F470916

General Info

Members Datasets Scaffolds Average Seq Length
631 253 631 116

Family's Representative Sequence

Representative Sequence 3300012498|Ga0157345_1043428|Ga0157345_10434281
Length 138
Sequence MSIETSLARAPANADTKGLDIMQISERPAGDVMIVDVSGKITLGDGGDVMLKDKMQSLIQQGKKKVVLNLGDVSYVDSAGLGEIVQAYATMNKGGGALKLLNTTKRIKDLLSITKLLTVFETFDNEPEALKSFQAAKV

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
106 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
124 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
188 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
194 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
195 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
196 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
198 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
199 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
201 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
202 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
203 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
204 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
211 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
212 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
213 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
214 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
219 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
224 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.4
Metatranscriptomes 4.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 1.43
Rhizosphere 97.94
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10271620 3300003203 Bacteria 500
2 Ga0058859_11684975 3300004798 Unclassified 523
3 Ga0058863_11589311 3300004799 Bacteria 899
4 Ga0058863_11856671 3300004799 Bacteria 683
5 Ga0058863_11962795 3300004799 Bacteria 1763
6 Ga0058861_10023773 3300004800 Bacteria 761
7 Ga0058861_10072445 3300004800 Bacteria 597
8 Ga0058861_10073597 3300004800 Unclassified 874
9 Ga0058861_11414578 3300004800 Bacteria 993
10 Ga0058860_12091568 3300004801 Unclassified 795
11 Ga0058862_10109303 3300004803 Bacteria 1017
12 Ga0058862_10141101 3300004803 Bacteria 1486
13 Ga0058862_12868634 3300004803 Bacteria 536
14 Ga0065714_10378903 3300005288 Unclassified 608
15 Ga0065704_10505876 3300005289 Unclassified 622
16 Ga0065712_10122969 3300005290 Bacteria 1644
17 Ga0065712_10123756 3300005290 Bacteria 1634
18 Ga0065712_10519671 3300005290 Bacteria 637
19 Ga0065715_10237197 3300005293 Archaea 1212
20 Ga0065715_10287935 3300005293 Bacteria 1063
21 Ga0065715_10679975 3300005293 Unclassified 663
22 Ga0065715_11023616 3300005293 Bacteria 539
23 Ga0065715_11132034 3300005293 Bacteria 513
24 Ga0065707_10051848 3300005295 Unclassified 862
25 Ga0065707_10181840 3300005295 Bacteria 1413
26 Ga0065707_11000299 3300005295 Unclassified 539
27 Ga0070676_11459666 3300005328 Unclassified 526
28 Ga0070683_100010335 3300005329 Bacteria 8028
29 Ga0070683_100020135 3300005329 Bacteria 5935
30 Ga0070683_100097137 3300005329 Bacteria 2771
31 Ga0070683_100812016 3300005329 Unclassified 897
32 Ga0070690_100287012 3300005330 Unclassified 1176
33 Ga0070690_101689192 3300005330 Unclassified 515
34 Ga0070670_100106251 3300005331 Bacteria 2419
35 Ga0070670_100365033 3300005331 Bacteria 1270
36 Ga0068869_100246472 3300005334 Unclassified 1425
37 Ga0068869_101286732 3300005334 Unclassified 645
38 Ga0068869_101410450 3300005334 Unclassified 617
39 Ga0070666_10045012 3300005335 Bacteria 2958
40 Ga0070666_10088745 3300005335 Bacteria 2122
41 Ga0070666_10218820 3300005335 Unclassified 1343
42 Ga0068868_101304462 3300005338 Unclassified 674
43 Ga0070689_100064248 3300005340 Bacteria 2856
44 Ga0070689_100099144 3300005340 Bacteria 2305
45 Ga0070691_11092799 3300005341 Unclassified 502
46 Ga0070687_100202436 3300005343 Bacteria 1204
47 Ga0070661_100232870 3300005344 Unclassified 1416
48 Ga0070661_100759941 3300005344 Bacteria 793
49 Ga0070692_10578711 3300005345 Bacteria 740
50 Ga0070668_100081222 3300005347 Bacteria 2541
51 Ga0070668_101274832 3300005347 Unclassified 667
52 Ga0070669_100412067 3300005353 Bacteria 1108
53 Ga0070675_100000561 3300005354 Bacteria 25582
54 Ga0070675_100006021 3300005354 Bacteria 9296
55 Ga0070675_100006819 3300005354 Bacteria 8770
56 Ga0070675_100232700 3300005354 Bacteria 1608
57 Ga0070675_100424296 3300005354 Bacteria 1190
58 Ga0070671_100002799 3300005355 Bacteria 13553
59 Ga0070674_100149982 3300005356 Unclassified 1758
60 Ga0070674_100744592 3300005356 Bacteria 842
61 Ga0070673_100013690 3300005364 Bacteria 5623
62 Ga0070673_100310463 3300005364 Bacteria 1391
63 Ga0070673_100578575 3300005364 Unclassified 1022
64 Ga0070673_102417124 3300005364 Bacteria 500
65 Ga0070688_100049679 3300005365 Unclassified 2611
66 Ga0070688_100630246 3300005365 Bacteria 824
67 Ga0070659_101437227 3300005366 Unclassified 614
68 Ga0070667_100035200 3300005367 Unclassified 4194
69 Ga0070667_100402078 3300005367 Bacteria 1247
70 Ga0070709_10000027 3300005434 Bacteria 126476
71 Ga0070709_10515772 3300005434 Bacteria 910
72 Ga0070709_11028962 3300005434 Bacteria 656
73 Ga0070709_11626148 3300005434 Unclassified 526
74 Ga0070713_100415003 3300005436 Unclassified 1259
75 Ga0070713_100661878 3300005436 Bacteria 995
76 Ga0070713_101523067 3300005436 Bacteria 649
77 Ga0070713_101645265 3300005436 Unclassified 623
78 Ga0070711_100405822 3300005439 Bacteria 1107
79 Ga0070705_100098569 3300005440 Bacteria 1840
80 Ga0070705_100710913 3300005440 Bacteria 790
81 Ga0070705_100921137 3300005440 Bacteria 704
82 Ga0070700_100464444 3300005441 Unclassified 966
83 Ga0070700_100578583 3300005441 Bacteria 876
84 Ga0070694_100110268 3300005444 Bacteria 1960
85 Ga0070694_100229683 3300005444 Bacteria 1395
86 Ga0070694_100370872 3300005444 Bacteria 1114
87 Ga0070694_100995093 3300005444 Bacteria 696
88 Ga0070708_100033294 3300005445 Unclassified 4478
89 Ga0070708_100223470 3300005445 Bacteria 1766
90 Ga0070708_100632947 3300005445 Bacteria 1008
91 Ga0070708_101677254 3300005445 Unclassified 591
92 Ga0070662_100124743 3300005457 Bacteria 1978
93 Ga0070662_100450087 3300005457 Bacteria 1069
94 Ga0070662_101511959 3300005457 Unclassified 579
95 Ga0070662_101895865 3300005457 Unclassified 515
96 Ga0070681_10293206 3300005458 Bacteria 1536
97 Ga0068867_101508233 3300005459 Bacteria 626
98 Ga0070685_10012804 3300005466 Unclassified 4412
99 Ga0070685_10078395 3300005466 Bacteria 1975
100 Ga0070685_10395319 3300005466 Bacteria 956
101 Ga0070685_10773915 3300005466 Bacteria 705
102 Ga0070685_10841828 3300005466 Bacteria 679
103 Ga0070706_100675122 3300005467 Bacteria 959
104 Ga0070706_100723290 3300005467 Bacteria 923
105 Ga0070706_101093853 3300005467 Unclassified 734
106 Ga0070707_100051486 3300005468 Bacteria 3948
107 Ga0070707_101723094 3300005468 Unclassified 594
108 Ga0070707_102216606 3300005468 Unclassified 517
109 Ga0070698_102036599 3300005471 Bacteria 527
110 Ga0070698_102112574 3300005471 Bacteria 517
111 Ga0070699_100313664 3300005518 Bacteria 1408
112 Ga0070699_100365228 3300005518 Bacteria 1302
113 Ga0070699_100837154 3300005518 Unclassified 842
114 Ga0070679_100079048 3300005530 Bacteria 3278
115 Ga0070679_100974642 3300005530 Unclassified 792
116 Ga0070684_100016295 3300005535 Bacteria 6072
117 Ga0070684_100031744 3300005535 Bacteria 4499
118 Ga0070684_100135750 3300005535 Bacteria 2222
119 Ga0070684_102352960 3300005535 Unclassified 502
120 Ga0070697_100166033 3300005536 Unclassified 1867
121 Ga0070697_101107768 3300005536 Bacteria 705
122 Ga0070697_101365134 3300005536 Unclassified 633
123 Ga0070672_100009590 3300005543 Bacteria 6679
124 Ga0070672_100027406 3300005543 Bacteria 4249
125 Ga0070672_100622864 3300005543 Bacteria 941
126 Ga0070672_101210783 3300005543 Unclassified 673
127 Ga0070686_100031756 3300005544 Unclassified 3232
128 Ga0070686_100105615 3300005544 Bacteria 1910
129 Ga0070695_100088287 3300005545 Bacteria 2064
130 Ga0070695_100768588 3300005545 Bacteria 770
131 Ga0070695_101019237 3300005545 Bacteria 674
132 Ga0070696_100650279 3300005546 Bacteria 855
133 Ga0070696_101775085 3300005546 Bacteria 533
134 Ga0070693_100032834 3300005547 Unclassified 2859
135 Ga0070665_100001839 3300005548 Bacteria 24104
136 Ga0070665_100460350 3300005548 Bacteria 1282
137 Ga0070704_100196913 3300005549 Unclassified 1624
138 Ga0070704_100209651 3300005549 Bacteria 1578
139 Ga0070704_100755180 3300005549 Bacteria 866
140 Ga0070704_100853003 3300005549 Bacteria 817
141 Ga0070664_100009177 3300005564 Bacteria 8030
142 Ga0070664_100126658 3300005564 Bacteria 2241
143 Ga0068857_100094453 3300005577 Bacteria 2678
144 Ga0068857_100315073 3300005577 Bacteria 1444
145 Ga0068857_100566627 3300005577 Bacteria 1071
146 Ga0068857_102307931 3300005577 Unclassified 528
147 Ga0068856_100136215 3300005614 Bacteria 2461
148 Ga0068859_100021862 3300005617 Bacteria 6416
149 Ga0068859_100029695 3300005617 Bacteria 5486
150 Ga0068859_100167584 3300005617 Bacteria 2276
151 Ga0068859_100897318 3300005617 Unclassified 971
152 Ga0068859_101181297 3300005617 Bacteria 842
153 Ga0068859_102257769 3300005617 Unclassified 600
154 Ga0068864_100071574 3300005618 Unclassified 3020
155 Ga0068864_100354016 3300005618 Bacteria 1386
156 Ga0068864_101671254 3300005618 Bacteria 641
157 Ga0068864_101899615 3300005618 Bacteria 601
158 Ga0068864_102442171 3300005618 Unclassified 529
159 Ga0068864_102485329 3300005618 Unclassified 524
160 Ga0068866_11227264 3300005718 Bacteria 542
161 Ga0068861_100356467 3300005719 Unclassified 1285
162 Ga0068861_100435976 3300005719 Unclassified 1171
163 Ga0068861_100495125 3300005719 Unclassified 1104
164 Ga0068861_100552746 3300005719 Bacteria 1049
165 Ga0068851_10142378 3300005834 Bacteria 1305
166 Ga0068870_10238762 3300005840 Bacteria 1121
167 Ga0068870_10636817 3300005840 Bacteria 729
168 Ga0068863_100003585 3300005841 Bacteria 15320
169 Ga0068863_100012059 3300005841 Bacteria 8350
170 Ga0068863_101300676 3300005841 Unclassified 734
171 Ga0068858_100000622 3300005842 Bacteria 36875
172 Ga0068858_100015561 3300005842 Bacteria 7154
173 Ga0068858_101342766 3300005842 Unclassified 704
174 Ga0068860_100008327 3300005843 Bacteria 10322
175 Ga0068860_100065353 3300005843 Bacteria 3455
176 Ga0068860_100761881 3300005843 Bacteria 980
177 Ga0068860_101082782 3300005843 Unclassified 821
178 Ga0068860_101348643 3300005843 Unclassified 734
179 Ga0068862_101522733 3300005844 Unclassified 674
180 Ga0081455_10065905 3300005937 Unclassified 3026
181 Ga0081455_10417071 3300005937 Bacteria 927
182 Ga0081455_10448183 3300005937 Unclassified 882
183 Ga0081455_10785476 3300005937 Unclassified 599
184 Ga0081539_10080001 3300005985 Bacteria 1720
185 Ga0075432_10410233 3300006058 Bacteria 587
186 Ga0070715_10742828 3300006163 Unclassified 590
187 Ga0070716_100032198 3300006173 Unclassified 2858
188 Ga0070716_100617338 3300006173 Bacteria 818
189 Ga0075366_10240616 3300006195 Bacteria 1103
190 Ga0097621_100029377 3300006237 Bacteria 4341
191 Ga0097621_100058936 3300006237 Bacteria 3142
