F470838
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 630 | 288 | 630 | 203 |
Family's Representative Sequence
| Representative Sequence | 3300026075|Ga0207708_10161441|Ga0207708_101614413 |
| Length | 198 |
| Sequence | MAIRKVARLGHPVLRQRAEEVPETEISSPRVQGIIEDLLVTMVEYDGAGLAAPQIHESVRIAVLVLDEQTDPHIWINPVITPIGDEMISSYEGCLSVPGLRGAVARHAEIEVDAVDRTGRPLHFHLKGFPAIVAQHECDHLDGVLFPQRMTDLTLLAYNDEPGPLAREVHENPDGIDPLFIDLVERWPGRGRWFPGKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 86 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 171 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 172 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 173 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 175 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 176 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 179 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 180 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 184 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 190 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 193 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 194 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 195 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 199 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 200 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 201 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 202 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 203 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 204 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 205 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 206 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 207 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 208 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 209 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 210 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 211 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 272 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 273 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 287 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.84 |
| Metatranscriptomes | 0.16 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.79 |
| Rhizosphere | 99.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10036712 | 3300003203 | Bacteria | 1775 |
| 2 | Ga0065707_10082232 | 3300005295 | Bacteria | 18627 |
| 3 | Ga0065707_10140127 | 3300005295 | Bacteria | 1771 |
| 4 | Ga0070658_10106268 | 3300005327 | Bacteria | 2322 |
| 5 | Ga0070676_10001054 | 3300005328 | Bacteria | 13725 |
| 6 | Ga0070683_100009336 | 3300005329 | Bacteria | 8383 |
| 7 | Ga0070683_100072418 | 3300005329 | Bacteria | 3216 |
| 8 | Ga0070690_100000289 | 3300005330 | Bacteria | 25771 |
| 9 | Ga0070690_100008257 | 3300005330 | Bacteria | 5989 |
| 10 | Ga0070690_100010634 | 3300005330 | Bacteria | 5361 |
| 11 | Ga0070690_100395550 | 3300005330 | Unclassified | 1014 |
| 12 | Ga0070690_100840140 | 3300005330 | Bacteria | 715 |
| 13 | Ga0070677_10018848 | 3300005333 | Bacteria | 2492 |
| 14 | Ga0070677_10142766 | 3300005333 | Bacteria | 1106 |
| 15 | Ga0068869_100000299 | 3300005334 | Bacteria | 26389 |
| 16 | Ga0068869_100000782 | 3300005334 | Bacteria | 18135 |
| 17 | Ga0068869_100186958 | 3300005334 | Bacteria | 1627 |
| 18 | Ga0070666_10001388 | 3300005335 | Bacteria | 14648 |
| 19 | Ga0070666_10025570 | 3300005335 | Bacteria | 3849 |
| 20 | Ga0070666_10097599 | 3300005335 | Bacteria | 2023 |
| 21 | Ga0070680_100007424 | 3300005336 | Bacteria | 8367 |
| 22 | Ga0070680_100118235 | 3300005336 | Bacteria | 2211 |
| 23 | Ga0070680_100401851 | 3300005336 | Bacteria | 1168 |
| 24 | Ga0070680_100607685 | 3300005336 | Bacteria | 939 |
| 25 | Ga0068868_100000531 | 3300005338 | Bacteria | 25572 |
| 26 | Ga0068868_100024328 | 3300005338 | Bacteria | 4595 |
| 27 | Ga0070689_100190308 | 3300005340 | Bacteria | 1671 |
| 28 | Ga0070689_100202158 | 3300005340 | Bacteria | 1623 |
| 29 | Ga0070689_100611661 | 3300005340 | Bacteria | 945 |
| 30 | Ga0070691_10050732 | 3300005341 | Bacteria | 1980 |
| 31 | Ga0070691_10154485 | 3300005341 | Bacteria | 1179 |
| 32 | Ga0070687_100000355 | 3300005343 | Bacteria | 15578 |
| 33 | Ga0070687_100000403 | 3300005343 | Bacteria | 14616 |
| 34 | Ga0070687_100265429 | 3300005343 | Unclassified | 1073 |
| 35 | Ga0070687_100410856 | 3300005343 | Bacteria | 890 |
| 36 | Ga0070661_100200273 | 3300005344 | Bacteria | 1525 |
| 37 | Ga0070692_10002606 | 3300005345 | Bacteria | 7035 |
| 38 | Ga0070692_10021627 | 3300005345 | Bacteria | 3131 |
| 39 | Ga0070692_10145540 | 3300005345 | Unclassified | 1345 |
| 40 | Ga0070692_10408477 | 3300005345 | Unclassified | 859 |
| 41 | Ga0070692_10584384 | 3300005345 | Unclassified | 737 |
| 42 | Ga0070668_100000682 | 3300005347 | Bacteria | 23141 |
| 43 | Ga0070668_100015073 | 3300005347 | Bacteria | 5775 |
| 44 | Ga0070669_100001513 | 3300005353 | Bacteria | 16797 |
| 45 | Ga0070669_100015151 | 3300005353 | Bacteria | 5492 |
