0373925_0025647 3300037068 Bacteria 4309
361 Ga0395899_0176971 3300037312 Bacteria 1500
362 Ga0395905_0070615 3300037471 Bacteria 3273
363 Ga0436364_0353987 3300037853 Bacteria 2134
364 Ga0395901_0542871 3300038443 Bacteria 1179
365 Ga0242420_013074 3300038996 Bacteria 1411
366 Ga0400489_72336 3300039093 Bacteria 113152
367 Ga0436365_0381106 3300039437 Bacteria 7685
368 Ga0436365_1246965 3300039437 Bacteria 1415
369 Ga0436360_0257601 3300039438 Bacteria 1559
370 Ga0436360_0614234 3300039438 Bacteria 4254
371 Ga0436360_1068656 3300039438 Bacteria 2162
372 Ga0436361_0986989 3300039447 Bacteria 4284
373 Ga0436362_0753582 3300039453 Bacteria 1792
374 Ga0439453_0001338 3300041408 Bacteria 3139
375 Ga0439435_0046835 3300042436 Bacteria 1226
376 Ga0439460_0090333 3300042461 Bacteria 973
377 Ga0451577_0005509 3300042876 Bacteria 12940
378 Ga0451577_0095470 3300042876 Bacteria 2655
379 Ga0439440_0008813 3300042993 Bacteria 2077
380 Ga0453683_0003168 3300044673 Bacteria 12238
381 Ga0453683_0012024 3300044673 Bacteria 5687
382 Ga0453683_0028061 3300044673 Bacteria 3566
383 Ga0453684_0014736 3300044712 Bacteria 12462
384 Ga0453684_0992720 3300044712 Bacteria 893
385 Ga0466959_0088309 3300045049 Bacteria 2229
386 Ga0451576_0016259 3300045051 Bacteria 8217
387 Ga0451576_0034474 3300045051 Bacteria 5375
388 Ga0451576_0065486 3300045051 Bacteria 3783
389 Ga0451576_0084488 3300045051 Bacteria 3302
390 Ga0466967_0424093 3300045976 Bacteria 1297
391 Ga0495592_0362307 3300046454 Bacteria 927
392 Ga0495653_0287800 3300046463 Bacteria 1076
393 Ga0495580_0048120 3300046472 Bacteria 3021
394 Ga0495580_0101622 3300046472 Bacteria 1999
395 Ga0495580_0150867 3300046472 Bacteria 1610
396 Ga0495582_0109100 3300046473 Bacteria 1554
397 Ga0495664_0108234 3300046477 Bacteria 1677
398 Ga0495584_0148733 3300046491 Bacteria 1190
399 Ga0495584_0317515 3300046491 Bacteria 791
400 Ga0495608_0219132 3300046511 Bacteria 1194
401 Ga0495608_0291545 3300046511 Bacteria 1011
402 Ga0495628_0084315 3300046516 Bacteria 2466
403 Ga0495648_0238298 3300046524 Bacteria 886
404 Ga0495652_0086161 3300046529 Bacteria 2580
405 Ga0495652_0210851 3300046529 Bacteria 1467
406 Ga0495667_0039429 3300046559 Bacteria 3141
407 Ga0495634_0207381 3300046642 Bacteria 1215
408 Ga0495625_0257664 3300046660 Bacteria 1130
409 Ga0495599_0080068 3300046678 Bacteria 2040
410 Ga0495646_0078248 3300046680 Bacteria 1933
411 Ga0495674_0046895 3300047319 Bacteria 3834
412 Ga0495672_0008352 3300047320 Bacteria 7659
413 Ga0495676_0311093 3300047321 Bacteria 1060
414 Ga0495680_0063967 3300047322 Bacteria 2823
415 Ga0495680_0380247 3300047322 Bacteria 978
416 Ga0495686_0295776 3300047472 Bacteria 895
417 Ga0496100_0031533 3300048903 Bacteria 3296
418 Ga0496100_0052160 3300048903 Bacteria 2658
419 Ga0496101_0085185 3300048904 Bacteria 2341
420 Ga0496102_0080941 3300048905 Bacteria 2993
421 Ga0496102_0092980 3300048905 Bacteria 2794
422 Ga0496103_0055018 3300048906 Bacteria 2467
423 Ga0496103_0124322 3300048906 Bacteria 1644
424 Ga0496104_0131878 3300048907 Bacteria 2400
425 Ga0496104_0277571 3300048907 Bacteria 1589
426 Ga0496105_0035998 3300048908 Bacteria 4076
427 Ga0496106_0039911 3300048909 Bacteria 3515
428 Ga0496106_0437057 3300048909 Bacteria 1051
429 Ga0496106_0495468 3300048909 Bacteria 981
430 Ga0496107_0200964 3300048910 Bacteria 1481
431 Ga0496108_0027950 3300048911 Bacteria 4664
432 Ga0496108_0075058 3300048911 Bacteria 2856
433 Ga0496109_0171227 3300048912 Bacteria 2037
434 Ga0496110_0116171 3300048913 Bacteria 2409
435 Ga0496110_0290130 3300048913 Bacteria 1490
436 Ga0496112_0285560 3300048915 Bacteria 1596
437 Ga0496114_0147855 3300048917 Bacteria 2037
438 Ga0496115_0118821 3300048918 Bacteria 2174