192 Ga0097621_100175624 3300006237 Bacteria 1849
193 Ga0097621_101934208 3300006237 Unclassified 563
194 Ga0097621_102144374 3300006237 Unclassified 534
195 Ga0068871_100003868 3300006358 Bacteria 10324
196 Ga0068871_100115412 3300006358 Bacteria 2263
197 Ga0068871_100118141 3300006358 Unclassified 2237
198 Ga0068871_100614876 3300006358 Bacteria 989
199 Ga0068871_102154569 3300006358 Unclassified 531
200 Ga0075428_100230698 3300006844 Unclassified 1998
201 Ga0075428_100910293 3300006844 Unclassified 933
202 Ga0075428_101450126 3300006844 Unclassified 720
203 Ga0075428_102378018 3300006844 Unclassified 544
204 Ga0075430_100325831 3300006846 Unclassified 1270
205 Ga0075430_100813694 3300006846 Bacteria 770
206 Ga0075431_100745969 3300006847 Bacteria 955
207 Ga0075431_100805236 3300006847 Unclassified 912
208 Ga0075431_100903876 3300006847 Bacteria 852
209 Ga0075431_101861834 3300006847 Unclassified 557
210 Ga0075433_10215112 3300006852 Bacteria 1708
211 Ga0075433_10330126 3300006852 Bacteria 1349
212 Ga0075433_10411963 3300006852 Bacteria 1192
213 Ga0075433_10739223 3300006852 Bacteria 861
214 Ga0075433_11855160 3300006852 Bacteria 518
215 Ga0075434_100007880 3300006871 Bacteria 9867
216 Ga0075434_100011896 3300006871 Bacteria 8229
217 Ga0075434_100029923 3300006871 Bacteria 5360
218 Ga0075434_100075138 3300006871 Unclassified 3373
219 Ga0075434_100247530 3300006871 Bacteria 1802
220 Ga0075434_100250466 3300006871 Bacteria 1790
221 Ga0075434_100266861 3300006871 Bacteria 1731
222 Ga0075434_100424560 3300006871 Unclassified 1351
223 Ga0075434_100817440 3300006871 Bacteria 948
224 Ga0075434_100864884 3300006871 Bacteria 919
225 Ga0075434_100867964 3300006871 Unclassified 918
226 Ga0075429_100386991 3300006880 Bacteria 1224
227 Ga0075429_100581167 3300006880 Bacteria 982
228 Ga0075429_100644884 3300006880 Bacteria 928
229 Ga0068865_100099115 3300006881 Bacteria 2130
230 Ga0068865_101811745 3300006881 Unclassified 552
231 Ga0075436_100019148 3300006914 Bacteria 4689
232 Ga0075436_100087274 3300006914 Unclassified 2167
233 Ga0075436_100557623 3300006914 Bacteria 841
234 Ga0075436_101301930 3300006914 Unclassified 550
235 Ga0075436_101304849 3300006914 Unclassified 549
236 Ga0097620_100021862 3300006931 Bacteria 6416
237 Ga0097620_100029696 3300006931 Bacteria 5486
238 Ga0097620_100167576 3300006931 Bacteria 2276
239 Ga0097620_100897316 3300006931 Unclassified 971
240 Ga0097620_101181297 3300006931 Bacteria 842
241 Ga0097620_102257758 3300006931 Unclassified 600
242 Ga0075435_100008141 3300007076 Bacteria 7507
243 Ga0075435_100220249 3300007076 Bacteria 1611
244 Ga0075435_100257977 3300007076 Bacteria 1485
245 Ga0075435_100270272 3300007076 Unclassified 1450
246 Ga0075435_100436425 3300007076 Unclassified 1129
247 Ga0099794_10254552 3300007265 Bacteria 906
248 Ga0105240_10858636 3300009093 Bacteria 979
249 Ga0111539_10008713 3300009094 Bacteria 12870
250 Ga0111539_10172384 3300009094 Bacteria 2528
251 Ga0111539_10179323 3300009094 Unclassified 2474
252 Ga0111539_10226486 3300009094 Bacteria 2178
253 Ga0111539_10346292 3300009094 Bacteria 1730
254 Ga0111539_10431698 3300009094 Bacteria 1534
255 Ga0111539_10491417 3300009094 Unclassified 1429
256 Ga0111539_11160591 3300009094 Unclassified 897
257 Ga0111539_11863938 3300009094 Unclassified 697
258 Ga0111539_12202471 3300009094 Unclassified 639
259 Ga0105245_10186322 3300009098 Bacteria 1985
260 Ga0105245_10868411 3300009098 Unclassified 943
261 Ga0105245_11508988 3300009098 Bacteria 723
262 Ga0105247_10358464 3300009101 Bacteria 1028
263 Ga0105247_10386469 3300009101 Unclassified 994
264 Ga0105247_11418328 3300009101 Unclassified 563
265 Ga0114129_10000027 3300009147 Bacteria 112969
266 Ga0114129_10001825 3300009147 Bacteria 28997
267 Ga0114129_10018799 3300009147 Bacteria 9841
268 Ga0114129_10036913 3300009147 Bacteria 6899
269 Ga0114129_10095570 3300009147 Bacteria 4116
270 Ga0114129_10118843 3300009147 Unclassified 3641
271 Ga0114129_10291399 3300009147 Bacteria 2178
272 Ga0114129_10432921 3300009147 Bacteria 1728
273 Ga0114129_10437858 3300009147 Bacteria 1717
274 Ga0114129_10724159 3300009147 Bacteria 1276
275 Ga0114129_10780256 3300009147 Bacteria 1221
276 Ga0114129_10800699 3300009147 Unclassified 1202
277 Ga0114129_12634171 3300009147 Unclassified 600
278 Ga0114129_13459274 3300009147 Unclassified 506
279 Ga0105243_10295746 3300009148 Unclassified 1465
280 Ga0105243_11543415 3300009148 Bacteria 689
281 Ga0105243_12806520 3300009148 Unclassified 528
282 Ga0105241_10165999 3300009174 Bacteria 1819
283 Ga0105241_12395026 3300009174 Unclassified 527
284 Ga0105242_10014533 3300009176 Bacteria 6099
285 Ga0105242_10027344 3300009176 Unclassified 4528
286 Ga0105242_10052344 3300009176 Unclassified 3331
287 Ga0105242_10688162 3300009176 Unclassified 999
288 Ga0105242_10832535 3300009176 Bacteria 916
289 Ga0105242_10982693 3300009176 Bacteria 850
290 Ga0105242_11369231 3300009176 Bacteria 734
291 Ga0105242_11487055 3300009176 Unclassified 707
292 Ga0105248_10002208 3300009177 Bacteria 21567
293 Ga0105248_10007272 3300009177 Bacteria 12146
294 Ga0105248_10095369 3300009177 Bacteria 3350
295 Ga0105248_11839838 3300009177 Unclassified 687
296 Ga0105248_11876695 3300009177 Unclassified 680
297 Ga0105237_10058136 3300009545 Bacteria 3870
298 Ga0105237_10278471 3300009545 Bacteria 1675
299 Ga0105238_11692783 3300009551 Bacteria 663
300 Ga0105238_12740139 3300009551 Unclassified 529
301 Ga0105249_10201714 3300009553 Bacteria 1947
302 Ga0105249_10210695 3300009553 Bacteria 1907
303 Ga0105249_10548780 3300009553 Bacteria 1206
304 Ga0105249_10801528 3300009553 Bacteria 1006
305 Ga0105249_11403836 3300009553 Unclassified 770
306 Ga0099796_10100019 3300010159 Unclassified 1090
307 Ga0105239_12596038 3300010375 Unclassified 591
308 Ga0105246_10966173 3300011119 Unclassified 769
309 Ga0157345_1043428 3300012498 Bacteria 549
310 Ga0157315_1061746 3300012508 Unclassified 530
311 Ga0157370_10081074 3300013104 Bacteria 3054
312 Ga0157369_10139342 3300013105 Bacteria 2567
313 Ga0157369_10411229 3300013105 Bacteria 1403
314 Ga0157374_10114882 3300013296 Bacteria 2592
315 Ga0157374_10238766 3300013296 Unclassified 1787
316 Ga0157374_11955394 3300013296 Bacteria 612
317 Ga0157378_10429110 3300013297 Unclassified 1308
318 Ga0157378_10596237 3300013297 Unclassified 1115
319 Ga0157378_10779749 3300013297 Bacteria 980
320 Ga0157378_10926597 3300013297 Unclassified 903
321 Ga0157378_11586530 3300013297 Unclassified 700
322 Ga0157378_11893082 3300013297 Unclassified 645
323 Ga0157378_12320434 3300013297 Bacteria 588
324 Ga0163162_10017315 3300013306 Bacteria 7051
325 Ga0163162_10042783 3300013306 Bacteria 4535
326 Ga0163162_10114231 3300013306 Bacteria 2799
327 Ga0163162_10337511 3300013306 Bacteria 1639
328 Ga0157372_10011519 3300013307 Bacteria 9407
329 Ga0157375_10001702 3300013308 Bacteria 18879
330 Ga0157375_10212855 3300013308 Bacteria 2091
331 Ga0157375_10712872 3300013308 Unclassified 1156
332 Ga0157375_11900355 3300013308 Unclassified 707
333 Ga0157375_12116056 3300013308 Bacteria 670
334 Ga0157375_12160583 3300013308 Unclassified 663
335 Ga0157375_12265850 3300013308 Bacteria 647
336 Ga0163163_10015783 3300014325 Bacteria 6995
337 Ga0163163_10269055 3300014325 Bacteria 1755
338 Ga0163163_10772685 3300014325 Unclassified 1024
339 Ga0157380_10121211 3300014326 Unclassified 2215
340 Ga0157380_10188664 3300014326 Bacteria 1818
341 Ga0157380_10266899 3300014326 Unclassified 1558
342 Ga0157380_10509327 3300014326 Bacteria 1171
343 Ga0157380_10634752 3300014326 Unclassified 1063
344 Ga0157380_10696331 3300014326 Unclassified 1020
345 Ga0157377_10893799 3300014745 Unclassified 663
346 Ga0157377_11305461 3300014745 Bacteria 567
347 Ga0157379_10000180 3300014968 Bacteria 47884
348 Ga0157379_10016768 3300014968 Bacteria 6447
349 Ga0157379_10238565 3300014968 Unclassified 1649
350 Ga0157379_11860639 3300014968 Bacteria 592
351 Ga0157379_12356349 3300014968 Bacteria 531
352 Ga0157376_10031953 3300014969 Unclassified 4222
353 Ga0157376_10051429 3300014969 Bacteria 3423
354 Ga0157376_10053387 3300014969 Bacteria 3365
355 Ga0157376_10150442 3300014969 Bacteria 2099
356 Ga0157376_10237011 3300014969 Bacteria 1698
357 Ga0157376_10402741 3300014969 Bacteria 1324
358 Ga0157376_11981844 3300014969 Unclassified 620
359 Ga0163161_10157937 3300017792 Bacteria 1728
360 Ga0197907_11454574 3300020069 Unclassified 534
361 Ga0206356_10181684 3300020070 Unclassified 576
362 Ga0206349_1065094 3300020075 Unclassified 637
363 Ga0206355_1100806 3300020076 Unclassified 601
364 Ga0206355_1108649 3300020076 Unclassified 786
365 Ga0206352_11002165 3300020078 Bacteria 1646
366 Ga0206352_11289502 3300020078 Bacteria 789
367 Ga0206350_10688957 3300020080 Unclassified 564
368 Ga0206354_10600620 3300020081 Bacteria 1189
369 Ga0224712_10554300 3300022467 Unclassified 559
370 Ga0207666_1024151 3300025271 Bacteria 907
371 Ga0207682_10099949 3300025893 Unclassified 1267
372 Ga0207710_10252757 3300025900 Unclassified 881
373 Ga0207688_10446423 3300025901 Bacteria 806
374 Ga0207680_10032721 3300025903 Bacteria 2959
375 Ga0207680_10045484 3300025903 Bacteria 2588
376 Ga0207680_10451569 3300025903 Bacteria 912
377 Ga0207680_10455055 3300025903 Bacteria 909
378 Ga0207680_11225273 3300025903 Unclassified 535
379 Ga0207685_10096305 3300025905 Unclassified 1257
380 Ga0207699_10000008 3300025906 Bacteria 358402
381 Ga0207699_10551111 3300025906 Bacteria 836
382 Ga0207684_10904925 3300025910 Unclassified 742
383 Ga0207684_11042374 3300025910 Unclassified 683
384 Ga0207707_10060142 3300025912 Bacteria 3305
385 Ga0207695_10005117 3300025913 Bacteria 17558
386 Ga0207695_10822703 3300025913 Bacteria 809
387 Ga0207671_10243728 3300025914 Bacteria 1412
388 Ga0207671_10801075 3300025914 Bacteria 747
389 Ga0207671_11240682 3300025914 Unclassified 582
390 Ga0207663_10490105 3300025916 Bacteria 953
391 Ga0207660_10512302 3300025917 Bacteria 974
392 Ga0207662_10308656 3300025918 Bacteria 1053
393 Ga0207662_10525779 3300025918 Bacteria 817
394 Ga0207649_10627552 3300025920 Bacteria 829
395 Ga0207649_11526578 3300025920 Bacteria 529
396 Ga0207652_10040523 3300025921 Bacteria 3956
397 Ga0207652_11006533 3300025921 Bacteria 732
398 Ga0207646_10000802 3300025922 Bacteria 40924
399 Ga0207646_10201947 3300025922 Unclassified 1796
400 Ga0207681_11118145 3300025923 Bacteria 662
401 Ga0207694_10864185 3300025924 Unclassified 764
402 Ga0207694_11648867 3300025924 Bacteria 540
403 Ga0207650_10065664 3300025925 Unclassified 2720
404 Ga0207650_11384442 3300025925 Unclassified 598
405 Ga0207650_11620906 3300025925 Unclassified 549
406 Ga0207659_10004186 3300025926 Bacteria 8712
407 Ga0207659_10020534 3300025926 Bacteria 4368
408 Ga0207659_10020996 3300025926 Unclassified 4327
409 Ga0207659_10499683 3300025926 Bacteria 1029
410 Ga0207687_10095861 3300025927 Bacteria 2173
411 Ga0207700_10657066 3300025928 Bacteria 935
412 Ga0207644_10047878 3300025931 Unclassified 3053