| 46 | Ga0070675_100016038 | 3300005354 | Bacteria | 5938 |
| 47 | Ga0070675_100073810 | 3300005354 | Bacteria | 2833 |
| 48 | Ga0070671_100006885 | 3300005355 | Bacteria | 9104 |
| 49 | Ga0070671_101096191 | 3300005355 | Bacteria | 699 |
| 50 | Ga0070674_100018912 | 3300005356 | Bacteria | 4365 |
| 51 | Ga0070673_100074393 | 3300005364 | Bacteria | 2738 |
| 52 | Ga0070673_101180577 | 3300005364 | Bacteria | 717 |
| 53 | Ga0070688_100132976 | 3300005365 | Bacteria | 1681 |
| 54 | Ga0070688_100177189 | 3300005365 | Bacteria | 1476 |
| 55 | Ga0070659_100007009 | 3300005366 | Bacteria | 8162 |
| 56 | Ga0070659_100429031 | 3300005366 | Bacteria | 1119 |
| 57 | Ga0070667_100007737 | 3300005367 | Bacteria | 8909 |
| 58 | Ga0070667_100260245 | 3300005367 | Bacteria | 1553 |
| 59 | Ga0070667_100584965 | 3300005367 | Bacteria | 1028 |
| 60 | Ga0070703_10014022 | 3300005406 | Bacteria | 2279 |
| 61 | Ga0070709_10110900 | 3300005434 | Bacteria | 1844 |
| 62 | Ga0070714_100085824 | 3300005435 | Bacteria | 2750 |
| 63 | Ga0070710_10026915 | 3300005437 | Bacteria | 3062 |
| 64 | Ga0070701_10000387 | 3300005438 | Bacteria | 14831 |
| 65 | Ga0070711_100452062 | 3300005439 | Bacteria | 1052 |
| 66 | Ga0070711_100589699 | 3300005439 | Bacteria | 926 |
| 67 | Ga0070705_100000472 | 3300005440 | Bacteria | 23179 |
| 68 | Ga0070705_100021219 | 3300005440 | Bacteria | 3452 |
| 69 | Ga0070705_100082742 | 3300005440 | Bacteria | 1976 |
| 70 | Ga0070705_100313315 | 3300005440 | Bacteria | 1130 |
| 71 | Ga0070700_100002641 | 3300005441 | Bacteria | 9172 |
| 72 | Ga0070700_100041008 | 3300005441 | Bacteria | 2836 |
| 73 | Ga0070700_100076914 | 3300005441 | Unclassified | 2145 |
| 74 | Ga0070700_100384540 | 3300005441 | Bacteria | 1051 |
| 75 | Ga0070694_100000249 | 3300005444 | Bacteria | 28513 |
| 76 | Ga0070694_100002755 | 3300005444 | Bacteria | 10423 |
| 77 | Ga0070694_100032351 | 3300005444 | Bacteria | 3435 |
| 78 | Ga0070694_100096109 | 3300005444 | Bacteria | 2088 |
| 79 | Ga0070694_100103234 | 3300005444 | Bacteria | 2020 |
| 80 | Ga0070694_100413170 | 3300005444 | Bacteria | 1059 |
| 81 | Ga0070694_100576624 | 3300005444 | Bacteria | 903 |
| 82 | Ga0070708_100071153 | 3300005445 | Bacteria | 3131 |
| 83 | Ga0070708_100874873 | 3300005445 | Bacteria | 844 |
| 84 | Ga0070663_100043422 | 3300005455 | Bacteria | 3164 |
| 85 | Ga0070678_100016206 | 3300005456 | Bacteria | 4760 |
| 86 | Ga0070662_100034124 | 3300005457 | Bacteria | 3586 |
| 87 | Ga0070662_100150582 | 3300005457 | Bacteria | 1811 |
| 88 | Ga0070662_100282450 | 3300005457 | Unclassified | 1344 |
| 89 | Ga0070662_100333996 | 3300005457 | Bacteria | 1239 |
| 90 | Ga0070681_10492617 | 3300005458 | Bacteria | 1139 |
| 91 | Ga0068867_100000430 | 3300005459 | Bacteria | 28048 |
| 92 | Ga0068867_100002651 | 3300005459 | Bacteria | 12626 |
| 93 | Ga0070706_100163026 | 3300005467 | Bacteria | 2082 |
| 94 | Ga0070698_100829766 | 3300005471 | Unclassified | 869 |
| 95 | Ga0070699_100093706 | 3300005518 | Bacteria | 2628 |
| 96 | Ga0070679_100089258 | 3300005530 | Bacteria | 3070 |
| 97 | Ga0070679_100332692 | 3300005530 | Bacteria | 1467 |
| 98 | Ga0070684_100026670 | 3300005535 | Bacteria | 4869 |
| 99 | Ga0070697_100001293 | 3300005536 | Bacteria | 18848 |
| 100 | Ga0070697_100997659 | 3300005536 | Bacteria | 744 |
| 101 | Ga0068853_100270386 | 3300005539 | Unclassified | 1565 |
| 102 | Ga0068853_100297181 | 3300005539 | Bacteria | 1492 |
| 103 | Ga0070672_100001295 | 3300005543 | Bacteria | 15400 |
| 104 | Ga0070672_100063248 | 3300005543 | Bacteria | 2922 |
| 105 | Ga0070672_100184813 | 3300005543 | Bacteria | 1738 |
| 106 | Ga0070672_100430916 | 3300005543 | Unclassified | 1134 |
| 107 | Ga0070686_100000392 | 3300005544 | Bacteria | 27736 |
| 108 | Ga0070686_100034552 | 3300005544 | Bacteria | 3116 |
| 109 | Ga0070686_100596758 | 3300005544 | Unclassified | 870 |
| 110 | Ga0070695_100000185 | 3300005545 | Bacteria | 29879 |
| 111 | Ga0070695_100495729 | 3300005545 | Bacteria | 944 |
| 112 | Ga0070696_100000519 | 3300005546 | Bacteria | 24408 |
| 113 | Ga0070696_100002012 | 3300005546 | Bacteria | 13331 |
| 114 | Ga0070696_100018323 | 3300005546 | Bacteria | 4731 |
| 115 | Ga0070696_100104966 | 3300005546 | Bacteria | 2029 |
| 116 | Ga0070696_100444546 | 3300005546 | Bacteria | 1022 |
| 117 | Ga0070696_100646344 | 3300005546 | Bacteria | 857 |
| 118 | Ga0070693_100000135 | 3300005547 | Bacteria | 33350 |
| 119 | Ga0070693_100257096 | 3300005547 | Bacteria | 1160 |
| 120 | Ga0070693_100326404 | 3300005547 | Unclassified | 1043 |
| 121 | Ga0070704_100000108 | 3300005549 | Bacteria | 28920 |
| 122 | Ga0070704_100083896 | 3300005549 | Bacteria | 2353 |
| 123 | Ga0070704_100086465 | 3300005549 | Bacteria | 2324 |
| 124 | Ga0070704_100193204 | 3300005549 | Unclassified | 1638 |
| 125 | Ga0070704_100481566 | 3300005549 | Bacteria | 1074 |
| 126 | Ga0068855_100002231 | 3300005563 | Bacteria | 23944 |
| 127 | Ga0070664_100056977 | 3300005564 | Bacteria | 3321 |