439 Ga0501031_0006362 3300049568 Bacteria 7703
440 Ga0501031_0007969 3300049568 Bacteria 6896
441 Ga0501032_0007999 3300049569 Bacteria 7707
442 Ga0501032_0058870 3300049569 Bacteria 2579
443 Ga0501032_0317939 3300049569 Bacteria 1005
444 Ga0501033_0002756 3300049570 Bacteria 14722
445 Ga0501033_0044266 3300049570 Bacteria 3314
446 Ga0501033_0065641 3300049570 Bacteria 2670
447 Ga0501034_0003212 3300049571 Bacteria 18732
448 Ga0501036_0001549 3300049572 Bacteria 17772
449 Ga0501036_0029995 3300049572 Bacteria 4595
450 Ga0501036_0051167 3300049572 Bacteria 3498
451 Ga0501036_0562355 3300049572 Bacteria 947
452 Ga0501037_0001941 3300049573 Bacteria 14964
453 Ga0501037_0202257 3300049573 Bacteria 1403
454 Ga0501038_0012795 3300049574 Bacteria 7662
455 Ga0501038_0050090 3300049574 Bacteria 3610
456 Ga0501038_0515559 3300049574 Bacteria 913
457 Ga0501039_0004796 3300049575 Bacteria 10238
458 Ga0501039_0050387 3300049575 Bacteria 3221
459 Ga0501039_0341178 3300049575 Bacteria 1177
460 Ga0501040_0057721 3300049576 Bacteria 2665
461 Ga0501040_0113782 3300049576 Bacteria 1894
462 Ga0501041_0019503 3300049577 Bacteria 4050
463 Ga0501041_0400039 3300049577 Bacteria 870
464 Ga0501042_0029198 3300049578 Bacteria 3889
465 Ga0501042_0115296 3300049578 Bacteria 1934
466 Ga0501043_0329556 3300049579 Bacteria 1163
467 Ga0501046_0003854 3300049580 Bacteria 13721
468 Ga0501046_0442159 3300049580 Bacteria 936
469 Ga0501047_0013790 3300049581 Bacteria 7676
470 Ga0501048_0003364 3300049582 Bacteria 12161
471 Ga0501048_0009989 3300049582 Bacteria 7106
472 Ga0501067_0004761 3300049583 Bacteria 7515
473 Ga0501068_0004017 3300049584 Bacteria 8004
474 Ga0501068_0169340 3300049584 Bacteria 1378
475 Ga0501068_0180221 3300049584 Bacteria 1336
476 Ga0501069_0001642 3300049585 Bacteria 11103
477 Ga0501069_0044564 3300049585 Bacteria 2456
478 Ga0501069_0171924 3300049585 Bacteria 1250
479 Ga0501070_0017479 3300049586 Bacteria 6020
480 Ga0501070_0592180 3300049586 Bacteria 884
481 Ga0501071_0010774 3300049587 Bacteria 6132
482 Ga0501071_0019723 3300049587 Bacteria 4680
483 Ga0501071_0363605 3300049587 Bacteria 1102
484 Ga0501071_0464445 3300049587 Bacteria 969
485 Ga0501072_0003852 3300049588 Bacteria 11338
486 Ga0501072_0222344 3300049588 Bacteria 1505
487 Ga0501072_0338062 3300049588 Bacteria 1196
488 Ga0501073_0007551 3300049589 Bacteria 8075
489 Ga0501073_0168190 3300049589 Bacteria 1518
490 Ga0501073_0271699 3300049589 Bacteria 1170
491 Ga0501074_0030822 3300049590 Bacteria 3885
492 Ga0501074_0198884 3300049590 Bacteria 1428
493 Ga0501075_0008660 3300049591 Bacteria 7091
494 Ga0501075_0299646 3300049591 Bacteria 1225
495 Ga0501075_0431149 3300049591 Bacteria 1005
496 Ga0501076_0032570 3300049592 Bacteria 4068
497 Ga0501076_0046513 3300049592 Bacteria 3429
498 Ga0501077_0268744 3300049593 Bacteria 1085
499 Ga0501079_0078279 3300049741 Bacteria 2557
500 Ga0501079_0597237 3300049741 Bacteria 869
501 Ga0501080_0011867 3300049742 Bacteria 7980
502 Ga0501080_0124093 3300049742 Bacteria 2392
503 Ga0501081_0041898 3300049743 Bacteria 3137
504 Ga0501081_0580407 3300049743 Bacteria 839
505 Ga0501083_0192665 3300049744 Bacteria 1330
506 Ga0501035_0018762 3300049822 Bacteria 6370
507 Ga0501035_0119605 3300049822 Bacteria 2304
508 Ga0501035_0224874 3300049822 Bacteria 1601
509 Ga0501044_0000057 3300049823 Bacteria 136472
510 Ga0501044_0014413 3300049823 Bacteria 8536
511 Ga0501044_0206459 3300049823 Bacteria 1921
512 Ga0501044_0356409 3300049823 Bacteria 1381
513 Ga0501045_0036907 3300049824 Bacteria 3550
514 Ga0501045_0040195 3300049824 Bacteria 3404
515 Ga0501045_0410695 3300049824 Bacteria 1007
516 nmdc:mga03683_10604_c1 3300050489 Bacteria 3310
517 nmdc:mga03683_201308_c1 3300050489 Bacteria 914