413 Ga0207706_10058818 3300025933 Bacteria 3385
414 Ga0207706_10478346 3300025933 Bacteria 1076
415 Ga0207706_11143569 3300025933 Unclassified 649
416 Ga0207686_10006041 3300025934 Bacteria 6501
417 Ga0207686_10029032 3300025934 Bacteria 3258
418 Ga0207686_10168100 3300025934 Bacteria 1544
419 Ga0207686_10216205 3300025934 Unclassified 1381
420 Ga0207686_11048513 3300025934 Bacteria 663
421 Ga0207686_11389646 3300025934 Unclassified 578
422 Ga0207670_10141873 3300025936 Bacteria 1772
423 Ga0207670_10281201 3300025936 Bacteria 1297
424 Ga0207670_10715687 3300025936 Bacteria 830
425 Ga0207669_10212883 3300025937 Bacteria 1412
426 Ga0207669_10369565 3300025937 Bacteria 1114
427 Ga0207669_10562869 3300025937 Unclassified 921
428 Ga0207704_10011561 3300025938 Bacteria 4350
429 Ga0207665_10027615 3300025939 Unclassified 3749
430 Ga0207665_10177837 3300025939 Bacteria 1540
431 Ga0207665_10735623 3300025939 Bacteria 777
432 Ga0207691_10033703 3300025940 Unclassified 4768
433 Ga0207691_10041856 3300025940 Bacteria 4226
434 Ga0207691_10171284 3300025940 Unclassified 1901
435 Ga0207691_10321147 3300025940 Bacteria 1327
436 Ga0207711_10002005 3300025941 Bacteria 18409
437 Ga0207711_10008782 3300025941 Bacteria 8450
438 Ga0207711_10058094 3300025941 Bacteria 3327
439 Ga0207711_10818069 3300025941 Bacteria 867
440 Ga0207711_11571666 3300025941 Unclassified 601
441 Ga0207689_11402290 3300025942 Unclassified 585
442 Ga0207661_10007180 3300025944 Bacteria 7913
443 Ga0207661_10014604 3300025944 Bacteria 5760
444 Ga0207661_10464533 3300025944 Bacteria 1154
445 Ga0207661_10483455 3300025944 Bacteria 1131
446 Ga0207679_10022026 3300025945 Bacteria 4333
447 Ga0207651_10409908 3300025960 Bacteria 1154
448 Ga0207651_10748867 3300025960 Bacteria 863
449 Ga0207651_11070415 3300025960 Unclassified 722
450 Ga0207712_10480093 3300025961 Bacteria 1059
451 Ga0207712_11553625 3300025961 Unclassified 593
452 Ga0207668_10034432 3300025972 Bacteria 3364
453 Ga0207668_10630571 3300025972 Bacteria 936
454 Ga0207668_11242768 3300025972 Unclassified 670
455 Ga0207668_11957014 3300025972 Unclassified 528
456 Ga0207658_10019741 3300025986 Unclassified 4661
457 Ga0207658_10023133 3300025986 Bacteria 4334
458 Ga0207658_10448263 3300025986 Bacteria 1142
459 Ga0207658_11419672 3300025986 Bacteria 635
460 Ga0207677_10645836 3300026023 Unclassified 933
461 Ga0207677_11262302 3300026023 Unclassified 678
462 Ga0207703_11213424 3300026035 Bacteria 725
463 Ga0207703_11440730 3300026035 Unclassified 663
464 Ga0207639_10483835 3300026041 Bacteria 1128
465 Ga0207678_10236684 3300026067 Bacteria 1564
466 Ga0207708_10048107 3300026075 Bacteria 3246
467 Ga0207708_10590787 3300026075 Unclassified 940
468 Ga0207708_11049169 3300026075 Bacteria 709
469 Ga0207708_11879910 3300026075 Bacteria 525
470 Ga0207702_10103648 3300026078 Bacteria 2517
471 Ga0207641_10000841 3300026088 Bacteria 32663
472 Ga0207641_10005560 3300026088 Bacteria 10742
473 Ga0207641_10229509 3300026088 Bacteria 1725
474 Ga0207641_10288541 3300026088 Bacteria 1546
475 Ga0207641_10337536 3300026088 Unclassified 1433
476 Ga0207648_10192446 3300026089 Bacteria 1808
477 Ga0207648_10872253 3300026089 Unclassified 840
478 Ga0207648_11275538 3300026089 Unclassified 690
479 Ga0207676_10062877 3300026095 Unclassified 2946
480 Ga0207676_10398804 3300026095 Bacteria 1285
481 Ga0207676_10756059 3300026095 Unclassified 946
482 Ga0207676_10759228 3300026095 Bacteria 944
483 Ga0207674_10066249 3300026116 Bacteria 3638
484 Ga0207674_10433773 3300026116 Bacteria 1270
485 Ga0207674_11469588 3300026116 Unclassified 651
486 Ga0207674_11597209 3300026116 Unclassified 621
487 Ga0207675_100115164 3300026118 Bacteria 2540
488 Ga0207675_100226275 3300026118 Unclassified 1803
489 Ga0207675_100318786 3300026118 Unclassified 1517
490 Ga0207675_100509473 3300026118 Unclassified 1199
491 Ga0207675_101585875 3300026118 Unclassified 675
492 Ga0207683_10440691 3300026121 Bacteria 1200
493 Ga0207683_12174299 3300026121 Unclassified 503
494 Ga0207698_12166990 3300026142 Bacteria 569
495 Ga0209968_1082089 3300027526 Bacteria 580
496 Ga0209998_10181237 3300027717 Bacteria 548
497 Ga0207428_10098871 3300027907 Bacteria 2257
498 Ga0207428_10110943 3300027907 Bacteria 2111
499 Ga0207428_10425984 3300027907 Unclassified 969
500 Ga0268266_10641724 3300028379 Bacteria 1021
501 Ga0268266_11343948 3300028379 Bacteria 690
502 Ga0268265_10059207 3300028380 Bacteria 2929
503 Ga0268265_10282703 3300028380 Bacteria 1485
504 Ga0268265_11831405 3300028380 Unclassified 613
505 Ga0268264_10050144 3300028381 Bacteria 3475
506 Ga0268264_10434721 3300028381 Bacteria 1268
507 Ga0268264_10982958 3300028381 Bacteria 850
508 Ga0268264_11559550 3300028381 Bacteria 671
509 Ga0265338_10005958 3300028800 Bacteria 15684
510 Ga0265324_10100738 3300029957 Unclassified 982
511 Ga0265760_10000004 3300031090 Bacteria 149429
512 Ga0265332_10365298 3300031238 Unclassified 596
513 Ga0265339_10031381 3300031249 Bacteria 3003
514 Ga0265339_10367468 3300031249 Unclassified 676
515 Ga0265316_10192808 3300031344 Unclassified 1513
516 Ga0307408_100169335 3300031548 Bacteria 1743
517 Ga0265314_10013813 3300031711 Bacteria 6503
518 Ga0316583_10112514 3300032133 Bacteria 949
519 Ga0316580_10211232 3300032139 Bacteria 598
520 Ga0316587_1105476 3300033529 Unclassified 545
521 Ga0373928_0070603 3300035084 Unclassified 863
522 Ga0373949_0302386 3300035090 Unclassified 508
523 Ga0373923_0212771 3300035111 Bacteria 897
524 Ga0373939_0102110 3300035114 Unclassified 986
525 Ga0373957_0084349 3300035120 Bacteria 1257
526 Ga0373960_0115553 3300035121 Unclassified 885
527 Ga0373955_0538885 3300035172 Unclassified 714
528 Ga0373924_0041123 3300035410 Bacteria 1894
529 Ga0373931_0531925 3300035691 Unclassified 762
530 Ga0373931_0730817 3300035691 Unclassified 656
531 Ga0373927_0354336 3300035695 Unclassified 967
532 Ga0373933_0922899 3300035724 Unclassified 575
533 Ga0373937_0010740 3300036401 Bacteria 8011
534 Ga0373937_0539329 3300036401 Bacteria 1108
535 Ga0373925_0872541 3300037068 Bacteria 742
536 Ga0242420_018056 3300038996 Unclassified 1240
537 Ga0436363_1685299 3300039450 Bacteria 1000
538 Ga0436362_0148371 3300039453 Bacteria 959
539 Ga0436362_0183530 3300039453 Bacteria 903
540 Ga0436362_1222734 3300039453 Unclassified 630
541 Ga0436362_1281684 3300039453 Bacteria 1259
542 Ga0453683_0008851 3300044673 Bacteria 6739
543 Ga0453683_0278315 3300044673 Unclassified 1068
544 Ga0453684_0471322 3300044712 Unclassified 1394
545 Ga0451576_0446321 3300045051 Bacteria 1358
546 Ga0451576_2017842 3300045051 Bacteria 594
547 Ga0495580_0397904 3300046472 Unclassified 929
548 Ga0495652_0591559 3300046529 Bacteria 758
549 Ga0495621_0260616 3300046539 Unclassified 710
550 Ga0495621_0512636 3300046539 Unclassified 518
551 Ga0495659_0546057 3300046664 Unclassified 511
552 Ga0495623_0407932 3300046679 Bacteria 730
553 Ga0495658_0018364 3300046683 Unclassified 3635
554 Ga0495658_0036409 3300046683 Bacteria 2715
555 Ga0495600_0037416 3300046809 Bacteria 3155
556 Ga0495604_0423363 3300047317 Bacteria 874
557 Ga0495636_0019243 3300047318 Bacteria 2744
558 Ga0495636_0110880 3300047318 Bacteria 1207
559 Ga0495674_0087284 3300047319 Bacteria 2670
560 Ga0495684_0523060 3300047471 Bacteria 812
561 Ga0496100_1326867 3300048903 Bacteria 568
562 Ga0496104_0640450 3300048907 Bacteria 972
563 Ga0496105_0382465 3300048908 Unclassified 1120
564 Ga0496106_0371685 3300048909 Bacteria 1149
565 Ga0496107_0935739 3300048910 Bacteria 631
566 Ga0496109_0164167 3300048912 Unclassified 2082
567 Ga0496109_1365918 3300048912 Bacteria 644
568 Ga0496110_0561735 3300048913 Bacteria 1037
569 Ga0496114_0543625 3300048917 Bacteria 1027
570 Ga0501036_1271608 3300049572 Unclassified 599
571 Ga0501080_0255437 3300049742 Bacteria 1598
572 Ga0501045_0698707 3300049824 Unclassified 748
573 nmdc:mga05p37_1001_c1 3300050507 Bacteria 32203
574 nmdc:mga05p37_109976_c1 3300050507 Bacteria 3390
575 nmdc:mga05p37_15084_c1 3300050507 Bacteria 6968
576 nmdc:mga05p37_169384_c1 3300050507 Bacteria 2664
577 nmdc:mga05p37_17696_c1 3300050507 Bacteria 8599
578 nmdc:mga05p37_226201_c1 3300050507 Bacteria 2256
579 nmdc:mga05p37_289629_c1 3300050507 Bacteria 1949
580 nmdc:mga05p37_303169_c1 3300050507 Unclassified 1897
581 nmdc:mga05p37_369393_c1 3300050507 Bacteria 1684
582 nmdc:mga05p37_45876_c1 3300050507 Bacteria 5375
583 nmdc:mga05p37_559841_c1 3300050507 Bacteria 1299
584 nmdc:mga05p37_738211_c1 3300050507 Unclassified 1087
585 nmdc:mga09592_182037_c1 3300050508 Bacteria 1818
586 nmdc:mga0qj67_268209_c1 3300050509 Unclassified 1384
587 nmdc:mga06r32_159090_c1 3300050510 Bacteria 2241
588 nmdc:mga06r32_1632567_c1 3300050510 Unclassified 583
589 nmdc:mga06r32_449703_c1 3300050510 Bacteria 1268
590 nmdc:mga06r32_452939_c1 3300050510 Bacteria 1263
591 nmdc:mga08y16_1762564_c1 3300050511 Bacteria 573
592 nmdc:mga08y16_1965793_c1 3300050511 Unclassified 535
593 nmdc:mga08y16_306697_c1 3300050511 Bacteria 1635
594 nmdc:mga08y16_46877_c1 3300050511 Bacteria 4524
595 nmdc:mga08y16_569540_c1 3300050511 Bacteria 1145
596 nmdc:mga08y16_64794_c1 3300050511 Unclassified 3815
597 nmdc:mga08y16_85228_c1 3300050511 Bacteria 3293
598 nmdc:mga08y16_993842_c1 3300050511 Unclassified 819
599 nmdc:mga0n895_155146_c1 3300050512 Bacteria 2320
600 nmdc:mga0n895_370769_c1 3300050512 Unclassified 1449
601 nmdc:mga0n895_3790_c1 3300050512 Bacteria 12243
602 nmdc:mga0n895_396574_c1 3300050512 Unclassified 1396
603 nmdc:mga0n895_47868_c1 3300050512 Unclassified 4182
604 nmdc:mga0n895_581501_c1 3300050512 Unclassified 1124
605 nmdc:mga0n895_787552_c1 3300050512 Bacteria 942
606 nmdc:mga0n895_950079_c1 3300050512 Bacteria 843
607 nmdc:mga0rr50_10143_c1 3300050513 Bacteria 5963
608 nmdc:mga0rr50_113817_c1 3300050513 Unclassified 2144
609 nmdc:mga0rr50_301741_c1 3300050513 Unclassified 1340
610 nmdc:mga0rr50_394934_c1 3300050513 Unclassified 1168
611 nmdc:mga0rr50_470007_c1 3300050513 Unclassified 1067
612 nmdc:mga08x19_196388_c1 3300050514 Bacteria 1382
613 nmdc:mga08x19_55049_c1 3300050514 Unclassified 2562
614 nmdc:mga08x19_5727_c1 3300050514 Bacteria 7345
615 nmdc:mga0a205_105196_c2 3300050515 Bacteria 2221
616 nmdc:mga0a205_1304090_c1 3300050515 Bacteria 574
617 nmdc:mga0a205_241451_c1 3300050515 Bacteria 1687
618 nmdc:mga0a205_274129_c1 3300050515 Bacteria 1563
619 nmdc:mga0a205_298480_c1 3300050515 Bacteria 1484
620 nmdc:mga0a205_412343_c1 3300050515 Unclassified 1214
621 nmdc:mga0a205_56909_c1 3300050515 Bacteria 3775
622 nmdc:mga0a205_833903_c1 3300050515 Unclassified 769
623 Ga0495601_0462859 3300053077 Unclassified 820
624 Ga0495595_0288670 3300053084 Bacteria 824
625 Ga0495619_0309533 3300053085 Bacteria 1094
626 Ga0495619_0705234 3300053085 Unclassified 686
627 Ga0587085_164841 3300059506 Unclassified 521
628 Ga0587092_082316 3300059512 Unclassified 637
629 Ga0587067_145002 3300059640 Bacteria 591
630 Ga0587076_061435 3300059645 Unclassified 758
631 Ga0587076_151944 3300059645 Unclassified 563