| 128 | Ga0068857_100645306 | 3300005577 | Bacteria | 1003 |
| 129 | Ga0068857_100737021 | 3300005577 | Bacteria | 938 |
| 130 | Ga0068854_100006272 | 3300005578 | Bacteria | 7557 |
| 131 | Ga0068856_100013516 | 3300005614 | Bacteria | 7903 |
| 132 | Ga0068856_100086145 | 3300005614 | Bacteria | 3121 |
| 133 | Ga0068856_100109958 | 3300005614 | Bacteria | 2753 |
| 134 | Ga0068856_100158041 | 3300005614 | Bacteria | 2277 |
| 135 | Ga0070702_100000557 | 3300005615 | Bacteria | 13590 |
| 136 | Ga0070702_100076821 | 3300005615 | Unclassified | 1989 |
| 137 | Ga0068852_100018182 | 3300005616 | Bacteria | 5534 |
| 138 | Ga0068852_100277055 | 3300005616 | Bacteria | 1616 |
| 139 | Ga0068852_100738304 | 3300005616 | Bacteria | 996 |
| 140 | Ga0068859_100001399 | 3300005617 | Bacteria | 24477 |
| 141 | Ga0068859_100090027 | 3300005617 | Bacteria | 3119 |
| 142 | Ga0068859_100112847 | 3300005617 | Bacteria | 2781 |
| 143 | Ga0068864_100039636 | 3300005618 | Bacteria | 4026 |
| 144 | Ga0068864_100272380 | 3300005618 | Bacteria | 1578 |
| 145 | Ga0068864_100452285 | 3300005618 | Bacteria | 1228 |
| 146 | Ga0068866_10001478 | 3300005718 | Bacteria | 10015 |
| 147 | Ga0068866_10002633 | 3300005718 | Bacteria | 7421 |
| 148 | Ga0068861_100001038 | 3300005719 | Bacteria | 17033 |
| 149 | Ga0068861_100001358 | 3300005719 | Bacteria | 15388 |
| 150 | Ga0068861_100010298 | 3300005719 | Bacteria | 6488 |
| 151 | Ga0068861_100074216 | 3300005719 | Bacteria | 2644 |
| 152 | Ga0068861_100752008 | 3300005719 | Bacteria | 911 |
| 153 | Ga0068851_10014733 | 3300005834 | Bacteria | 3716 |
| 154 | Ga0068870_10149137 | 3300005840 | Bacteria | 1376 |
| 155 | Ga0068863_100001611 | 3300005841 | Bacteria | 22315 |
| 156 | Ga0068863_100125147 | 3300005841 | Bacteria | 2452 |
| 157 | Ga0068863_100138342 | 3300005841 | Bacteria | 2327 |
| 158 | Ga0068863_100910362 | 3300005841 | Bacteria | 880 |
| 159 | Ga0068858_100003840 | 3300005842 | Bacteria | 14854 |
| 160 | Ga0068858_100593837 | 3300005842 | Bacteria | 1074 |
| 161 | Ga0068860_100001826 | 3300005843 | Bacteria | 22678 |
| 162 | Ga0068860_100002413 | 3300005843 | Bacteria | 19606 |
| 163 | Ga0068860_100030311 | 3300005843 | Bacteria | 5203 |
| 164 | Ga0068862_100001204 | 3300005844 | Bacteria | 24408 |
| 165 | Ga0068862_100003042 | 3300005844 | Bacteria | 14608 |
| 166 | Ga0068862_100017851 | 3300005844 | Bacteria | 5907 |
| 167 | Ga0068862_100070394 | 3300005844 | Bacteria | 3020 |
| 168 | Ga0068862_100093124 | 3300005844 | Bacteria | 2627 |
| 169 | Ga0068862_100141810 | 3300005844 | Unclassified | 2133 |
| 170 | Ga0068862_100273829 | 3300005844 | Bacteria | 1545 |
| 171 | Ga0081539_10000462 | 3300005985 | Bacteria | 86060 |
| 172 | Ga0070716_100290864 | 3300006173 | Bacteria | 1132 |
| 173 | Ga0097621_100001049 | 3300006237 | Bacteria | 19393 |
| 174 | Ga0097621_100004130 | 3300006237 | Bacteria | 10069 |
| 175 | Ga0097621_100282111 | 3300006237 | Unclassified | 1462 |
| 176 | Ga0097621_100388660 | 3300006237 | Bacteria | 1247 |
| 177 | Ga0068871_100000370 | 3300006358 | Bacteria | 31403 |
| 178 | Ga0068871_100004173 | 3300006358 | Bacteria | 10001 |
| 179 | Ga0068871_100561979 | 3300006358 | Archaea | 1034 |
| 180 | Ga0075428_100000993 | 3300006844 | Bacteria | 30002 |
| 181 | Ga0075428_100066543 | 3300006844 | Bacteria | 3945 |
| 182 | Ga0075428_100243377 | 3300006844 | Bacteria | 1940 |
| 183 | Ga0075428_100503100 | 3300006844 | Bacteria | 1296 |
| 184 | Ga0075430_100002561 | 3300006846 | Bacteria | 15154 |
| 185 | Ga0075430_100563165 | 3300006846 | Bacteria | 940 |
| 186 | Ga0075430_100809367 | 3300006846 | Unclassified | 772 |
| 187 | Ga0075431_100267579 | 3300006847 | Bacteria | 1733 |
| 188 | Ga0075433_10007872 | 3300006852 | Bacteria | 8476 |
| 189 | Ga0075433_10061416 | 3300006852 | Bacteria | 3292 |
| 190 | Ga0075433_10146936 | 3300006852 | Bacteria | 2096 |
| 191 | Ga0075433_10292049 | 3300006852 | Bacteria | 1444 |
| 192 | Ga0075434_100003359 | 3300006871 | Bacteria | 14318 |
| 193 | Ga0075434_100030678 | 3300006871 | Bacteria | 5295 |
| 194 | Ga0075434_100211253 | 3300006871 | Bacteria | 1961 |
| 195 | Ga0075434_100830456 | 3300006871 | Bacteria | 940 |
| 196 | Ga0075434_101068199 | 3300006871 | Bacteria | 821 |
| 197 | Ga0075429_100000003 | 3300006880 | Bacteria | 130377 |
| 198 | Ga0075429_100002816 | 3300006880 | Bacteria | 14713 |
| 199 | Ga0075429_100029199 | 3300006880 | Bacteria | 4789 |
| 200 | Ga0075429_100177510 | 3300006880 | Bacteria | 1866 |
| 201 | Ga0075429_100562320 | 3300006880 | Bacteria | 999 |
| 202 | Ga0068865_100000283 | 3300006881 | Bacteria | 27881 |
| 203 | Ga0068865_100000599 | 3300006881 | Bacteria | 20236 |
| 204 | Ga0068865_100521630 | 3300006881 | Bacteria | 994 |
| 205 | Ga0075436_100001687 | 3300006914 | Bacteria | 15098 |
| 206 | Ga0075436_100026392 | 3300006914 | Bacteria | 4000 |
| 207 | Ga0075436_100116709 | 3300006914 | Unclassified | 1865 |
| 208 | Ga0097620_100001399 | 3300006931 | Bacteria | 24477 |
| 209 | Ga0097620_100090025 | 3300006931 | Bacteria | 3119 |