518 nmdc:mga03683_4030_c1 3300050489 Bacteria 4820
519 nmdc:mga03n38_34808_c1 3300050490 Bacteria 2154
520 nmdc:mga03n38_69831_c1 3300050490 Bacteria 1623
521 nmdc:mga00v17_19810_c1 3300050491 Bacteria 3847
522 nmdc:mga00v17_385045_c1 3300050491 Bacteria 912
523 nmdc:mga0yw44_191481_c1 3300050492 Bacteria 1349
524 nmdc:mga0yw44_226726_c1 3300050492 Bacteria 1240
525 nmdc:mga0yw44_39587_c1 3300050492 Bacteria 2796
526 nmdc:mga0k408_78958_c1 3300050493 Bacteria 1926
527 nmdc:mga0k408_8961_c1 3300050493 Bacteria 5383
528 nmdc:mga06z11_48960_c1 3300050494 Bacteria 2154
529 nmdc:mga04h51_29317_c1 3300050495 Bacteria 1723
530 nmdc:mga07m45_18344_c1 3300050496 Bacteria 3775
531 nmdc:mga07m45_207017_c1 3300050496 Bacteria 1141
532 nmdc:mga07m45_47616_c1 3300050496 Bacteria 2411
533 nmdc:mga05p37_12850_c1 3300050507 Bacteria 10013
534 nmdc:mga05p37_139477_c1 3300050507 Bacteria 2971
535 nmdc:mga05p37_160948_c1 3300050507 Bacteria 2742
536 nmdc:mga05p37_19550_c1 3300050507 Bacteria 8193
537 nmdc:mga05p37_225905_c2 3300050507 Bacteria 1758
538 nmdc:mga05p37_2389_c1 3300050507 Bacteria 21838
539 nmdc:mga05p37_247384_c1 3300050507 Bacteria 2140
540 nmdc:mga05p37_2490_c1 3300050507 Bacteria 21416
541 nmdc:mga05p37_388157_c1 3300050507 Bacteria 1634
542 nmdc:mga05p37_42965_c1 3300050507 Bacteria 1366
543 nmdc:mga05p37_45890_c1 3300050507 Bacteria 5374
544 nmdc:mga05p37_600370_c1 3300050507 Bacteria 1243
545 nmdc:mga05p37_633987_c1 3300050507 Bacteria 1200
546 nmdc:mga05p37_636000_c1 3300050507 Bacteria 1198
547 nmdc:mga05p37_65680_c1 3300050507 Bacteria 4464
548 nmdc:mga05p37_8957_c1 3300050507 Bacteria 11835
549 nmdc:mga09592_103442_c1 3300050508 Bacteria 2440
550 nmdc:mga09592_237606_c1 3300050508 Bacteria 1579
551 nmdc:mga09592_24612_c1 3300050508 Bacteria 4980
552 nmdc:mga09592_28838_c1 3300050508 Bacteria 4614
553 nmdc:mga09592_529_c1 3300050508 Bacteria 28853
554 nmdc:mga09592_535418_c1 3300050508 Bacteria 1007
555 nmdc:mga09592_66296_c1 3300050508 Bacteria 3060
556 nmdc:mga09592_6873_c1 3300050508 Bacteria 9258
557 nmdc:mga09592_84570_c1 3300050508 Bacteria 2705
558 nmdc:mga0qj67_13099_c1 3300050509 Bacteria 6263
559 nmdc:mga0qj67_196425_c1 3300050509 Bacteria 1640
560 nmdc:mga0qj67_2827_c1 3300050509 Bacteria 12450
561 nmdc:mga0qj67_7328_c1 3300050509 Bacteria 8156
562 nmdc:mga06r32_12759_c1 3300050510 Bacteria 7597
563 nmdc:mga06r32_173714_c1 3300050510 Bacteria 2139
564 nmdc:mga06r32_226909_c1 3300050510 Bacteria 1856
565 nmdc:mga06r32_25894_c1 3300050510 Bacteria 5462
566 nmdc:mga06r32_266541_c1 3300050510 Bacteria 1700
567 nmdc:mga06r32_32462_c1 3300050510 Bacteria 4913
568 nmdc:mga06r32_59501_c1 3300050510 Bacteria 3674
569 nmdc:mga06r32_63568_c1 3300050510 Bacteria 3558
570 nmdc:mga06r32_673_c1 3300050510 Bacteria 29768
571 nmdc:mga06r32_69768_c1 3300050510 Bacteria 3397
572 nmdc:mga08y16_140199_c1 3300050511 Bacteria 2513
573 nmdc:mga08y16_213113_c1 3300050511 Bacteria 2000
574 nmdc:mga08y16_3260_c1 3300050511 Bacteria 16798
575 nmdc:mga08y16_36141_c1 3300050511 Bacteria 5188
576 nmdc:mga08y16_3745_c1 3300050511 Bacteria 15833
577 nmdc:mga08y16_398047_c1 3300050511 Bacteria 1410
578 nmdc:mga08y16_41526_c1 3300050511 Bacteria 4818
579 nmdc:mga0n895_10312_c1 3300050512 Bacteria 8241
580 nmdc:mga0n895_16426_c1 3300050512 Bacteria 6792
581 nmdc:mga0n895_21571_c1 3300050512 Bacteria 6027
582 nmdc:mga0n895_23302_c1 3300050512 Bacteria 5816
583 nmdc:mga0n895_2639_c1 3300050512 Bacteria 14134
584 nmdc:mga0n895_471042_c1 3300050512 Bacteria 1267
585 nmdc:mga0n895_56109_c1 3300050512 Bacteria 3880
586 nmdc:mga0n895_58605_c1 3300050512 Bacteria 3797
587 nmdc:mga0n895_59305_c1 3300050512 Bacteria 3776
588 nmdc:mga0n895_7213_c1 3300050512 Bacteria 9518
589 nmdc:mga0n895_792230_c1 3300050512 Bacteria 939