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005468 Ga0070707_100051486 Ga0070707_1000514862 95
2 3300049824 Ga0501045_0698707 Ga0501045_0698707_261_569 101
3 3300025934 Ga0207686_11389646 Ga0207686_113896461 110
4 3300005293 Ga0065715_11023616 Ga0065715_110236161 111
5 3300005293 Ga0065715_11132034 Ga0065715_111320341 111
6 3300005295 Ga0065707_10181840 Ga0065707_101818402 111
7 3300005295 Ga0065707_11000299 Ga0065707_110002991 111
8 3300005329 Ga0070683_100812016 Ga0070683_1008120161 111
9 3300005334 Ga0068869_101410450 Ga0068869_1014104501 111
10 3300005335 Ga0070666_10088745 Ga0070666_100887454 111
11 3300005335 Ga0070666_10218820 Ga0070666_102188201 111
12 3300005340 Ga0070689_100064248 Ga0070689_1000642481 111
13 3300005344 Ga0070661_100759941 Ga0070661_1007599412 111
14 3300005345 Ga0070692_10578711 Ga0070692_105787111 111
15 3300005347 Ga0070668_100081222 Ga0070668_1000812224 111
16 3300005353 Ga0070669_100412067 Ga0070669_1004120671 111
17 3300005354 Ga0070675_100424296 Ga0070675_1004242962 111
18 3300005364 Ga0070673_102417124 Ga0070673_1024171241 111
19 3300005366 Ga0070659_101437227 Ga0070659_1014372272 111
20 3300005367 Ga0070667_100402078 Ga0070667_1004020781 111
21 3300005434 Ga0070709_10515772 Ga0070709_105157722 111
22 3300005436 Ga0070713_100415003 Ga0070713_1004150032 111
23 3300005440 Ga0070705_100921137 Ga0070705_1009211372 111
24 3300005441 Ga0070700_100578583 Ga0070700_1005785832 111
25 3300005444 Ga0070694_100110268 Ga0070694_1001102681 111
26 3300005444 Ga0070694_100370872 Ga0070694_1003708722 111
27 3300005444 Ga0070694_100995093 Ga0070694_1009950932 111
28 3300005445 Ga0070708_101677254 Ga0070708_1016772541 111
29 3300005457 Ga0070662_100124743 Ga0070662_1001247432 111
30 3300005459 Ga0068867_101508233 Ga0068867_1015082331 111
31 3300005466 Ga0070685_10395319 Ga0070685_103953192 111
32 3300005466 Ga0070685_10841828 Ga0070685_108418282 111
33 3300005467 Ga0070706_100675122 Ga0070706_1006751222 111
34 3300005467 Ga0070706_100723290 Ga0070706_1007232901 111
35 3300005467 Ga0070706_101093853 Ga0070706_1010938531 111
36 3300005468 Ga0070707_101723094 Ga0070707_1017230942 111
37 3300005471 Ga0070698_102036599 Ga0070698_1020365991 111
38 3300005471 Ga0070698_102112574 Ga0070698_1021125741 111
39 3300005518 Ga0070699_100365228 Ga0070699_1003652282 111
40 3300005535 Ga0070684_102352960 Ga0070684_1023529601 111
41 3300005536 Ga0070697_100166033 Ga0070697_1001660332 111
42 3300005536 Ga0070697_101365134 Ga0070697_1013651341 111
43 3300005543 Ga0070672_100009590 Ga0070672_1000095904 111
44 3300005545 Ga0070695_100768588 Ga0070695_1007685881 111
45 3300005546 Ga0070696_100650279 Ga0070696_1006502792 111
46 3300005546 Ga0070696_101775085 Ga0070696_1017750851 111
47 3300005548 Ga0070665_100001839 Ga0070665_10000183913 111
48 3300005549 Ga0070704_100196913 Ga0070704_1001969132 111
49 3300005549 Ga0070704_100209651 Ga0070704_1002096511 111
50 3300005549 Ga0070704_100853003 Ga0070704_1008530032 111
51 3300005614 Ga0068856_100136215 Ga0068856_1001362154 111
52 3300005617 Ga0068859_100167584 Ga0068859_1001675842 111
53 3300005617 Ga0068859_101181297 Ga0068859_1011812971 111
54 3300005618 Ga0068864_100354016 Ga0068864_1003540162 111
55 3300005618 Ga0068864_101899615 Ga0068864_1018996151 111
56 3300005618 Ga0068864_102442171 Ga0068864_1024421711 111
57 3300005718 Ga0068866_11227264 Ga0068866_112272642 111
58 3300005719 Ga0068861_100435976 Ga0068861_1004359762 111
59 3300005719 Ga0068861_100495125 Ga0068861_1004951252 111
60 3300005834 Ga0068851_10142378 Ga0068851_101423782 111
61 3300005840 Ga0068870_10238762 Ga0068870_102387622 111
62 3300005841 Ga0068863_100012059 Ga0068863_1000120596 111
63 3300005842 Ga0068858_100015561 Ga0068858_1000155611 111
64 3300005842 Ga0068858_101342766 Ga0068858_1013427662 111
65 3300005843 Ga0068860_100008327 Ga0068860_1000083273 111
66 3300005843 Ga0068860_100761881 Ga0068860_1007618812 111
67 3300005843 Ga0068860_101082782 Ga0068860_1010827822 111
68 3300005937 Ga0081455_10065905 Ga0081455_100659053 111
69 3300005937 Ga0081455_10448183 Ga0081455_104481831 111
70 3300006058 Ga0075432_10410233 Ga0075432_104102331 111
71 3300006163 Ga0070715_10742828 Ga0070715_107428282 111
72 3300006237 Ga0097621_100058936 Ga0097621_1000589362 111
73 3300006237 Ga0097621_100175624 Ga0097621_1001756242 111
74 3300006358 Ga0068871_100115412 Ga0068871_1001154121 111
75 3300006358 Ga0068871_100118141 Ga0068871_1001181412 111
76 3300006844 Ga0075428_100230698 Ga0075428_1002306982 111
77 3300006846 Ga0075430_100813694 Ga0075430_1008136941 111
78 3300006852 Ga0075433_10215112 Ga0075433_102151121 111
79 3300006852 Ga0075433_10411963 Ga0075433_104119632 111
80 3300006871 Ga0075434_100011896 Ga0075434_1000118962 111
81 3300006871 Ga0075434_100250466 Ga0075434_1002504662 111
82 3300006871 Ga0075434_100867964 Ga0075434_1008679642 111
83 3300006880 Ga0075429_100386991 Ga0075429_1003869913 111
84 3300006880 Ga0075429_100581167 Ga0075429_1005811672 111
85 3300006881 Ga0068865_100099115 Ga0068865_1000991152 111
86 3300006914 Ga0075436_100019148 Ga0075436_1000191484 111
87 3300006914 Ga0075436_100557623 Ga0075436_1005576232 111
88 3300006914 Ga0075436_101301930 Ga0075436_1013019301 111
89 3300006914 Ga0075436_101304849 Ga0075436_1013048491 111
90 3300006931 Ga0097620_100167576 Ga0097620_1001675762 111
91 3300006931 Ga0097620_101181297 Ga0097620_1011812971 111
92 3300007076 Ga0075435_100220249 Ga0075435_1002202492 111
93 3300007076 Ga0075435_100436425 Ga0075435_1004364252 111
94 3300007265 Ga0099794_10254552 Ga0099794_102545521 111
95 3300009093 Ga0105240_10858636 Ga0105240_108586362 111
96 3300009094 Ga0111539_10172384 Ga0111539_101723844 111
97 3300009094 Ga0111539_10179323 Ga0111539_101793233 111
98 3300009094 Ga0111539_11160591 Ga0111539_111605912 111
99 3300009094 Ga0111539_11863938 Ga0111539_118639381 111
100 3300009098 Ga0105245_10186322 Ga0105245_101863222 111
101 3300009098 Ga0105245_11508988 Ga0105245_115089881 111
102 3300009101 Ga0105247_10358464 Ga0105247_103584642 111
103 3300009147 Ga0114129_10001825 Ga0114129_1000182522 111
104 3300009147 Ga0114129_10018799 Ga0114129_100187998 111
105 3300009147 Ga0114129_10036913 Ga0114129_100369133 111
106 3300009147 Ga0114129_10118843 Ga0114129_101188432 111
107 3300009147 Ga0114129_10437858 Ga0114129_104378582 111
108 3300009147 Ga0114129_10800699 Ga0114129_108006992 111
109 3300009148 Ga0105243_10295746 Ga0105243_102957462 111
110 3300009148 Ga0105243_11543415 Ga0105243_115434151 111
111 3300009174 Ga0105241_10165999 Ga0105241_101659991 111
112 3300009176 Ga0105242_10014533 Ga0105242_100145334 111
113 3300009176 Ga0105242_11369231 Ga0105242_113692311 111
114 3300009177 Ga0105248_10007272 Ga0105248_100072728 111
115 3300009177 Ga0105248_10095369 Ga0105248_100953692 111
116 3300009545 Ga0105237_10058136 Ga0105237_100581362 111
117 3300009545 Ga0105237_10278471 Ga0105237_102784711 111
118 3300009551 Ga0105238_11692783 Ga0105238_116927832 111
119 3300009551 Ga0105238_12740139 Ga0105238_127401391 111
120 3300009553 Ga0105249_10201714 Ga0105249_102017142 111
121 3300009553 Ga0105249_10548780 Ga0105249_105487802 111
122 3300009553 Ga0105249_10801528 Ga0105249_108015282 111
123 3300010375 Ga0105239_12596038 Ga0105239_125960381 111
124 3300012508 Ga0157315_1061746 Ga0157315_10617461 111
125 3300013104 Ga0157370_10081074 Ga0157370_100810743 111
126 3300013105 Ga0157369_10139342 Ga0157369_101393421 111
127 3300013105 Ga0157369_10411229 Ga0157369_104112292 111
128 3300013296 Ga0157374_10114882 Ga0157374_101148822 111
129 3300013297 Ga0157378_12320434 Ga0157378_123204341 111
130 3300013306 Ga0163162_10042783 Ga0163162_100427833 111
131 3300013306 Ga0163162_10337511 Ga0163162_103375112 111
132 3300013308 Ga0157375_10712872 Ga0157375_107128721 111
133 3300013308 Ga0157375_12265850 Ga0157375_122658501 111
134 3300014326 Ga0157380_10266899 Ga0157380_102668992 111
135 3300014326 Ga0157380_10634752 Ga0157380_106347522 111
136 3300014326 Ga0157380_10696331 Ga0157380_106963312 111
137 3300014745 Ga0157377_11305461 Ga0157377_113054612 111
138 3300014968 Ga0157379_10016768 Ga0157379_100167683 111
139 3300014968 Ga0157379_10238565 Ga0157379_102385652 111
140 3300014968 Ga0157379_11860639 Ga0157379_118606392 111
141 3300014968 Ga0157379_12356349 Ga0157379_123563491 111
142 3300014969 Ga0157376_10051429 Ga0157376_100514292 111
143 3300014969 Ga0157376_10237011 Ga0157376_102370112 111
144 3300020069 Ga0197907_11454574 Ga0197907_114545741 111
145 3300020070 Ga0206356_10181684 Ga0206356_101816841 111
146 3300020075 Ga0206349_1065094 Ga0206349_10650941 111
147 3300020076 Ga0206355_1100806 Ga0206355_11008061 111
148 3300020078 Ga0206352_11002165 Ga0206352_110021652 111
149 3300020080 Ga0206350_10688957 Ga0206350_106889571 111
150 3300020081 Ga0206354_10600620 Ga0206354_106006201 111
151 3300022467 Ga0224712_10554300 Ga0224712_105543001 111
152 3300025271 Ga0207666_1024151 Ga0207666_10241512 111
153 3300025893 Ga0207682_10099949 Ga0207682_100999492 111
154 3300025901 Ga0207688_10446423 Ga0207688_104464232 111
155 3300025903 Ga0207680_10045484 Ga0207680_100454845 111
156 3300025903 Ga0207680_10451569 Ga0207680_104515691 111
157 3300025903 Ga0207680_10455055 Ga0207680_104550551 111
158 3300025906 Ga0207699_10551111 Ga0207699_105511112 111
159 3300025910 Ga0207684_10904925 Ga0207684_109049251 111
160 3300025910 Ga0207684_11042374 Ga0207684_110423742 111
161 3300025913 Ga0207695_10822703 Ga0207695_108227031 111
162 3300025914 Ga0207671_10243728 Ga0207671_102437281 111
163 3300025914 Ga0207671_11240682 Ga0207671_112406821 111