| 210 | Ga0097620_100112848 | 3300006931 | Bacteria | 2781 |
| 211 | Ga0075435_100001908 | 3300007076 | Bacteria | 13571 |
| 212 | Ga0075435_100045483 | 3300007076 | Bacteria | 3519 |
| 213 | Ga0075435_100281364 | 3300007076 | Bacteria | 1420 |
| 214 | Ga0075435_100418794 | 3300007076 | Bacteria | 1153 |
| 215 | Ga0075435_100645168 | 3300007076 | Bacteria | 919 |
| 216 | Ga0099794_10009654 | 3300007265 | Bacteria | 4070 |
| 217 | Ga0105250_10019097 | 3300009092 | Bacteria | 2771 |
| 218 | Ga0105240_11287381 | 3300009093 | Bacteria | 771 |
| 219 | Ga0111539_10023346 | 3300009094 | Bacteria | 7599 |
| 220 | Ga0111539_10027656 | 3300009094 | Bacteria | 6928 |
| 221 | Ga0111539_10065980 | 3300009094 | Bacteria | 4275 |
| 222 | Ga0111539_10125633 | 3300009094 | Bacteria | 3006 |
| 223 | Ga0111539_10131849 | 3300009094 | Bacteria | 2926 |
| 224 | Ga0111539_10203580 | 3300009094 | Bacteria | 2308 |
| 225 | Ga0111539_10304718 | 3300009094 | Bacteria | 1854 |
| 226 | Ga0111539_11679898 | 3300009094 | Unclassified | 736 |
| 227 | Ga0105245_10001066 | 3300009098 | Bacteria | 24858 |
| 228 | Ga0105245_10012082 | 3300009098 | Bacteria | 7509 |
| 229 | Ga0114129_10001138 | 3300009147 | Bacteria | 35164 |
| 230 | Ga0114129_10005359 | 3300009147 | Bacteria | 18104 |
| 231 | Ga0114129_10318058 | 3300009147 | Bacteria | 2070 |
| 232 | Ga0114129_10651601 | 3300009147 | Bacteria | 1359 |
| 233 | Ga0105243_10000708 | 3300009148 | Bacteria | 32162 |
| 234 | Ga0105243_10002376 | 3300009148 | Bacteria | 15759 |
| 235 | Ga0105243_10011238 | 3300009148 | Bacteria | 6773 |
| 236 | Ga0105243_10067067 | 3300009148 | Bacteria | 2888 |
| 237 | Ga0105241_10010132 | 3300009174 | Bacteria | 6919 |
| 238 | Ga0105241_10015810 | 3300009174 | Bacteria | 5529 |
| 239 | Ga0105242_10001614 | 3300009176 | Bacteria | 17755 |
| 240 | Ga0105242_10003692 | 3300009176 | Bacteria | 11916 |
| 241 | Ga0105242_10150666 | 3300009176 | Bacteria | 2028 |
| 242 | Ga0105248_10002161 | 3300009177 | Bacteria | 21753 |
| 243 | Ga0105248_10005188 | 3300009177 | Bacteria | 14360 |
| 244 | Ga0105248_10202109 | 3300009177 | Bacteria | 2239 |
| 245 | Ga0105248_10316364 | 3300009177 | Bacteria | 1758 |
| 246 | Ga0105238_10815244 | 3300009551 | Unclassified | 949 |
| 247 | Ga0105249_10000996 | 3300009553 | Bacteria | 25124 |
| 248 | Ga0105249_10005638 | 3300009553 | Bacteria | 10832 |
| 249 | Ga0105249_10092104 | 3300009553 | Bacteria | 2837 |
| 250 | Ga0105249_10105216 | 3300009553 | Bacteria | 2660 |
| 251 | Ga0157371_10298535 | 3300013102 | Bacteria | 1166 |
| 252 | Ga0157370_10125797 | 3300013104 | Bacteria | 2392 |
| 253 | Ga0157374_10303333 | 3300013296 | Unclassified | 1580 |
| 254 | Ga0157378_10001153 | 3300013297 | Bacteria | 24026 |
| 255 | Ga0157378_10123484 | 3300013297 | Bacteria | 2389 |
| 256 | Ga0163162_10005059 | 3300013306 | Bacteria | 12702 |
| 257 | Ga0163162_10107920 | 3300013306 | Bacteria | 2880 |
| 258 | Ga0163162_10117859 | 3300013306 | Bacteria | 2757 |
| 259 | Ga0163162_11572580 | 3300013306 | Unclassified | 750 |
| 260 | Ga0157372_10959801 | 3300013307 | Bacteria | 991 |
| 261 | Ga0157375_10000906 | 3300013308 | Bacteria | 25775 |
| 262 | Ga0157375_10119505 | 3300013308 | Bacteria | 2743 |
| 263 | Ga0157375_11304148 | 3300013308 | Bacteria | 854 |
| 264 | Ga0157380_10002623 | 3300014326 | Bacteria | 12166 |
| 265 | Ga0157380_10023634 | 3300014326 | Bacteria | 4639 |
| 266 | Ga0157380_10049523 | 3300014326 | Bacteria | 3314 |
| 267 | Ga0157380_10172289 | 3300014326 | Bacteria | 1892 |
| 268 | Ga0157379_10028553 | 3300014968 | Bacteria | 4961 |
| 269 | Ga0157379_10198166 | 3300014968 | Bacteria | 1815 |
| 270 | Ga0157376_10069460 | 3300014969 | Bacteria | 2987 |
| 271 | Ga0157376_10165442 | 3300014969 | Bacteria | 2009 |
| 272 | Ga0163161_10000551 | 3300017792 | Bacteria | 30373 |
| 273 | Ga0163161_10175190 | 3300017792 | Unclassified | 1642 |
| 274 | Ga0206353_10563905 | 3300020082 | Bacteria | 1224 |
| 275 | Ga0207697_10004623 | 3300025315 | Bacteria | 6542 |
| 276 | Ga0207656_10005122 | 3300025321 | Bacteria | 4610 |
| 277 | Ga0207653_10022602 | 3300025885 | Bacteria | 1999 |
| 278 | Ga0207653_10142339 | 3300025885 | Bacteria | 878 |
| 279 | Ga0207682_10030051 | 3300025893 | Unclassified | 2175 |
| 280 | Ga0207642_10000750 | 3300025899 | Bacteria | 10038 |
| 281 | Ga0207642_10022003 | 3300025899 | Bacteria | 2520 |
| 282 | Ga0207680_10002557 | 3300025903 | Bacteria | 8482 |
| 283 | Ga0207680_10080910 | 3300025903 | Bacteria | 2041 |
| 284 | Ga0207645_10000390 | 3300025907 | Bacteria | 36191 |
| 285 | Ga0207645_10011013 | 3300025907 | Bacteria | 6189 |
| 286 | Ga0207645_10153332 | 3300025907 | Bacteria | 1505 |
| 287 | Ga0207684_10038808 | 3300025910 | Bacteria | 4041 |
| 288 | Ga0207654_10023548 | 3300025911 | Bacteria | 3300 |
| 289 | Ga0207707_10021374 | 3300025912 | Bacteria | 5657 |
| 290 | Ga0207707_10116193 | 3300025912 | Bacteria | 2338 |
| 291 | Ga0207707_10149245 | 3300025912 | Bacteria | 2044 |