590 nmdc:mga0n895_9276_c1 3300050512 Bacteria 8598
591 nmdc:mga0rr50_11160_c1 3300050513 Bacteria 5733
592 nmdc:mga0rr50_120851_c1 3300050513 Bacteria 2085
593 nmdc:mga0rr50_122747_c1 3300050513 Bacteria 2070
594 nmdc:mga0rr50_311669_c1 3300050513 Bacteria 1318
595 nmdc:mga0rr50_43204_c1 3300050513 Bacteria 3296
596 nmdc:mga0rr50_4749_c1 3300050513 Bacteria 8015
597 nmdc:mga0rr50_48095_c1 3300050513 Bacteria 3151
598 nmdc:mga0rr50_7637_c1 3300050513 Bacteria 6687
599 nmdc:mga08x19_334871_c1 3300050514 Bacteria 1055
600 nmdc:mga08x19_538_c1 3300050514 Bacteria 25060
601 nmdc:mga0a205_11548_c1 3300050515 Bacteria 8137
602 nmdc:mga0a205_1161_c1 3300050515 Bacteria 21897
603 nmdc:mga0a205_12415_c1 3300050515 Bacteria 3128
604 nmdc:mga0a205_140747_c1 3300050515 Bacteria 2313
605 nmdc:mga0a205_28074_c1 3300050515 Bacteria 4865
606 nmdc:mga0a205_317_c1 3300050515 Bacteria 35903
607 nmdc:mga0a205_36204_c1 3300050515 Bacteria 4742
608 nmdc:mga0a205_3940_c2 3300050515 Bacteria 10694
609 nmdc:mga0a205_592718_c1 3300050515 Bacteria 962
610 nmdc:mga0sz30_102550_c1 3300050516 Bacteria 1250
611 nmdc:mga0sz30_34759_c2 3300050516 Bacteria 1347
612 Ga0495601_0060412 3300053077 Bacteria 2405
613 Ga0495619_0057957 3300053085 Bacteria 2570
614 Ga0500646_0001852 3300053090 Bacteria 5550
615 Ga0500583_0146104 3300053092 Bacteria 1176
616 Ga0500641_0026280 3300053096 Bacteria 2259
617 Ga0500562_041276 3300053108 Bacteria 1227
618 Ga0500642_0101633 3300053130 Bacteria 1338
619 Ga0500655_000777 3300053133 Bacteria 6277
620 Ga0500568_0014147 3300053139 Bacteria 3613
621 Ga0500604_0000550 3300053151 Bacteria 10334
622 Ga0501084_0011282 3300054114 Bacteria 7396
623 Ga0501084_0024095 3300054114 Bacteria 5076
624 Ga0501084_0104496 3300054114 Bacteria 2379
625 Ga0501084_0150629 3300054114 Bacteria 1961
626 Ga0501084_0385634 3300054114 Bacteria 1184
627 Ga0501084_0530864 3300054114 Bacteria 995
628 Ga0501082_0004059 3300060353 Bacteria 12767
629 Ga0501082_0036048 3300060353 Bacteria 4262
630 Ga0501082_0642267 3300060353 Bacteria 929
631 Ga0530510_0006864 3300061734 Bacteria 7934
632 Ga0373943_0106745
633 JGI25406J46586_10007267
634 JGI25153J46596_10001658
635 JGI25405J52794_10001500
636 Ga0070658_10020347
637 Ga0070676_10081315
638 Ga0070676_10218046
639 Ga0070690_100009684
640 Ga0070680_100005498
641 Ga0070680_100044708
642 Ga0070680_100057211
643 Ga0068868_100129277
644 Ga0070660_100500543
645 Ga0070660_100544148
646 Ga0070689_100004975
647 Ga0070689_100218907
648 Ga0070689_100534924
649 Ga0070687_100231756
650 Ga0070668_100392158
651 Ga0070669_100103416
652 Ga0070675_100110130
653 Ga0070671_100333169
654 Ga0070674_100031325
655 Ga0070688_100005526
656 Ga0070667_100459505
657 Ga0070703_10015714
658 Ga0070709_10375446
659 Ga0070714_100551888
660 Ga0070713_100228082
661 Ga0070713_100285279
662 Ga0070713_100902943
663 Ga0070711_100047935
664 Ga0070700_100235692
665 Ga0070694_100088041
666 Ga0070694_100101824
667 Ga0070708_100020159
668 Ga0070708_100223375
669 Ga0070708_100290703
670 Ga0070708_100317099
671 Ga0070708_100669606
672 Ga0070663_100352429
673 Ga0070678_100101789
674 Ga0070678_100424195
675 Ga0070681_10002673
676 Ga0070681_10081524
677 Ga0068867_100286799
678 Ga0070706_100059498
679 Ga0070706_100213006
680 Ga0070706_100447964
681 Ga0070707_100001672
682 Ga0070707_100356668
683 Ga0070707_100501552
684 Ga0070698_100012716
685 Ga0070698_100239769
686 Ga0070698_100486327
687 Ga0070699_100011860
688 Ga0070699_100190570
689 Ga0070679_100002188
690 Ga0070679_100037432
691 Ga0070679_100547536
692 Ga0070697_100014969
693 Ga0070672_100281689
694 Ga0070695_100072723
695 Ga0070696_100093317
696 Ga0070696_100537538
697 Ga0068855_100162684
698 Ga0068857_100040330