164 3300025918 Ga0207662_10525779 Ga0207662_105257793 111
165 3300025920 Ga0207649_10627552 Ga0207649_106275522 111
166 3300025922 Ga0207646_10201947 Ga0207646_102019471 111
167 3300025925 Ga0207650_11384442 Ga0207650_113844422 111
168 3300025926 Ga0207659_10499683 Ga0207659_104996832 111
169 3300025927 Ga0207687_10095861 Ga0207687_100958612 111
170 3300025933 Ga0207706_10058818 Ga0207706_100588183 111
171 3300025934 Ga0207686_10006041 Ga0207686_100060412 111
172 3300025934 Ga0207686_10029032 Ga0207686_100290324 111
173 3300025934 Ga0207686_11048513 Ga0207686_110485131 111
174 3300025936 Ga0207670_10141873 Ga0207670_101418732 111
175 3300025936 Ga0207670_10281201 Ga0207670_102812011 111
176 3300025936 Ga0207670_10715687 Ga0207670_107156871 111
177 3300025937 Ga0207669_10562869 Ga0207669_105628692 111
178 3300025938 Ga0207704_10011561 Ga0207704_100115612 111
179 3300025940 Ga0207691_10041856 Ga0207691_100418562 111
180 3300025940 Ga0207691_10171284 Ga0207691_101712842 111
181 3300025940 Ga0207691_10321147 Ga0207691_103211471 111
182 3300025941 Ga0207711_10008782 Ga0207711_100087825 111
183 3300025941 Ga0207711_10058094 Ga0207711_100580944 111
184 3300025941 Ga0207711_10818069 Ga0207711_108180692 111
185 3300025944 Ga0207661_10483455 Ga0207661_104834552 111
186 3300025961 Ga0207712_11553625 Ga0207712_115536252 111
187 3300025972 Ga0207668_10034432 Ga0207668_100344323 111
188 3300025972 Ga0207668_10630571 Ga0207668_106305711 111
189 3300025986 Ga0207658_10023133 Ga0207658_100231334 111
190 3300025986 Ga0207658_10448263 Ga0207658_104482632 111
191 3300026023 Ga0207677_11262302 Ga0207677_112623021 111
192 3300026035 Ga0207703_11213424 Ga0207703_112134242 111
193 3300026035 Ga0207703_11440730 Ga0207703_114407301 111
194 3300026041 Ga0207639_10483835 Ga0207639_104838352 111
195 3300026067 Ga0207678_10236684 Ga0207678_102366841 111
196 3300026075 Ga0207708_10048107 Ga0207708_100481073 111
197 3300026075 Ga0207708_11049169 Ga0207708_110491691 111
198 3300026075 Ga0207708_11879910 Ga0207708_118799102 111
199 3300026078 Ga0207702_10103648 Ga0207702_101036484 111
200 3300026088 Ga0207641_10005560 Ga0207641_100055602 111
201 3300026088 Ga0207641_10229509 Ga0207641_102295092 111
202 3300026088 Ga0207641_10337536 Ga0207641_103375362 111
203 3300026089 Ga0207648_10192446 Ga0207648_101924462 111
204 3300026095 Ga0207676_10398804 Ga0207676_103988042 111
205 3300026095 Ga0207676_10756059 Ga0207676_107560591 111
206 3300026116 Ga0207674_11469588 Ga0207674_114695881 111
207 3300026118 Ga0207675_100226275 Ga0207675_1002262752 111
208 3300026118 Ga0207675_100509473 Ga0207675_1005094731 111
209 3300026121 Ga0207683_10440691 Ga0207683_104406912 111
210 3300026142 Ga0207698_12166990 Ga0207698_121669901 111
211 3300027717 Ga0209998_10181237 Ga0209998_101812371 111
212 3300027907 Ga0207428_10098871 Ga0207428_100988711 111
213 3300028379 Ga0268266_10641724 Ga0268266_106417242 111
214 3300028380 Ga0268265_10059207 Ga0268265_100592073 111
215 3300028380 Ga0268265_10282703 Ga0268265_102827032 111
216 3300028381 Ga0268264_10434721 Ga0268264_104347211 111
217 3300028381 Ga0268264_10982958 Ga0268264_109829582 111
218 3300028381 Ga0268264_11559550 Ga0268264_115595501 111
219 3300031548 Ga0307408_100169335 Ga0307408_1001693352 111
220 3300032139 Ga0316580_10211232 Ga0316580_102112322 111
221 3300033529 Ga0316587_1105476 Ga0316587_11054761 111
222 3300035090 Ga0373949_0302386 Ga0373949_0302386_106_447 111
223 3300035111 Ga0373923_0212771 Ga0373923_0212771_32_370 111
224 3300035120 Ga0373957_0084349 Ga0373957_0084349_188_526 111
225 3300035172 Ga0373955_0538885 Ga0373955_0538885_260_598 111
226 3300035410 Ga0373924_0041123 Ga0373924_0041123_184_522 111
227 3300035724 Ga0373933_0922899 Ga0373933_0922899_17_355 111
228 3300036401 Ga0373937_0010740 Ga0373937_0010740_4749_5087 111
229 3300037068 Ga0373925_0872541 Ga0373925_0872541_202_552 111
230 3300046679 Ga0495623_0407932 Ga0495623_0407932_266_607 111
231 3300046683 Ga0495658_0018364 Ga0495658_0018364_1161_1499 111
232 3300046809 Ga0495600_0037416 Ga0495600_0037416_1434_1772 111
233 3300047317 Ga0495604_0423363 Ga0495604_0423363_194_535 111
234 3300047319 Ga0495674_0087284 Ga0495674_0087284_630_968 111
235 3300047471 Ga0495684_0523060 Ga0495684_0523060_357_695 111
236 3300048907 Ga0496104_0640450 Ga0496104_0640450_606_944 111
237 3300048909 Ga0496106_0371685 Ga0496106_0371685_173_514 111
238 3300048910 Ga0496107_0935739 Ga0496107_0935739_99_437 111
239 3300048912 Ga0496109_0164167 Ga0496109_0164167_260_601 111
240 3300048912 Ga0496109_1365918 Ga0496109_1365918_83_424 111
241 3300048917 Ga0496114_0543625 Ga0496114_0543625_623_961 111
242 3300049572 Ga0501036_1271608 Ga0501036_1271608_174_512 111
243 3300049742 Ga0501080_0255437 Ga0501080_0255437_54_392 111
244 3300050507 nmdc:mga05p37_15084_c1 nmdc:mga05p37_15084_c1_3563_3904 111
245 3300050507 nmdc:mga05p37_17696_c1 nmdc:mga05p37_17696_c1_1277_1621 111
246 3300050507 nmdc:mga05p37_226201_c1 nmdc:mga05p37_226201_c1_691_1032 111
247 3300050507 nmdc:mga05p37_303169_c1 nmdc:mga05p37_303169_c1_65_406 111
248 3300050507 nmdc:mga05p37_45876_c1 nmdc:mga05p37_45876_c1_3166_3507 111
249 3300050507 nmdc:mga05p37_738211_c1 nmdc:mga05p37_738211_c1_143_493 111
250 3300050508 nmdc:mga09592_182037_c1 nmdc:mga09592_182037_c1_495_836 111
251 3300050511 nmdc:mga08y16_1762564_c1 nmdc:mga08y16_1762564_c1_212_556 111
252 3300050511 nmdc:mga08y16_46877_c1 nmdc:mga08y16_46877_c1_1344_1685 111
253 3300050511 nmdc:mga08y16_569540_c1 nmdc:mga08y16_569540_c1_773_1114 111
254 3300050511 nmdc:mga08y16_993842_c1 nmdc:mga08y16_993842_c1_204_548 111
255 3300050512 nmdc:mga0n895_155146_c1 nmdc:mga0n895_155146_c1_1630_1971 111
256 3300050512 nmdc:mga0n895_370769_c1 nmdc:mga0n895_370769_c1_293_634 111
257 3300050513 nmdc:mga0rr50_394934_c1 nmdc:mga0rr50_394934_c1_176_517 111
258 3300050513 nmdc:mga0rr50_470007_c1 nmdc:mga0rr50_470007_c1_396_737 111
259 3300050514 nmdc:mga08x19_196388_c1 nmdc:mga08x19_196388_c1_79_420 111
260 3300050514 nmdc:mga08x19_5727_c1 nmdc:mga08x19_5727_c1_4835_5185 111
261 3300050515 nmdc:mga0a205_241451_c1 nmdc:mga0a205_241451_c1_1328_1672 111
262 3300050515 nmdc:mga0a205_298480_c1 nmdc:mga0a205_298480_c1_283_627 111
263 3300050515 nmdc:mga0a205_56909_c1 nmdc:mga0a205_56909_c1_811_1161 111
264 3300050515 nmdc:mga0a205_833903_c1 nmdc:mga0a205_833903_c1_206_586 111
265 3300053077 Ga0495601_0462859 Ga0495601_0462859_416_754 111
266 3300053084 Ga0495595_0288670 Ga0495595_0288670_183_521 111
267 3300053085 Ga0495619_0309533 Ga0495619_0309533_75_416 111
268 3300053085 Ga0495619_0705234 Ga0495619_0705234_260_598 111
269 3300005445 Ga0070708_100223470 Ga0070708_1002234702 112
270 3300005518 Ga0070699_100313664 Ga0070699_1003136641 112
271 3300005518 Ga0070699_100837154 Ga0070699_1008371541 112
272 3300005545 Ga0070695_100088287 Ga0070695_1000882872 112
273 3300044673 Ga0453683_0008851 Ga0453683_0008851_1356_1733 112
274 3300044673 Ga0453683_0278315 Ga0453683_0278315_459_836 112
275 3300044712 Ga0453684_0471322 Ga0453684_0471322_372_749 112
276 3300045051 Ga0451576_0446321 Ga0451576_0446321_130_507 112
277 3300004798 Ga0058859_11684975 Ga0058859_116849751 113
278 3300004799 Ga0058863_11589311 Ga0058863_115893112 113
279 3300004799 Ga0058863_11856671 Ga0058863_118566711 113
280 3300004799 Ga0058863_11962795 Ga0058863_119627953 113
281 3300004800 Ga0058861_10023773 Ga0058861_100237731 113
282 3300004800 Ga0058861_10072445 Ga0058861_100724451 113
283 3300004800 Ga0058861_10073597 Ga0058861_100735972 113
284 3300004800 Ga0058861_11414578 Ga0058861_114145782 113
285 3300004801 Ga0058860_12091568 Ga0058860_120915682 113
286 3300004803 Ga0058862_10109303 Ga0058862_101093033 113
287 3300004803 Ga0058862_10141101 Ga0058862_101411012 113
288 3300004803 Ga0058862_12868634 Ga0058862_128686341 113
289 3300005288 Ga0065714_10378903 Ga0065714_103789031 113
290 3300005289 Ga0065704_10505876 Ga0065704_105058761 113
291 3300005290 Ga0065712_10122969 Ga0065712_101229692 113
292 3300005290 Ga0065712_10123756 Ga0065712_101237562 113
293 3300005290 Ga0065712_10519671 Ga0065712_105196712 113
294 3300005293 Ga0065715_10287935 Ga0065715_102879351 113
295 3300005293 Ga0065715_10679975 Ga0065715_106799751 113
296 3300005295 Ga0065707_10051848 Ga0065707_100518481 113
297 3300005328 Ga0070676_11459666 Ga0070676_114596661 113
298 3300005329 Ga0070683_100010335 Ga0070683_1000103352 113
299 3300005329 Ga0070683_100020135 Ga0070683_1000201355 113
300 3300005329 Ga0070683_100097137 Ga0070683_1000971374 113
301 3300005330 Ga0070690_100287012 Ga0070690_1002870121 113
302 3300005330 Ga0070690_101689192 Ga0070690_1016891921 113
303 3300005331 Ga0070670_100106251 Ga0070670_1001062511 113
304 3300005331 Ga0070670_100365033 Ga0070670_1003650332 113
305 3300005334 Ga0068869_100246472 Ga0068869_1002464722 113
306 3300005334 Ga0068869_101286732 Ga0068869_1012867321 113
307 3300005335 Ga0070666_10045012 Ga0070666_100450122 113
308 3300005338 Ga0068868_101304462 Ga0068868_1013044622 113
309 3300005340 Ga0070689_100099144 Ga0070689_1000991442 113
310 3300005341 Ga0070691_11092799 Ga0070691_110927991 113
311 3300005343 Ga0070687_100202436 Ga0070687_1002024362 113
312 3300005344 Ga0070661_100232870 Ga0070661_1002328702 113
313 3300005347 Ga0070668_101274832 Ga0070668_1012748322 113
314 3300005354 Ga0070675_100000561 Ga0070675_10000056118 113
315 3300005354 Ga0070675_100006021 Ga0070675_1000060216 113
316 3300005354 Ga0070675_100006819 Ga0070675_1000068197 113
317 3300005355 Ga0070671_100002799 Ga0070671_1000027999 113
318 3300005356 Ga0070674_100149982 Ga0070674_1001499822 113