| 292 | Ga0207707_10394523 | 3300025912 | Bacteria | 1189 |
| 293 | Ga0207671_10063237 | 3300025914 | Bacteria | 2750 |
| 294 | Ga0207660_10010154 | 3300025917 | Bacteria | 6100 |
| 295 | Ga0207660_10117480 | 3300025917 | Bacteria | 2010 |
| 296 | Ga0207660_10149366 | 3300025917 | Bacteria | 1794 |
| 297 | Ga0207660_10237780 | 3300025917 | Bacteria | 1434 |
| 298 | Ga0207660_10438416 | 3300025917 | Bacteria | 1055 |
| 299 | Ga0207662_10000191 | 3300025918 | Bacteria | 28718 |
| 300 | Ga0207662_10001816 | 3300025918 | Bacteria | 10480 |
| 301 | Ga0207662_10234386 | 3300025918 | Bacteria | 1200 |
| 302 | Ga0207662_10433685 | 3300025918 | Bacteria | 896 |
| 303 | Ga0207657_10009108 | 3300025919 | Bacteria | 10013 |
| 304 | Ga0207649_10011618 | 3300025920 | Bacteria | 4862 |
| 305 | Ga0207652_10108716 | 3300025921 | Bacteria | 2457 |
| 306 | Ga0207652_10174442 | 3300025921 | Bacteria | 1930 |
| 307 | Ga0207652_10272847 | 3300025921 | Bacteria | 1525 |
| 308 | Ga0207652_10804993 | 3300025921 | Bacteria | 834 |
| 309 | Ga0207646_10199130 | 3300025922 | Bacteria | 1809 |
| 310 | Ga0207646_10805360 | 3300025922 | Bacteria | 836 |
| 311 | Ga0207681_10010837 | 3300025923 | Bacteria | 5600 |
| 312 | Ga0207681_10016603 | 3300025923 | Bacteria | 4608 |
| 313 | Ga0207681_10128293 | 3300025923 | Bacteria | 1871 |
| 314 | Ga0207681_10424901 | 3300025923 | Bacteria | 1077 |
| 315 | Ga0207659_10019827 | 3300025926 | Bacteria | 4434 |
| 316 | Ga0207659_10026847 | 3300025926 | Bacteria | 3891 |
| 317 | Ga0207687_10001813 | 3300025927 | Bacteria | 14697 |
| 318 | Ga0207664_10029789 | 3300025929 | Bacteria | 4161 |
| 319 | Ga0207644_10004980 | 3300025931 | Bacteria | 8666 |
| 320 | Ga0207706_10002980 | 3300025933 | Bacteria | 16337 |
| 321 | Ga0207706_10067822 | 3300025933 | Bacteria | 3140 |
| 322 | Ga0207706_10122008 | 3300025933 | Bacteria | 2292 |
| 323 | Ga0207706_10214488 | 3300025933 | Bacteria | 1686 |
| 324 | Ga0207706_10572404 | 3300025933 | Bacteria | 971 |
| 325 | Ga0207686_10001418 | 3300025934 | Bacteria | 13594 |
| 326 | Ga0207686_10022309 | 3300025934 | Bacteria | 3645 |
| 327 | Ga0207709_10001098 | 3300025935 | Bacteria | 19845 |
| 328 | Ga0207709_10021268 | 3300025935 | Bacteria | 3671 |
| 329 | Ga0207709_10073500 | 3300025935 | Bacteria | 2179 |
| 330 | Ga0207709_10228264 | 3300025935 | Bacteria | 1347 |
| 331 | Ga0207670_10243838 | 3300025936 | Bacteria | 1385 |
| 332 | Ga0207670_10533694 | 3300025936 | Unclassified | 957 |
| 333 | Ga0207670_10908467 | 3300025936 | Unclassified | 738 |
| 334 | Ga0207669_10027920 | 3300025937 | Bacteria | 3097 |
| 335 | Ga0207669_10392891 | 3300025937 | Unclassified | 1084 |
| 336 | Ga0207704_10000409 | 3300025938 | Bacteria | 19434 |
| 337 | Ga0207704_10003731 | 3300025938 | Bacteria | 6935 |
| 338 | Ga0207704_10015773 | 3300025938 | Bacteria | 3861 |
| 339 | Ga0207665_10530664 | 3300025939 | Bacteria | 912 |
| 340 | Ga0207691_10001079 | 3300025940 | Bacteria | 27155 |
| 341 | Ga0207691_10016817 | 3300025940 | Bacteria | 6943 |
| 342 | Ga0207691_10095012 | 3300025940 | Bacteria | 2667 |
| 343 | Ga0207691_10148924 | 3300025940 | Bacteria | 2059 |
| 344 | Ga0207711_10007838 | 3300025941 | Bacteria | 8926 |
| 345 | Ga0207711_10026903 | 3300025941 | Bacteria | 4828 |
| 346 | Ga0207711_10063905 | 3300025941 | Bacteria | 3178 |
| 347 | Ga0207689_10000921 | 3300025942 | Bacteria | 28235 |
| 348 | Ga0207689_10036897 | 3300025942 | Bacteria | 4056 |
| 349 | Ga0207661_10112997 | 3300025944 | Bacteria | 2300 |
| 350 | Ga0207679_10148749 | 3300025945 | Bacteria | 1903 |
| 351 | Ga0207667_10017372 | 3300025949 | Bacteria | 8098 |
| 352 | Ga0207667_10018772 | 3300025949 | Bacteria | 7743 |
| 353 | Ga0207667_10347196 | 3300025949 | Bacteria | 1513 |
| 354 | Ga0207651_10109064 | 3300025960 | Bacteria | 2073 |
| 355 | Ga0207651_10221178 | 3300025960 | Unclassified | 1531 |
| 356 | Ga0207651_10226974 | 3300025960 | Unclassified | 1513 |
| 357 | Ga0207712_10007728 | 3300025961 | Bacteria | 6798 |
| 358 | Ga0207712_10117711 | 3300025961 | Bacteria | 2004 |
| 359 | Ga0207712_10258394 | 3300025961 | Bacteria | 1411 |
| 360 | Ga0207712_10608927 | 3300025961 | Unclassified | 946 |
| 361 | Ga0207668_10002352 | 3300025972 | Bacteria | 11046 |
| 362 | Ga0207668_10017408 | 3300025972 | Bacteria | 4503 |
| 363 | Ga0207668_10157848 | 3300025972 | Bacteria | 1764 |
| 364 | Ga0207668_10658016 | 3300025972 | Bacteria | 917 |
| 365 | Ga0207640_10001592 | 3300025981 | Bacteria | 12198 |
| 366 | Ga0207640_10074462 | 3300025981 | Bacteria | 2298 |
| 367 | Ga0207640_10956978 | 3300025981 | Bacteria | 751 |
| 368 | Ga0207658_10019716 | 3300025986 | Bacteria | 4664 |
| 369 | Ga0207658_10347392 | 3300025986 | Bacteria | 1291 |
| 370 | Ga0207677_10000592 | 3300026023 | Bacteria | 22464 |
| 371 | Ga0207677_10056605 | 3300026023 | Bacteria | 2687 |
| 372 | Ga0207703_10000937 | 3300026035 | Bacteria | 28276 |
| 373 | Ga0207703_10007345 | 3300026035 | Bacteria | 8758 |
| 374 | Ga0207703_10704467 | 3300026035 | Bacteria | 960 |