699 Ga0068856_100113642
700 Ga0068856_100342607
701 Ga0070702_100220815
702 Ga0068859_100039096
703 Ga0068859_100076507
704 Ga0068861_100711590
705 Ga0068863_100299394
706 Ga0068858_100178301
707 Ga0068858_100235240
708 Ga0068858_100267184
709 Ga0068858_100810261
710 Ga0068862_101036476
711 Ga0081455_10000368
712 Ga0081455_10001577
713 Ga0081455_10060167
714 Ga0081455_10115944
715 Ga0081455_10136206
716 Ga0081538_10015221
717 Ga0081538_10031367
718 Ga0081538_10033443
719 Ga0081538_10039314
720 Ga0081538_10057021
721 Ga0081538_10128182
722 Ga0081540_1026400
723 Ga0081540_1081857
724 Ga0081539_10000396
725 Ga0081539_10086589
726 Ga0081539_10146289
727 Ga0075365_10018201
728 Ga0075365_10084825
729 Ga0075365_10301717
730 Ga0075368_10003775
731 Ga0075364_10005251
732 Ga0075432_10070305
733 Ga0075432_10103596
734 Ga0070716_100016208
735 Ga0075362_10047884
736 Ga0075362_10063835
737 Ga0075362_10197925
738 Ga0075367_10116643
739 Ga0075367_10301277
740 Ga0075369_10010495
741 Ga0075369_10016282
742 Ga0075369_10074096
743 Ga0075366_10047370
744 Ga0075366_10116699
745 Ga0075370_10022325
746 Ga0075370_10123550
747 Ga0075428_100000434
748 Ga0075428_100010067
749 Ga0075428_100048916
750 Ga0075428_100091128
751 Ga0075428_100110293
752 Ga0075428_100126250
753 Ga0075430_100000421
754 Ga0075430_100005233
755 Ga0075430_100027640
756 Ga0075431_100003282
757 Ga0075431_100003781
758 Ga0075431_100041288
759 Ga0075431_100071708
760 Ga0075431_100080828
761 Ga0075431_100128503
762 Ga0075431_100196556
763 Ga0075431_100210058
764 Ga0075431_100223418
765 Ga0075431_100362929
766 Ga0075431_100559306
767 Ga0075433_10000715
768 Ga0075433_10004325
769 Ga0075433_10043268
770 Ga0075433_10049839
771 Ga0075433_10055724
772 Ga0075433_10196262
773 Ga0075433_10424304
774 Ga0075433_10484924
775 Ga0075433_10745871
776 Ga0075434_100004132
777 Ga0075434_100006316
778 Ga0075434_100014007
779 Ga0075434_100019577
780 Ga0075434_100019591
781 Ga0075434_100024595
782 Ga0075434_100032219
783 Ga0075434_100068594
784 Ga0075434_100088796
785 Ga0075434_100477513
786 Ga0075429_100000553
787 Ga0075429_100002159
788 Ga0075429_100011933
789 Ga0075429_100040638
790 Ga0075429_100041281
791 Ga0075429_100086458
792 Ga0075429_100137242
793 Ga0075429_100276397
794 Ga0075436_100002160
795 Ga0075436_100038901
796 Ga0075436_100101134
797 Ga0075436_100113970
798 Ga0097620_100039095
799 Ga0097620_100076508
800 Ga0075435_100011792
801 Ga0075435_100016181
802 Ga0075435_100019645
803 Ga0075435_100034499
804 Ga0075435_100580290
805 Ga0099794_10005153
806 Ga0105240_10030893
807 Ga0111539_10000124
808 Ga0111539_10011628
809 Ga0111539_10062922
810 Ga0111539_10139605
811 Ga0111539_10191658
812 Ga0111539_10354709
813 Ga0111539_10557713
814 Ga0111539_11284559
815 Ga0105245_10341081
816 Ga0114129_10002493
817 Ga0114129_10003512
818 Ga0114129_10017718
819 Ga0114129_10018084
820 Ga0114129_10024655
821 Ga0114129_10046962
822 Ga0114129_10053944
823 Ga0114129_10065912
824 Ga0114129_10068989
825 Ga0114129_10076475
826 Ga0114129_10082363
827 Ga0114129_10083508
828 Ga0114129_10162467
829 Ga0114129_10231231
830 Ga0114129_10307857
831 Ga0114129_10456418
832 Ga0114129_10512182
833 Ga0114129_10633547
834 Ga0114129_10674153
835 Ga0114129_10940271
836 Ga0105248_10090902
837 Ga0105238_10024989
838 Ga0105249_10082774
839 Ga0105249_10176399
840 Ga0105249_10241503
841 Ga0105028_106941
842 Ga0157371_10052121
843 Ga0157370_10012658
844 Ga0157374_10054046
845 Ga0157378_10072734
846 Ga0157378_10078063
847 Ga0157378_10448501
848 Ga0163162_10057974
849 Ga0163162_10166588
850 Ga0157372_10346592
851 Ga0157372_10919948
852 Ga0157375_10340579
853 Ga0163163_10004299
854 Ga0182008_10030915
855 Ga0182008_10046953
856 Ga0157379_10450326
857 Ga0182007_10039054
858 Ga0213871_10027502