319 3300005356 Ga0070674_100744592 Ga0070674_1007445921 113
320 3300005364 Ga0070673_100013690 Ga0070673_1000136902 113
321 3300005364 Ga0070673_100310463 Ga0070673_1003104632 113
322 3300005364 Ga0070673_100578575 Ga0070673_1005785752 113
323 3300005365 Ga0070688_100049679 Ga0070688_1000496793 113
324 3300005365 Ga0070688_100630246 Ga0070688_1006302462 113
325 3300005367 Ga0070667_100035200 Ga0070667_1000352006 113
326 3300005434 Ga0070709_11028962 Ga0070709_110289622 113
327 3300005434 Ga0070709_11626148 Ga0070709_116261481 113
328 3300005436 Ga0070713_101523067 Ga0070713_1015230672 113
329 3300005436 Ga0070713_101645265 Ga0070713_1016452652 113
330 3300005439 Ga0070711_100405822 Ga0070711_1004058221 113
331 3300005440 Ga0070705_100098569 Ga0070705_1000985692 113
332 3300005441 Ga0070700_100464444 Ga0070700_1004644442 113
333 3300005444 Ga0070694_100229683 Ga0070694_1002296832 113
334 3300005445 Ga0070708_100632947 Ga0070708_1006329472 113
335 3300005457 Ga0070662_100450087 Ga0070662_1004500872 113
336 3300005457 Ga0070662_101511959 Ga0070662_1015119591 113
337 3300005457 Ga0070662_101895865 Ga0070662_1018958651 113
338 3300005458 Ga0070681_10293206 Ga0070681_102932062 113
339 3300005466 Ga0070685_10012804 Ga0070685_100128043 113
340 3300005466 Ga0070685_10078395 Ga0070685_100783953 113
341 3300005466 Ga0070685_10773915 Ga0070685_107739151 113
342 3300005468 Ga0070707_102216606 Ga0070707_1022166061 113
343 3300005530 Ga0070679_100079048 Ga0070679_1000790482 113
344 3300005530 Ga0070679_100974642 Ga0070679_1009746422 113
345 3300005535 Ga0070684_100016295 Ga0070684_1000162957 113
346 3300005535 Ga0070684_100031744 Ga0070684_1000317443 113
347 3300005535 Ga0070684_100135750 Ga0070684_1001357503 113
348 3300005536 Ga0070697_101107768 Ga0070697_1011077682 113
349 3300005543 Ga0070672_100027406 Ga0070672_1000274064 113
350 3300005543 Ga0070672_100622864 Ga0070672_1006228642 113
351 3300005543 Ga0070672_101210783 Ga0070672_1012107831 113
352 3300005544 Ga0070686_100031756 Ga0070686_1000317561 113
353 3300005544 Ga0070686_100105615 Ga0070686_1001056152 113
354 3300005545 Ga0070695_101019237 Ga0070695_1010192371 113
355 3300005547 Ga0070693_100032834 Ga0070693_1000328342 113
356 3300005548 Ga0070665_100460350 Ga0070665_1004603503 113
357 3300005549 Ga0070704_100755180 Ga0070704_1007551801 113
358 3300005564 Ga0070664_100009177 Ga0070664_1000091772 113
359 3300005564 Ga0070664_100126658 Ga0070664_1001266582 113
360 3300005577 Ga0068857_100094453 Ga0068857_1000944532 113
361 3300005577 Ga0068857_100315073 Ga0068857_1003150732 113
362 3300005577 Ga0068857_100566627 Ga0068857_1005666272 113
363 3300005577 Ga0068857_102307931 Ga0068857_1023079312 113
364 3300005617 Ga0068859_100021862 Ga0068859_1000218624 113
365 3300005617 Ga0068859_100029695 Ga0068859_1000296953 113
366 3300005617 Ga0068859_100897318 Ga0068859_1008973182 113
367 3300005617 Ga0068859_102257769 Ga0068859_1022577692 113
368 3300005618 Ga0068864_100071574 Ga0068864_1000715742 113
369 3300005618 Ga0068864_102485329 Ga0068864_1024853291 113
370 3300005719 Ga0068861_100356467 Ga0068861_1003564672 113
371 3300005719 Ga0068861_100552746 Ga0068861_1005527461 113
372 3300005840 Ga0068870_10636817 Ga0068870_106368172 113
373 3300005841 Ga0068863_100003585 Ga0068863_1000035853 113
374 3300005841 Ga0068863_101300676 Ga0068863_1013006761 113
375 3300005842 Ga0068858_100000622 Ga0068858_10000062211 113
376 3300005843 Ga0068860_100065353 Ga0068860_1000653534 113
377 3300005843 Ga0068860_101348643 Ga0068860_1013486432 113
378 3300005844 Ga0068862_101522733 Ga0068862_1015227332 113
379 3300005937 Ga0081455_10417071 Ga0081455_104170711 113
380 3300005937 Ga0081455_10785476 Ga0081455_107854762 113
381 3300006173 Ga0070716_100617338 Ga0070716_1006173382 113
382 3300006237 Ga0097621_100029377 Ga0097621_1000293772 113
383 3300006237 Ga0097621_101934208 Ga0097621_1019342081 113
384 3300006237 Ga0097621_102144374 Ga0097621_1021443741 113
385 3300006358 Ga0068871_100003868 Ga0068871_1000038682 113
386 3300006358 Ga0068871_100614876 Ga0068871_1006148762 113
387 3300006358 Ga0068871_102154569 Ga0068871_1021545691 113
388 3300006844 Ga0075428_100910293 Ga0075428_1009102932 113
389 3300006844 Ga0075428_101450126 Ga0075428_1014501262 113
390 3300006844 Ga0075428_102378018 Ga0075428_1023780181 113
391 3300006846 Ga0075430_100325831 Ga0075430_1003258313 113
392 3300006847 Ga0075431_100745969 Ga0075431_1007459692 113
393 3300006847 Ga0075431_100805236 Ga0075431_1008052362 113
394 3300006847 Ga0075431_100903876 Ga0075431_1009038761 113
395 3300006847 Ga0075431_101861834 Ga0075431_1018618341 113
396 3300006852 Ga0075433_10330126 Ga0075433_103301262 113
397 3300006852 Ga0075433_10739223 Ga0075433_107392231 113
398 3300006852 Ga0075433_11855160 Ga0075433_118551601 113
399 3300006871 Ga0075434_100007880 Ga0075434_1000078803 113
400 3300006871 Ga0075434_100029923 Ga0075434_1000299233 113
401 3300006871 Ga0075434_100075138 Ga0075434_1000751384 113
402 3300006871 Ga0075434_100247530 Ga0075434_1002475304 113
403 3300006871 Ga0075434_100266861 Ga0075434_1002668612 113
404 3300006871 Ga0075434_100424560 Ga0075434_1004245603 113
405 3300006871 Ga0075434_100817440 Ga0075434_1008174402 113
406 3300006871 Ga0075434_100864884 Ga0075434_1008648841 113
407 3300006880 Ga0075429_100644884 Ga0075429_1006448841 113
408 3300006881 Ga0068865_101811745 Ga0068865_1018117451 113
409 3300006914 Ga0075436_100087274 Ga0075436_1000872742 113
410 3300006931 Ga0097620_100021862 Ga0097620_1000218624 113
411 3300006931 Ga0097620_100029696 Ga0097620_1000296965 113
412 3300006931 Ga0097620_100897316 Ga0097620_1008973162 113
413 3300006931 Ga0097620_102257758 Ga0097620_1022577582 113
414 3300007076 Ga0075435_100008141 Ga0075435_1000081416 113
415 3300007076 Ga0075435_100257977 Ga0075435_1002579771 113
416 3300007076 Ga0075435_100270272 Ga0075435_1002702722 113
417 3300009094 Ga0111539_10008713 Ga0111539_100087138 113
418 3300009094 Ga0111539_10226486 Ga0111539_102264862 113
419 3300009094 Ga0111539_10346292 Ga0111539_103462923 113
420 3300009094 Ga0111539_10431698 Ga0111539_104316982 113
421 3300009094 Ga0111539_10491417 Ga0111539_104914172 113
422 3300009094 Ga0111539_12202471 Ga0111539_122024712 113
423 3300009098 Ga0105245_10868411 Ga0105245_108684112 113
424 3300009101 Ga0105247_10386469 Ga0105247_103864693 113
425 3300009101 Ga0105247_11418328 Ga0105247_114183281 113
426 3300009147 Ga0114129_10000027 Ga0114129_1000002740 113
427 3300009147 Ga0114129_10095570 Ga0114129_100955703 113
428 3300009147 Ga0114129_10291399 Ga0114129_102913994 113
429 3300009147 Ga0114129_10724159 Ga0114129_107241592 113
430 3300009147 Ga0114129_10780256 Ga0114129_107802563 113
431 3300009147 Ga0114129_12634171 Ga0114129_126341711 113
432 3300009147 Ga0114129_13459274 Ga0114129_134592741 113
433 3300009148 Ga0105243_12806520 Ga0105243_128065201 113
434 3300009176 Ga0105242_10027344 Ga0105242_100273442 113
435 3300009176 Ga0105242_10052344 Ga0105242_100523443 113
436 3300009176 Ga0105242_10688162 Ga0105242_106881622 113
437 3300009176 Ga0105242_10832535 Ga0105242_108325352 113
438 3300009176 Ga0105242_10982693 Ga0105242_109826931 113
439 3300009176 Ga0105242_11487055 Ga0105242_114870551 113
440 3300009177 Ga0105248_10002208 Ga0105248_100022089 113
441 3300009177 Ga0105248_11839838 Ga0105248_118398381 113
442 3300009177 Ga0105248_11876695 Ga0105248_118766952 113
443 3300009553 Ga0105249_10210695 Ga0105249_102106953 113
444 3300009553 Ga0105249_11403836 Ga0105249_114038362 113
445 3300011119 Ga0105246_10966173 Ga0105246_109661732 113
446 3300012498 Ga0157345_1043428 Ga0157345_10434281 113
447 3300013296 Ga0157374_10238766 Ga0157374_102387663 113
448 3300013296 Ga0157374_11955394 Ga0157374_119553941 113
449 3300013297 Ga0157378_10429110 Ga0157378_104291101 113
450 3300013297 Ga0157378_10596237 Ga0157378_105962372 113
451 3300013297 Ga0157378_10779749 Ga0157378_107797492 113
452 3300013297 Ga0157378_11893082 Ga0157378_118930822 113
453 3300013306 Ga0163162_10017315 Ga0163162_100173154 113
454 3300013306 Ga0163162_10114231 Ga0163162_101142313 113
455 3300013307 Ga0157372_10011519 Ga0157372_100115195 113
456 3300013308 Ga0157375_10001702 Ga0157375_100017025 113
457 3300013308 Ga0157375_10212855 Ga0157375_102128553 113
458 3300013308 Ga0157375_11900355 Ga0157375_119003553 113
459 3300013308 Ga0157375_12116056 Ga0157375_121160561 113
460 3300013308 Ga0157375_12160583 Ga0157375_121605831 113
461 3300014325 Ga0163163_10015783 Ga0163163_100157835 113
462 3300014325 Ga0163163_10269055 Ga0163163_102690552 113
463 3300014325 Ga0163163_10772685 Ga0163163_107726851 113
464 3300014326 Ga0157380_10121211 Ga0157380_101212113 113
465 3300014326 Ga0157380_10188664 Ga0157380_101886642 113
466 3300014326 Ga0157380_10509327 Ga0157380_105093272 113
467 3300014745 Ga0157377_10893799 Ga0157377_108937992 113
468 3300014968 Ga0157379_10000180 Ga0157379_1000018019 113
469 3300014969 Ga0157376_10031953 Ga0157376_100319532 113
470 3300014969 Ga0157376_10053387 Ga0157376_100533872 113
471 3300014969 Ga0157376_10150442 Ga0157376_101504423 113
472 3300014969 Ga0157376_10402741 Ga0157376_104027412 113
473 3300014969 Ga0157376_11981844 Ga0157376_119818441 113
474 3300017792 Ga0163161_10157937 Ga0163161_101579372 113
475 3300020076 Ga0206355_1108649 Ga0206355_11086492 113
476 3300020078 Ga0206352_11289502 Ga0206352_112895022 113
477 3300025900 Ga0207710_10252757 Ga0207710_102527573 113
478 3300025903 Ga0207680_10032721 Ga0207680_100327212 113
479 3300025903 Ga0207680_11225273 Ga0207680_112252731 113