| 375 | Ga0207639_10098519 | 3300026041 | Bacteria | 2357 |
| 376 | Ga0207639_10318305 | 3300026041 | Unclassified | 1381 |
| 377 | Ga0207678_10003010 | 3300026067 | Bacteria | 15242 |
| 378 | Ga0207708_10000451 | 3300026075 | Bacteria | 31936 |
| 379 | Ga0207708_10015956 | 3300026075 | Bacteria | 5640 |
| 380 | Ga0207708_10084591 | 3300026075 | Bacteria | 2439 |
| 381 | Ga0207708_10152389 | 3300026075 | Bacteria | 1821 |
| 382 | Ga0207708_10161441 | 3300026075 | Bacteria | 1770 |
| 383 | Ga0207708_10182809 | 3300026075 | Unclassified | 1665 |
| 384 | Ga0207708_10210666 | 3300026075 | Bacteria | 1553 |
| 385 | Ga0207702_10178909 | 3300026078 | Bacteria | 1951 |
| 386 | Ga0207702_10312875 | 3300026078 | Bacteria | 1493 |
| 387 | Ga0207641_10004844 | 3300026088 | Bacteria | 11591 |
| 388 | Ga0207641_10164194 | 3300026088 | Bacteria | 2021 |
| 389 | Ga0207648_10000245 | 3300026089 | Bacteria | 58564 |
| 390 | Ga0207648_10001462 | 3300026089 | Bacteria | 25984 |
| 391 | Ga0207648_10001948 | 3300026089 | Bacteria | 22560 |
| 392 | Ga0207648_10394633 | 3300026089 | Bacteria | 1253 |
| 393 | Ga0207676_10004835 | 3300026095 | Bacteria | 9549 |
| 394 | Ga0207676_10089139 | 3300026095 | Bacteria | 2527 |
| 395 | Ga0207674_10000956 | 3300026116 | Bacteria | 37766 |
| 396 | Ga0207674_10573581 | 3300026116 | Bacteria | 1090 |
| 397 | Ga0207674_10661770 | 3300026116 | Bacteria | 1008 |
| 398 | Ga0207675_100001447 | 3300026118 | Bacteria | 23783 |
| 399 | Ga0207675_100001475 | 3300026118 | Bacteria | 23622 |
| 400 | Ga0207675_100023625 | 3300026118 | Bacteria | 5719 |
| 401 | Ga0207675_100053681 | 3300026118 | Unclassified | 3760 |
| 402 | Ga0207675_100325628 | 3300026118 | Bacteria | 1501 |
| 403 | Ga0207683_10021770 | 3300026121 | Bacteria | 5496 |
| 404 | Ga0207683_10472796 | 3300026121 | Bacteria | 1156 |
| 405 | Ga0207698_10007473 | 3300026142 | Bacteria | 6846 |
| 406 | Ga0207698_10095027 | 3300026142 | Bacteria | 2453 |
| 407 | Ga0207698_10157694 | 3300026142 | Bacteria | 1980 |
| 408 | Ga0209967_1004895 | 3300027364 | Bacteria | 1791 |
| 409 | Ga0210000_1004416 | 3300027462 | Bacteria | 2033 |
| 410 | Ga0210000_1004622 | 3300027462 | Bacteria | 1986 |
| 411 | Ga0209968_1008484 | 3300027526 | Bacteria | 1567 |
| 412 | Ga0209999_1002327 | 3300027543 | Bacteria | 3347 |
| 413 | Ga0209999_1047153 | 3300027543 | Bacteria | 811 |
| 414 | Ga0209974_10032126 | 3300027876 | Bacteria | 1739 |
| 415 | Ga0207428_10004232 | 3300027907 | Bacteria | 13746 |
| 416 | Ga0207428_10022897 | 3300027907 | Bacteria | 5264 |
| 417 | Ga0207428_10035347 | 3300027907 | Bacteria | 4084 |
| 418 | Ga0207428_10210576 | 3300027907 | Bacteria | 1460 |
| 419 | Ga0268265_10000627 | 3300028380 | Bacteria | 35202 |
| 420 | Ga0268265_10004164 | 3300028380 | Bacteria | 10135 |
| 421 | Ga0268265_10053870 | 3300028380 | Bacteria | 3049 |
| 422 | Ga0268265_10105537 | 3300028380 | Bacteria | 2286 |
| 423 | Ga0268265_10397766 | 3300028380 | Bacteria | 1272 |
| 424 | Ga0268265_10404334 | 3300028380 | Bacteria | 1263 |
| 425 | Ga0268265_10932691 | 3300028380 | Bacteria | 854 |
| 426 | Ga0268264_10003335 | 3300028381 | Bacteria | 13874 |
| 427 | Ga0268264_10007307 | 3300028381 | Bacteria | 9238 |
| 428 | Ga0268264_10118738 | 3300028381 | Bacteria | 2328 |
| 429 | Ga0307410_10367056 | 3300031852 | Bacteria | 1155 |
| 430 | Ga0307416_100115903 | 3300032002 | Bacteria | 2374 |
| 431 | Ga0307415_100514897 | 3300032126 | Bacteria | 1049 |
| 432 | Ga0373958_0003458 | 3300034819 | Bacteria | 2278 |
| 433 | Ga0373944_0003060 | 3300035089 | Bacteria | 4298 |
| 434 | Ga0373952_0006344 | 3300035092 | Bacteria | 2182 |
| 435 | Ga0373923_0086627 | 3300035111 | Bacteria | 1365 |
| 436 | Ga0373932_0002139 | 3300035112 | Bacteria | 5133 |
| 437 | Ga0373932_0030359 | 3300035112 | Bacteria | 1497 |
| 438 | Ga0373936_0022250 | 3300035113 | Bacteria | 2468 |
| 439 | Ga0373939_0040560 | 3300035114 | Bacteria | 1399 |
| 440 | Ga0373939_0074281 | 3300035114 | Bacteria | 1115 |
| 441 | Ga0373939_0113772 | 3300035114 | Bacteria | 946 |
| 442 | Ga0373941_0027364 | 3300035115 | Bacteria | 1664 |
| 443 | Ga0373941_0078473 | 3300035115 | Bacteria | 1110 |
| 444 | Ga0373954_0000032 | 3300035118 | Bacteria | 54647 |
| 445 | Ga0373956_0021330 | 3300035119 | Bacteria | 2764 |
| 446 | Ga0373956_0060881 | 3300035119 | Bacteria | 1710 |
| 447 | Ga0373957_0015053 | 3300035120 | Bacteria | 2655 |
| 448 | Ga0373960_0072352 | 3300035121 | Bacteria | 1069 |
| 449 | Ga0373960_0091159 | 3300035121 | Bacteria | 974 |
| 450 | Ga0373943_0015453 | 3300035170 | Bacteria | 3467 |
| 451 | Ga0373946_0004376 | 3300035171 | Bacteria | 5059 |
| 452 | Ga0373955_0058778 | 3300035172 | Bacteria | 2116 |
| 453 | Ga0373955_0082820 | 3300035172 | Bacteria | 1816 |
| 454 | Ga0373961_0108783 | 3300035241 | Bacteria | 906 |
| 455 | Ga0373924_0002130 | 3300035410 | Bacteria | 6621 |
| 456 | Ga0373924_0024984 | 3300035410 | Bacteria | 2359 |
| 457 | Ga0373931_0008988 | 3300035691 | Bacteria | 4763 |