859 Ga0209758_1000244
860 Ga0207426_1040099
861 Ga0207642_10028504
862 Ga0207699_10141831
863 Ga0207645_10039151
864 Ga0207684_10002639
865 Ga0207684_10004470
866 Ga0207684_10026421
867 Ga0207684_10096148
868 Ga0207707_10010790
869 Ga0207707_10184718
870 Ga0207707_10203717
871 Ga0207695_10178844
872 Ga0207693_10183323
873 Ga0207660_10032358
874 Ga0207660_10099254
875 Ga0207660_10216640
876 Ga0207660_10516454
877 Ga0207657_10180238
878 Ga0207657_10470614
879 Ga0207652_10010541
880 Ga0207652_10046211
881 Ga0207646_10001883
882 Ga0207646_10279814
883 Ga0207646_10660455
884 Ga0207681_10303897
885 Ga0207687_10098417
886 Ga0207687_10389126
887 Ga0207700_10191700
888 Ga0207700_10408953
889 Ga0207644_10330925
890 Ga0207670_10007280
891 Ga0207670_10158132
892 Ga0207670_10224554
893 Ga0207670_10440674
894 Ga0207665_10000418
895 Ga0207665_10422987
896 Ga0207691_10148122
897 Ga0207711_10007320
898 Ga0207667_10146465
899 Ga0207712_10377779
900 Ga0207668_10295784
901 Ga0207640_10605961
902 Ga0207677_10367247
903 Ga0207703_10241908
904 Ga0207703_10886614
905 Ga0207678_10124814
906 Ga0207708_10288542
907 Ga0207708_10372557
908 Ga0207641_10186149
909 Ga0207641_10818034
910 Ga0207648_10420020
911 Ga0207648_10509218
912 Ga0207676_10013655
913 Ga0207676_10605405
914 Ga0207674_10040228
915 Ga0207675_100433392
916 Ga0207683_10040272
917 Ga0207683_10046643
918 Ga0207683_10479925
919 Ga0209588_1019247
920 Ga0209588_1047994
921 Ga0209813_10022443
922 Ga0209813_10022663
923 Ga0207428_10000314
924 Ga0207428_10005435
925 Ga0207428_10138809
926 Ga0268265_10912030
927 Ga0265337_1001072
928 Ga0265334_10032868
929 Ga0265318_10002015
930 Ga0265338_10008257
931 Ga0307511_10000103
932 Ga0265330_10037629
933 Ga0265332_10014798
934 Ga0265328_10052595
935 Ga0265320_10022186
936 Ga0265320_10097662
937 Ga0265325_10004654
938 Ga0265325_10021089
939 Ga0265329_10005759
940 Ga0265329_10013968
941 Ga0265340_10001737
942 Ga0265340_10013957
943 Ga0265340_10036729
944 Ga0265339_10000837
945 Ga0265339_10010326
946 Ga0265339_10082570
947 Ga0265339_10096237
948 Ga0265331_10091382
949 Ga0265327_10070759
950 Ga0265316_10122775
951 Ga0265313_10008850
952 Ga0265313_10060460
953 Ga0265342_10001224
954 Ga0265342_10010536
955 Ga0265342_10012965
956 Ga0316577_10228515
957 Ga0307406_10066867
958 Ga0307416_100320496
959 Ga0307415_100352285
960 Ga0373930_0037452
961 Ga0373958_0008473
962 Ga0373938_0005630
963 Ga0373934_0053818
964 Ga0373949_0015833
965 Ga0373936_0020581
966 Ga0373939_0020324
967 Ga0373939_0048063
968 Ga0373941_0012508
969 Ga0373941_0159436
970 Ga0373945_0121911
971 Ga0373956_0038866
972 Ga0373942_0071574
973 Ga0373961_0009443
974 Ga0373961_0048021
975 Ga0373924_0105682
976 Ga0373931_0000725
977 Ga0373931_0002681
978 Ga0373931_0030209
979 Ga0373931_0167182
980 Ga0373931_0278101
981 Ga0373935_0014949
982 Ga0373935_0213144
983 Ga0373927_0021395
984 Ga0373933_0031795
985 Ga0373933_0137475
986 Ga0373937_0004611
987 Ga0373937_0006097
988 Ga0373937_0022491
989 Ga0373937_0235427
990 Ga0316584_0005489
991 Ga0373925_0025647
992 Ga0395899_0176971
993 Ga0395905_0070615
994 Ga0436364_0353987
995 Ga0395901_0542871
996 Ga0242420_013074
997 Ga0400489_72336
998 Ga0436365_0381106
999 Ga0436365_1246965
1000 Ga0436360_0257601
1001 Ga0436360_0614234
1002 Ga0436360_1068656
1003 Ga0436361_0986989
1004 Ga0436362_0753582
1005 Ga0439453_0001338
1006 Ga0439435_0046835
1007 Ga0439460_0090333
1008 Ga0451577_0005509
1009 Ga0451577_0095470
1010 Ga0439440_0008813
1011 Ga0453683_0003168
1012 Ga0453683_0012024
1013 Ga0453683_0028061
1014 Ga0453684_0014736
1015 Ga0453684_0992720
1016 Ga0466959_0088309
1017 Ga0451576_0016259
1018 Ga0451576_0034474
1019 Ga0451576_0065486
1020 Ga0451576_0084488
1021 Ga0466967_0424093