480 3300025912 Ga0207707_10060142 Ga0207707_100601423 113
481 3300025913 Ga0207695_10005117 Ga0207695_1000511713 113
482 3300025914 Ga0207671_10801075 Ga0207671_108010752 113
483 3300025916 Ga0207663_10490105 Ga0207663_104901051 113
484 3300025917 Ga0207660_10512302 Ga0207660_105123022 113
485 3300025918 Ga0207662_10308656 Ga0207662_103086561 113
486 3300025920 Ga0207649_11526578 Ga0207649_115265782 113
487 3300025921 Ga0207652_10040523 Ga0207652_100405232 113
488 3300025921 Ga0207652_11006533 Ga0207652_110065331 113
489 3300025922 Ga0207646_10000802 Ga0207646_100008024 113
490 3300025923 Ga0207681_11118145 Ga0207681_111181452 113
491 3300025924 Ga0207694_10864185 Ga0207694_108641852 113
492 3300025924 Ga0207694_11648867 Ga0207694_116488672 113
493 3300025925 Ga0207650_10065664 Ga0207650_100656641 113
494 3300025925 Ga0207650_11620906 Ga0207650_116209061 113
495 3300025926 Ga0207659_10004186 Ga0207659_100041864 113
496 3300025926 Ga0207659_10020534 Ga0207659_100205343 113
497 3300025926 Ga0207659_10020996 Ga0207659_100209963 113
498 3300025931 Ga0207644_10047878 Ga0207644_100478783 113
499 3300025933 Ga0207706_10478346 Ga0207706_104783462 113
500 3300025933 Ga0207706_11143569 Ga0207706_111435691 113
501 3300025934 Ga0207686_10168100 Ga0207686_101681002 113
502 3300025934 Ga0207686_10216205 Ga0207686_102162052 113
503 3300025937 Ga0207669_10212883 Ga0207669_102128832 113
504 3300025937 Ga0207669_10369565 Ga0207669_103695652 113
505 3300025939 Ga0207665_10177837 Ga0207665_101778371 113
506 3300025939 Ga0207665_10735623 Ga0207665_107356232 113
507 3300025940 Ga0207691_10033703 Ga0207691_100337033 113
508 3300025941 Ga0207711_10002005 Ga0207711_100020059 113
509 3300025941 Ga0207711_11571666 Ga0207711_115716662 113
510 3300025942 Ga0207689_11402290 Ga0207689_114022902 113
511 3300025944 Ga0207661_10007180 Ga0207661_100071802 113
512 3300025944 Ga0207661_10014604 Ga0207661_100146045 113
513 3300025944 Ga0207661_10464533 Ga0207661_104645333 113
514 3300025945 Ga0207679_10022026 Ga0207679_100220262 113
515 3300025960 Ga0207651_10409908 Ga0207651_104099082 113
516 3300025960 Ga0207651_10748867 Ga0207651_107488672 113
517 3300025960 Ga0207651_11070415 Ga0207651_110704152 113
518 3300025961 Ga0207712_10480093 Ga0207712_104800932 113
519 3300025972 Ga0207668_11242768 Ga0207668_112427682 113
520 3300025972 Ga0207668_11957014 Ga0207668_119570142 113
521 3300025986 Ga0207658_10019741 Ga0207658_100197411 113
522 3300025986 Ga0207658_11419672 Ga0207658_114196722 113
523 3300026023 Ga0207677_10645836 Ga0207677_106458361 113
524 3300026075 Ga0207708_10590787 Ga0207708_105907872 113
525 3300026088 Ga0207641_10000841 Ga0207641_1000084121 113
526 3300026088 Ga0207641_10288541 Ga0207641_102885413 113
527 3300026089 Ga0207648_10872253 Ga0207648_108722531 113
528 3300026089 Ga0207648_11275538 Ga0207648_112755381 113
529 3300026095 Ga0207676_10062877 Ga0207676_100628773 113
530 3300026095 Ga0207676_10759228 Ga0207676_107592282 113
531 3300026116 Ga0207674_10066249 Ga0207674_100662492 113
532 3300026116 Ga0207674_10433773 Ga0207674_104337732 113
533 3300026116 Ga0207674_11597209 Ga0207674_115972092 113
534 3300026118 Ga0207675_100115164 Ga0207675_1001151643 113
535 3300026118 Ga0207675_100318786 Ga0207675_1003187863 113
536 3300026118 Ga0207675_101585875 Ga0207675_1015858752 113
537 3300026121 Ga0207683_12174299 Ga0207683_121742991 113
538 3300027526 Ga0209968_1082089 Ga0209968_10820891 113
539 3300027907 Ga0207428_10110943 Ga0207428_101109432 113
540 3300027907 Ga0207428_10425984 Ga0207428_104259842 113
541 3300028379 Ga0268266_11343948 Ga0268266_113439482 113
542 3300028380 Ga0268265_11831405 Ga0268265_118314051 113
543 3300028381 Ga0268264_10050144 Ga0268264_100501444 113
544 3300028800 Ga0265338_10005958 Ga0265338_100059582 113
545 3300029957 Ga0265324_10100738 Ga0265324_101007382 113
546 3300031090 Ga0265760_10000004 Ga0265760_100000048 113
547 3300031238 Ga0265332_10365298 Ga0265332_103652981 113
548 3300031249 Ga0265339_10031381 Ga0265339_100313813 113
549 3300031249 Ga0265339_10367468 Ga0265339_103674682 113
550 3300031344 Ga0265316_10192808 Ga0265316_101928083 113
551 3300031711 Ga0265314_10013813 Ga0265314_100138133 113
552 3300032133 Ga0316583_10112514 Ga0316583_101125141 113
553 3300035084 Ga0373928_0070603 Ga0373928_0070603_282_641 113
554 3300035114 Ga0373939_0102110 Ga0373939_0102110_195_554 113
555 3300035121 Ga0373960_0115553 Ga0373960_0115553_253_612 113
556 3300035691 Ga0373931_0531925 Ga0373931_0531925_71_433 113
557 3300035691 Ga0373931_0730817 Ga0373931_0730817_151_555 113
558 3300035695 Ga0373927_0354336 Ga0373927_0354336_110_472 113
559 3300036401 Ga0373937_0539329 Ga0373937_0539329_246_608 113
560 3300038996 Ga0242420_018056 Ga0242420_018056_398_760 113
561 3300039453 Ga0436362_0148371 Ga0436362_0148371_252_602 113
562 3300039453 Ga0436362_1222734 Ga0436362_1222734_178_540 113
563 3300039453 Ga0436362_1281684 Ga0436362_1281684_272_634 113
564 3300045051 Ga0451576_2017842 Ga0451576_2017842_44_406 113
565 3300046472 Ga0495580_0397904 Ga0495580_0397904_201_563 113
566 3300046529 Ga0495652_0591559 Ga0495652_0591559_121_483 113
567 3300046539 Ga0495621_0260616 Ga0495621_0260616_233_586 113
568 3300046539 Ga0495621_0512636 Ga0495621_0512636_76_435 113
569 3300046664 Ga0495659_0546057 Ga0495659_0546057_73_432 113
570 3300046683 Ga0495658_0036409 Ga0495658_0036409_2188_2547 113
571 3300047318 Ga0495636_0019243 Ga0495636_0019243_2002_2349 113
572 3300047318 Ga0495636_0110880 Ga0495636_0110880_192_545 113
573 3300048903 Ga0496100_1326867 Ga0496100_1326867_152_502 113
574 3300048908 Ga0496105_0382465 Ga0496105_0382465_125_487 113
575 3300048913 Ga0496110_0561735 Ga0496110_0561735_255_608 113
576 3300050507 nmdc:mga05p37_109976_c1 nmdc:mga05p37_109976_c1_578_937 113
577 3300050507 nmdc:mga05p37_169384_c1 nmdc:mga05p37_169384_c1_2173_2535 113
578 3300050507 nmdc:mga05p37_289629_c1 nmdc:mga05p37_289629_c1_200_547 113
579 3300050507 nmdc:mga05p37_369393_c1 nmdc:mga05p37_369393_c1_1187_1549 113
580 3300050509 nmdc:mga0qj67_268209_c1 nmdc:mga0qj67_268209_c1_633_995 113
581 3300050510 nmdc:mga06r32_159090_c1 nmdc:mga06r32_159090_c1_1791_2141 113
582 3300050510 nmdc:mga06r32_1632567_c1 nmdc:mga06r32_1632567_c1_63_425 113
583 3300050510 nmdc:mga06r32_449703_c1 nmdc:mga06r32_449703_c1_812_1174 113
584 3300050510 nmdc:mga06r32_452939_c1 nmdc:mga06r32_452939_c1_766_1128 113
585 3300050511 nmdc:mga08y16_1965793_c1 nmdc:mga08y16_1965793_c1_17_370 113
586 3300050511 nmdc:mga08y16_306697_c1 nmdc:mga08y16_306697_c1_162_524 113
587 3300050511 nmdc:mga08y16_64794_c1 nmdc:mga08y16_64794_c1_1957_2307 113
588 3300050511 nmdc:mga08y16_85228_c1 nmdc:mga08y16_85228_c1_1449_1802 113
589 3300050512 nmdc:mga0n895_3790_c1 nmdc:mga0n895_3790_c1_5125_5484 113
590 3300050512 nmdc:mga0n895_396574_c1 nmdc:mga0n895_396574_c1_395_754 113
591 3300050512 nmdc:mga0n895_47868_c1 nmdc:mga0n895_47868_c1_230_592 113
592 3300050512 nmdc:mga0n895_581501_c1 nmdc:mga0n895_581501_c1_565_927 113
593 3300050512 nmdc:mga0n895_787552_c1 nmdc:mga0n895_787552_c1_28_390 113
594 3300050512 nmdc:mga0n895_950079_c1 nmdc:mga0n895_950079_c1_129_491 113
595 3300050513 nmdc:mga0rr50_10143_c1 nmdc:mga0rr50_10143_c1_4916_5275 113
596 3300050513 nmdc:mga0rr50_113817_c1 nmdc:mga0rr50_113817_c1_961_1323 113
597 3300050513 nmdc:mga0rr50_301741_c1 nmdc:mga0rr50_301741_c1_817_1179 113
598 3300050514 nmdc:mga08x19_55049_c1 nmdc:mga08x19_55049_c1_1292_1651 113
599 3300050515 nmdc:mga0a205_105196_c2 nmdc:mga0a205_105196_c2_1450_1809 113
600 3300050515 nmdc:mga0a205_1304090_c1 nmdc:mga0a205_1304090_c1_27_389 113
601 3300050515 nmdc:mga0a205_274129_c1 nmdc:mga0a205_274129_c1_318_680 113
602 3300050515 nmdc:mga0a205_412343_c1 nmdc:mga0a205_412343_c1_265_627 113
603 3300059506 Ga0587085_164841 Ga0587085_164841_48_410 113
604 3300059512 Ga0587092_082316 Ga0587092_082316_93_455 113
605 3300059640 Ga0587067_145002 Ga0587067_145002_162_509 113
606 3300059645 Ga0587076_061435 Ga0587076_061435_90_452 113
607 3300059645 Ga0587076_151944 Ga0587076_151944_171_515 113
608 3300003203 JGI25406J46586_10271620 JGI25406J46586_102716201 114
609 3300005293 Ga0065715_10237197 Ga0065715_102371972 114
610 3300005354 Ga0070675_100232700 Ga0070675_1002327002 114
611 3300005434 Ga0070709_10000027 Ga0070709_1000002794 114
612 3300005436 Ga0070713_100661878 Ga0070713_1006618782 114
613 3300005440 Ga0070705_100710913 Ga0070705_1007109132 114
614 3300005445 Ga0070708_100033294 Ga0070708_1000332941 114
615 3300005618 Ga0068864_101671254 Ga0068864_1016712542 114
616 3300005985 Ga0081539_10080001 Ga0081539_100800011 114
617 3300006173 Ga0070716_100032198 Ga0070716_1000321982 114
618 3300006195 Ga0075366_10240616 Ga0075366_102406162 114
619 3300009147 Ga0114129_10432921 Ga0114129_104329213 114
620 3300009174 Ga0105241_12395026 Ga0105241_123950261 114
621 3300010159 Ga0099796_10100019 Ga0099796_101000192 114
622 3300013297 Ga0157378_10926597 Ga0157378_109265971 114
623 3300013297 Ga0157378_11586530 Ga0157378_115865302 114
624 3300025905 Ga0207685_10096305 Ga0207685_100963052 114
625 3300025906 Ga0207699_10000008 Ga0207699_1000000817 114
626 3300025928 Ga0207700_10657066 Ga0207700_106570662 114
627 3300025939 Ga0207665_10027615 Ga0207665_100276155 114
628 3300039450 Ga0436363_1685299 Ga0436363_1685299_559_903 114
629 3300039453 Ga0436362_0183530 Ga0436362_0183530_313_663 114
630 3300050507 nmdc:mga05p37_1001_c1 nmdc:mga05p37_1001_c1_12051_12410 114
631 3300050507 nmdc:mga05p37_559841_c1 nmdc:mga05p37_559841_c1_434_829 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01740