| 458 | Ga0373931_0159154 | 3300035691 | Bacteria | 1322 |
| 459 | Ga0373931_0372671 | 3300035691 | Bacteria | 898 |
| 460 | Ga0373935_0024504 | 3300035692 | Bacteria | 3714 |
| 461 | Ga0373927_0007300 | 3300035695 | Bacteria | 7492 |
| 462 | Ga0373927_0109431 | 3300035695 | Bacteria | 1800 |
| 463 | Ga0373933_0007401 | 3300035724 | Bacteria | 5987 |
| 464 | Ga0373933_0014146 | 3300035724 | Bacteria | 4431 |
| 465 | Ga0373947_0024500 | 3300035725 | Bacteria | 3516 |
| 466 | Ga0373947_0074559 | 3300035725 | Bacteria | 2088 |
| 467 | Ga0373937_0006288 | 3300036401 | Bacteria | 10240 |
| 468 | Ga0373937_0017415 | 3300036401 | Bacteria | 6400 |
| 469 | Ga0373937_0103509 | 3300036401 | Bacteria | 2644 |
| 470 | Ga0373925_0000920 | 3300037068 | Bacteria | 26852 |
| 471 | Ga0373925_0231515 | 3300037068 | Bacteria | 1477 |
| 472 | Ga0373925_0345946 | 3300037068 | Bacteria | 1206 |
| 473 | Ga0395900_0189368 | 3300037418 | Bacteria | 2088 |
| 474 | Ga0395905_0197937 | 3300037471 | Bacteria | 1884 |
| 475 | Ga0395901_0028910 | 3300038443 | Bacteria | 5703 |
| 476 | Ga0451807_1967121 | 3300041486 | Bacteria | 3599 |
| 477 | Ga0439443_002918 | 3300042003 | Bacteria | 2102 |
| 478 | Ga0439456_033300 | 3300042013 | Bacteria | 1108 |
| 479 | Ga0439446_0024779 | 3300042156 | Bacteria | 1713 |
| 480 | Ga0439434_0002357 | 3300042435 | Bacteria | 5495 |
| 481 | Ga0439435_0000277 | 3300042436 | Bacteria | 7580 |
| 482 | Ga0439435_0000676 | 3300042436 | Bacteria | 5657 |
| 483 | Ga0439435_0001802 | 3300042436 | Bacteria | 4086 |
| 484 | Ga0439435_0121908 | 3300042436 | Bacteria | 817 |
| 485 | Ga0439444_0003955 | 3300042437 | Bacteria | 2122 |
| 486 | Ga0439460_0000454 | 3300042461 | Bacteria | 8823 |
| 487 | Ga0451577_0197282 | 3300042876 | Unclassified | 1817 |
| 488 | Ga0453684_0235436 | 3300044712 | Bacteria | 2111 |
| 489 | Ga0451576_0003473 | 3300045051 | Bacteria | 21579 |
| 490 | Ga0451576_0049688 | 3300045051 | Bacteria | 4401 |
| 491 | Ga0451576_0530937 | 3300045051 | Bacteria | 1236 |
| 492 | Ga0451576_0834465 | 3300045051 | Bacteria | 967 |
| 493 | Ga0495592_0014466 | 3300046454 | Bacteria | 5988 |
| 494 | Ga0495603_0000212 | 3300046455 | Bacteria | 30148 |
| 495 | Ga0495641_0063311 | 3300046461 | Bacteria | 1667 |
| 496 | Ga0495651_0158507 | 3300046462 | Bacteria | 1624 |
| 497 | Ga0495580_0000358 | 3300046472 | Bacteria | 37269 |
| 498 | Ga0495639_0015755 | 3300046475 | Bacteria | 3278 |
| 499 | Ga0495662_0070368 | 3300046476 | Bacteria | 1695 |
| 500 | Ga0495664_0150041 | 3300046477 | Bacteria | 1414 |
| 501 | Ga0495594_0123671 | 3300046499 | Bacteria | 1463 |
| 502 | Ga0495608_0007343 | 3300046511 | Bacteria | 7791 |
| 503 | Ga0495618_0010594 | 3300046514 | Bacteria | 5579 |
| 504 | Ga0495628_0111971 | 3300046516 | Bacteria | 2098 |
| 505 | Ga0495628_0470421 | 3300046516 | Bacteria | 911 |
| 506 | Ga0495630_0015067 | 3300046517 | Bacteria | 5640 |
| 507 | Ga0495630_0046809 | 3300046517 | Bacteria | 3234 |
| 508 | Ga0495666_0004532 | 3300046526 | Bacteria | 7020 |
| 509 | Ga0495652_0069125 | 3300046529 | Bacteria | 2957 |
| 510 | Ga0495640_0006892 | 3300046533 | Bacteria | 8950 |
| 511 | Ga0495640_0034541 | 3300046533 | Bacteria | 3584 |
| 512 | Ga0495586_0003782 | 3300046535 | Bacteria | 8110 |
| 513 | Ga0495586_0004396 | 3300046535 | Bacteria | 7525 |
| 514 | Ga0495587_0081319 | 3300046536 | Bacteria | 1877 |
| 515 | Ga0495598_0108243 | 3300046537 | Bacteria | 928 |
| 516 | Ga0495667_0014654 | 3300046559 | Bacteria | 5297 |
| 517 | Ga0495634_0031176 | 3300046642 | Bacteria | 3673 |
| 518 | Ga0495635_0029037 | 3300046663 | Bacteria | 3845 |
| 519 | Ga0495659_0073017 | 3300046664 | Unclassified | 1289 |
| 520 | Ga0495657_0387458 | 3300046675 | Bacteria | 824 |
| 521 | Ga0495599_0060146 | 3300046678 | Bacteria | 2375 |
| 522 | Ga0495647_0000273 | 3300046681 | Bacteria | 14274 |
| 523 | Ga0495647_0210352 | 3300046681 | Bacteria | 855 |
| 524 | Ga0495658_0000620 | 3300046683 | Bacteria | 19327 |
| 525 | Ga0495658_0091324 | 3300046683 | Bacteria | 1803 |
| 526 | Ga0495658_0097342 | 3300046683 | Bacteria | 1751 |
| 527 | Ga0495658_0276181 | 3300046683 | Bacteria | 1060 |
| 528 | Ga0495613_0068075 | 3300046689 | Bacteria | 2597 |
| 529 | Ga0495600_0205199 | 3300046809 | Bacteria | 1264 |
| 530 | Ga0495581_0020108 | 3300047315 | Bacteria | 3876 |
| 531 | Ga0495604_0031472 | 3300047317 | Bacteria | 4207 |
| 532 | Ga0495680_0162865 | 3300047322 | Bacteria | 1618 |
| 533 | Ga0495684_0209859 | 3300047471 | Bacteria | 1433 |
| 534 | Ga0495593_0234686 | 3300047673 | Bacteria | 919 |
| 535 | Ga0495593_0236836 | 3300047673 | Bacteria | 915 |
| 536 | Ga0496101_0319526 | 3300048904 | Bacteria | 1218 |
| 537 | Ga0496102_0057948 | 3300048905 | Bacteria | 3539 |
| 538 | Ga0496106_0211012 | 3300048909 | Bacteria | 1547 |
| 539 | Ga0496110_0837834 | 3300048913 | Bacteria | 825 |
| 540 | Ga0501031_0568009 | 3300049568 | Bacteria | 730 |
| 541 | Ga0501033_0302959 | 3300049570 | Bacteria | 1125 |
| 542 | Ga0501033_0527337 | 3300049570 | Bacteria | 815 |