1022 Ga0495592_0362307
1023 Ga0495653_0287800
1024 Ga0495580_0048120
1025 Ga0495580_0101622
1026 Ga0495580_0150867
1027 Ga0495582_0109100
1028 Ga0495664_0108234
1029 Ga0495584_0148733
1030 Ga0495584_0317515
1031 Ga0495608_0219132
1032 Ga0495608_0291545
1033 Ga0495628_0084315
1034 Ga0495648_0238298
1035 Ga0495652_0086161
1036 Ga0495652_0210851
1037 Ga0495667_0039429
1038 Ga0495634_0207381
1039 Ga0495625_0257664
1040 Ga0495599_0080068
1041 Ga0495646_0078248
1042 Ga0495674_0046895
1043 Ga0495672_0008352
1044 Ga0495676_0311093
1045 Ga0495680_0063967
1046 Ga0495680_0380247
1047 Ga0495686_0295776
1048 Ga0496100_0031533
1049 Ga0496100_0052160
1050 Ga0496101_0085185
1051 Ga0496102_0080941
1052 Ga0496102_0092980
1053 Ga0496103_0055018
1054 Ga0496103_0124322
1055 Ga0496104_0131878
1056 Ga0496104_0277571
1057 Ga0496105_0035998
1058 Ga0496106_0039911
1059 Ga0496106_0437057
1060 Ga0496106_0495468
1061 Ga0496107_0200964
1062 Ga0496108_0027950
1063 Ga0496108_0075058
1064 Ga0496109_0171227
1065 Ga0496110_0116171
1066 Ga0496110_0290130
1067 Ga0496112_0285560
1068 Ga0496114_0147855
1069 Ga0496115_0118821
1070 Ga0501031_0006362
1071 Ga0501031_0007969
1072 Ga0501032_0007999
1073 Ga0501032_0058870
1074 Ga0501032_0317939
1075 Ga0501033_0002756
1076 Ga0501033_0044266
1077 Ga0501033_0065641
1078 Ga0501034_0003212
1079 Ga0501036_0001549
1080 Ga0501036_0029995
1081 Ga0501036_0051167
1082 Ga0501036_0562355
1083 Ga0501037_0001941
1084 Ga0501037_0202257
1085 Ga0501038_0012795
1086 Ga0501038_0050090
1087 Ga0501038_0515559
1088 Ga0501039_0004796
1089 Ga0501039_0050387
1090 Ga0501039_0341178
1091 Ga0501040_0057721
1092 Ga0501040_0113782
1093 Ga0501041_0019503
1094 Ga0501041_0400039
1095 Ga0501042_0029198
1096 Ga0501042_0115296
1097 Ga0501043_0329556
1098 Ga0501046_0003854
1099 Ga0501046_0442159
1100 Ga0501047_0013790
1101 Ga0501048_0003364
1102 Ga0501048_0009989
1103 Ga0501067_0004761
1104 Ga0501068_0004017
1105 Ga0501068_0169340
1106 Ga0501068_0180221
1107 Ga0501069_0001642
1108 Ga0501069_0044564
1109 Ga0501069_0171924
1110 Ga0501070_0017479
1111 Ga0501070_0592180
1112 Ga0501071_0010774
1113 Ga0501071_0019723
1114 Ga0501071_0363605
1115 Ga0501071_0464445
1116 Ga0501072_0003852
1117 Ga0501072_0222344
1118 Ga0501072_0338062
1119 Ga0501073_0007551
1120 Ga0501073_0168190
1121 Ga0501073_0271699
1122 Ga0501074_0030822
1123 Ga0501074_0198884
1124 Ga0501075_0008660
1125 Ga0501075_0299646
1126 Ga0501075_0431149
1127 Ga0501076_0032570
1128 Ga0501076_0046513
1129 Ga0501077_0268744
1130 Ga0501079_0078279
1131 Ga0501079_0597237
1132 Ga0501080_0011867
1133 Ga0501080_0124093
1134 Ga0501081_0041898
1135 Ga0501081_0580407
1136 Ga0501083_0192665
1137 Ga0501035_0018762
1138 Ga0501035_0119605
1139 Ga0501035_0224874
1140 Ga0501044_0000057
1141 Ga0501044_0014413
1142 Ga0501044_0206459
1143 Ga0501044_0356409
1144 Ga0501045_0036907
1145 Ga0501045_0040195
1146 Ga0501045_0410695
1147 nmdc:mga03683_10604_c1
1148 nmdc:mga03683_201308_c1
1149 nmdc:mga03683_4030_c1
1150 nmdc:mga03n38_34808_c1
1151 nmdc:mga03n38_69831_c1
1152 nmdc:mga00v17_19810_c1
1153 nmdc:mga00v17_385045_c1
1154 nmdc:mga0yw44_191481_c1
1155 nmdc:mga0yw44_226726_c1
1156 nmdc:mga0yw44_39587_c1
1157 nmdc:mga0k408_78958_c1
1158 nmdc:mga0k408_8961_c1
1159 nmdc:mga06z11_48960_c1
1160 nmdc:mga04h51_29317_c1
1161 nmdc:mga07m45_18344_c1
1162 nmdc:mga07m45_207017_c1
1163 nmdc:mga07m45_47616_c1
1164 nmdc:mga05p37_12850_c1
1165 nmdc:mga05p37_139477_c1
1166 nmdc:mga05p37_160948_c1
1167 nmdc:mga05p37_19550_c1
1168 nmdc:mga05p37_225905_c2
1169 nmdc:mga05p37_2389_c1
1170 nmdc:mga05p37_247384_c1
1171 nmdc:mga05p37_2490_c1
1172 nmdc:mga05p37_388157_c1
1173 nmdc:mga05p37_42965_c1
1174 nmdc:mga05p37_45890_c1
1175 nmdc:mga05p37_600370_c1
1176 nmdc:mga05p37_633987_c1