STAS

STAS domain

23

129

0.91

PF13466

STAS_2

STAS domain

35

116

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f43-assembly1.cif.gz_A-2 crystal structure of a putative anti-sigma factor antagonist (tm1081) from thermotoga maritima at 1.59 a resolution 0.9082 6 113
3if5-assembly1.cif.gz_A-2 crystal structure analysis of mglu 0.9007 7 81
4hyl-assembly1.cif.gz_A the crystal structure of an anti-sigma-factor antagonist from haliangium ochraceum dsm 14365 0.8973 2 111
1th8-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii 0.8948 3 113
6m36-assembly1.cif.gz_H the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8856 3 103
ID Description Score Start End Superfamily
3if5A02 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9007 7 81 3.30.750.24
3f43A01 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8932 9 112 3.30.750.24
af_P53273_654_785_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8928 13 112 3.30.750.24
af_I1KA21_504_648_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8828 13 113 3.30.750.24
4qtpB00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8806 3 113 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A1L6LHU7-F1-model_v4 deleted 0.996 3 113
AF-A0A2V9PKL9-F1-model_v4 Anti-sigma factor antagonist 0.9957 3 113 GO:0043856
AF-A0A2V9XR24-F1-model_v4 Anti-sigma factor antagonist 0.995 2 86 GO:0043856
AF-A0A2D6R3H5-F1-model_v4 Anti-sigma factor antagonist 0.9949 2 113 GO:0043856
AF-A0A7T9G9U0-F1-model_v4 deleted 0.9949 2 113

Feature Viewer

pLDDT pTM Quality
89.48 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map