1177 nmdc:mga05p37_636000_c1
1178 nmdc:mga05p37_65680_c1
1179 nmdc:mga05p37_8957_c1
1180 nmdc:mga09592_103442_c1
1181 nmdc:mga09592_237606_c1
1182 nmdc:mga09592_24612_c1
1183 nmdc:mga09592_28838_c1
1184 nmdc:mga09592_529_c1
1185 nmdc:mga09592_535418_c1
1186 nmdc:mga09592_66296_c1
1187 nmdc:mga09592_6873_c1
1188 nmdc:mga09592_84570_c1
1189 nmdc:mga0qj67_13099_c1
1190 nmdc:mga0qj67_196425_c1
1191 nmdc:mga0qj67_2827_c1
1192 nmdc:mga0qj67_7328_c1
1193 nmdc:mga06r32_12759_c1
1194 nmdc:mga06r32_173714_c1
1195 nmdc:mga06r32_226909_c1
1196 nmdc:mga06r32_25894_c1
1197 nmdc:mga06r32_266541_c1
1198 nmdc:mga06r32_32462_c1
1199 nmdc:mga06r32_59501_c1
1200 nmdc:mga06r32_63568_c1
1201 nmdc:mga06r32_673_c1
1202 nmdc:mga06r32_69768_c1
1203 nmdc:mga08y16_140199_c1
1204 nmdc:mga08y16_213113_c1
1205 nmdc:mga08y16_3260_c1
1206 nmdc:mga08y16_36141_c1
1207 nmdc:mga08y16_3745_c1
1208 nmdc:mga08y16_398047_c1
1209 nmdc:mga08y16_41526_c1
1210 nmdc:mga0n895_10312_c1
1211 nmdc:mga0n895_16426_c1
1212 nmdc:mga0n895_21571_c1
1213 nmdc:mga0n895_23302_c1
1214 nmdc:mga0n895_2639_c1
1215 nmdc:mga0n895_471042_c1
1216 nmdc:mga0n895_56109_c1
1217 nmdc:mga0n895_58605_c1
1218 nmdc:mga0n895_59305_c1
1219 nmdc:mga0n895_7213_c1
1220 nmdc:mga0n895_792230_c1
1221 nmdc:mga0n895_9276_c1
1222 nmdc:mga0rr50_11160_c1
1223 nmdc:mga0rr50_120851_c1
1224 nmdc:mga0rr50_122747_c1
1225 nmdc:mga0rr50_311669_c1
1226 nmdc:mga0rr50_43204_c1
1227 nmdc:mga0rr50_4749_c1
1228 nmdc:mga0rr50_48095_c1
1229 nmdc:mga0rr50_7637_c1
1230 nmdc:mga08x19_334871_c1
1231 nmdc:mga08x19_538_c1
1232 nmdc:mga0a205_11548_c1
1233 nmdc:mga0a205_1161_c1
1234 nmdc:mga0a205_12415_c1
1235 nmdc:mga0a205_140747_c1
1236 nmdc:mga0a205_28074_c1
1237 nmdc:mga0a205_317_c1
1238 nmdc:mga0a205_36204_c1
1239 nmdc:mga0a205_3940_c2
1240 nmdc:mga0a205_592718_c1
1241 nmdc:mga0sz30_102550_c1
1242 nmdc:mga0sz30_34759_c2
1243 Ga0495601_0060412
1244 Ga0495619_0057957
1245 Ga0500646_0001852
1246 Ga0500583_0146104
1247 Ga0500641_0026280
1248 Ga0500562_041276
1249 Ga0500642_0101633
1250 Ga0500655_000777
1251 Ga0500568_0014147
1252 Ga0500604_0000550
1253 Ga0501084_0011282
1254 Ga0501084_0024095
1255 Ga0501084_0104496
1256 Ga0501084_0150629
1257 Ga0501084_0385634
1258 Ga0501084_0530864
1259 Ga0501082_0004059
1260 Ga0501082_0036048
1261 Ga0501082_0642267
1262 Ga0530510_0006864

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

38

191

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.923 6 225
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9198 6 235
4wbs-assembly1.cif.gz_A crystal structure of an abc transporter related protein from burkholderia phymatum 0.9193 6 238
5x5y-assembly1.cif.gz_A a membrane protein complex 0.9183 6 237
7efo-assembly1.cif.gz_A lptb2fg-lps from klebsiella pneumoniae in nanodiscs 0.9167 6 237
ID Description Score Start End Superfamily
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9439 5 238 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9262 3 226 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9244 5 238 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9237 6 220 3.40.50.300
4wbsA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9193 6 238 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A497QLC1-F1-model_v4 ABC transporter ATP-binding protein 0.9598 119 232 GO:0005524
GO:0016887
GO:0042626
GO:0043190
AF-A0A524QQB3-F1-model_v4 ATP-binding cassette domain-containing protein 0.9573 122 227 GO:0005524
GO:0016887
AF-A0A854DBZ5-F1-model_v4 deleted 0.9532 119 217
AF-A0A2N1QX64-F1-model_v4 ABC transporter ATP-binding protein 0.9492 119 238 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A7W3T3T6-F1-model_v4 ATP-binding cassette domain-containing protein 0.9485 7 237 GO:0005524
GO:0005886
GO:0016887

Map