| 543 | Ga0501036_0373856 | 3300049572 | Bacteria | 1190 |
| 544 | Ga0501037_0169095 | 3300049573 | Bacteria | 1555 |
| 545 | Ga0501038_0078941 | 3300049574 | Bacteria | 2776 |
| 546 | Ga0501038_0210273 | 3300049574 | Bacteria | 1557 |
| 547 | Ga0501039_0025541 | 3300049575 | Bacteria | 4540 |
| 548 | Ga0501040_0112159 | 3300049576 | Bacteria | 1907 |
| 549 | Ga0501040_0203387 | 3300049576 | Bacteria | 1406 |
| 550 | Ga0501040_0460507 | 3300049576 | Bacteria | 916 |
| 551 | Ga0501041_0078132 | 3300049577 | Bacteria | 2036 |
| 552 | Ga0501041_0118273 | 3300049577 | Bacteria | 1646 |
| 553 | Ga0501041_0449162 | 3300049577 | Bacteria | 818 |
| 554 | Ga0501042_0021872 | 3300049578 | Bacteria | 4463 |
| 555 | Ga0501042_0126504 | 3300049578 | Bacteria | 1840 |
| 556 | Ga0501046_0040314 | 3300049580 | Bacteria | 3733 |
| 557 | Ga0501046_0264577 | 3300049580 | Bacteria | 1263 |
| 558 | Ga0501046_0331182 | 3300049580 | Bacteria | 1108 |
| 559 | Ga0501046_0839855 | 3300049580 | Bacteria | 642 |
| 560 | Ga0501048_0085162 | 3300049582 | Bacteria | 2229 |
| 561 | Ga0501067_0468490 | 3300049583 | Bacteria | 704 |
| 562 | Ga0501067_0506835 | 3300049583 | Bacteria | 675 |
| 563 | Ga0501068_0237690 | 3300049584 | Bacteria | 1159 |
| 564 | Ga0501069_0061323 | 3300049585 | Bacteria | 2100 |
| 565 | Ga0501071_0557572 | 3300049587 | Bacteria | 880 |
| 566 | Ga0501072_0005763 | 3300049588 | Bacteria | 9432 |
| 567 | Ga0501072_0047052 | 3300049588 | Bacteria | 3397 |
| 568 | Ga0501072_0060729 | 3300049588 | Bacteria | 2980 |
| 569 | Ga0501072_0123105 | 3300049588 | Bacteria | 2066 |
| 570 | Ga0501072_0767351 | 3300049588 | Bacteria | 756 |
| 571 | Ga0501075_0003753 | 3300049591 | Bacteria | 10205 |
| 572 | Ga0501075_0008430 | 3300049591 | Bacteria | 7191 |
| 573 | Ga0501076_0001091 | 3300049592 | Bacteria | 17844 |
| 574 | Ga0501076_0034277 | 3300049592 | Bacteria | 3967 |
| 575 | Ga0501077_0073045 | 3300049593 | Bacteria | 2173 |
| 576 | Ga0501079_0011674 | 3300049741 | Bacteria | 6711 |
| 577 | Ga0501079_0093779 | 3300049741 | Bacteria | 2326 |
| 578 | Ga0501080_0070566 | 3300049742 | Bacteria | 3249 |
| 579 | Ga0501081_0006843 | 3300049743 | Bacteria | 7414 |
| 580 | Ga0501081_0149592 | 3300049743 | Bacteria | 1677 |
| 581 | Ga0501081_0295520 | 3300049743 | Unclassified | 1188 |
| 582 | Ga0501278_020757 | 3300049774 | Bacteria | 605 |
| 583 | Ga0501283_034324 | 3300049779 | Bacteria | 861 |
| 584 | Ga0501045_0007341 | 3300049824 | Bacteria | 7664 |
| 585 | Ga0501045_0139426 | 3300049824 | Bacteria | 1803 |
| 586 | Ga0501045_0574747 | 3300049824 | Bacteria | 835 |
| 587 | nmdc:mga05p37_5151_c1 | 3300050507 | Bacteria | 15316 |
| 588 | nmdc:mga05p37_77_c1 | 3300050507 | Bacteria | 86224 |
| 589 | nmdc:mga09592_1000729_c1 | 3300050508 | Unclassified | 699 |
| 590 | nmdc:mga09592_111078_c1 | 3300050508 | Bacteria | 2352 |
| 591 | nmdc:mga09592_140_c1 | 3300050508 | Bacteria | 48059 |
| 592 | nmdc:mga09592_150391_c1 | 3300050508 | Bacteria | 2008 |
| 593 | nmdc:mga09592_5031_c1 | 3300050508 | Bacteria | 10722 |
| 594 | nmdc:mga09592_66735_c1 | 3300050508 | Bacteria | 3050 |
| 595 | nmdc:mga0qj67_188814_c1 | 3300050509 | Bacteria | 1675 |
| 596 | nmdc:mga0qj67_309704_c1 | 3300050509 | Bacteria | 1279 |
| 597 | nmdc:mga0qj67_416279_c1 | 3300050509 | Bacteria | 1084 |
| 598 | nmdc:mga0qj67_779747_c1 | 3300050509 | Unclassified | 757 |
| 599 | nmdc:mga06r32_106764_c1 | 3300050510 | Bacteria | 2751 |
| 600 | nmdc:mga06r32_190120_c1 | 3300050510 | Bacteria | 2041 |
| 601 | nmdc:mga06r32_232898_c1 | 3300050510 | Bacteria | 1830 |
| 602 | nmdc:mga06r32_61973_c1 | 3300050510 | Bacteria | 3602 |
| 603 | nmdc:mga08y16_18790_c1 | 3300050511 | Bacteria | 7282 |
| 604 | nmdc:mga08y16_33511_c1 | 3300050511 | Bacteria | 5394 |
| 605 | nmdc:mga08y16_427085_c1 | 3300050511 | Unclassified | 1354 |
| 606 | nmdc:mga08y16_56264_c1 | 3300050511 | Bacteria | 4112 |
| 607 | nmdc:mga08y16_69948_c1 | 3300050511 | Bacteria | 3659 |
| 608 | nmdc:mga08y16_94304_c1 | 3300050511 | Bacteria | 3118 |
| 609 | nmdc:mga0n895_125607_c1 | 3300050512 | Bacteria | 2589 |
| 610 | nmdc:mga0n895_201043_c1 | 3300050512 | Bacteria | 2023 |
| 611 | nmdc:mga0n895_48283_c1 | 3300050512 | Unclassified | 4166 |
| 612 | nmdc:mga0n895_553083_c1 | 3300050512 | Bacteria | 1156 |
| 613 | nmdc:mga0n895_78559_c1 | 3300050512 | Bacteria | 3285 |
| 614 | nmdc:mga0n895_792501_c1 | 3300050512 | Bacteria | 938 |
| 615 | nmdc:mga0rr50_113866_c1 | 3300050513 | Bacteria | 2144 |
| 616 | nmdc:mga0rr50_381_c1 | 3300050513 | Bacteria | 24264 |
| 617 | nmdc:mga0rr50_736127_c1 | 3300050513 | Bacteria | 842 |
| 618 | nmdc:mga08x19_21885_c1 | 3300050514 | Bacteria | 3952 |
| 619 | nmdc:mga08x19_2762_c1 | 3300050514 | Bacteria | 10593 |
| 620 | nmdc:mga08x19_37850_c1 | 3300050514 | Bacteria | 3063 |
| 621 | nmdc:mga08x19_381577_c1 | 3300050514 | Bacteria | 987 |
| 622 | nmdc:mga08x19_4927_c2 | 3300050514 | Bacteria | 5296 |
| 623 | nmdc:mga0a205_83595_c1 | 3300050515 | Unclassified | 3083 |
| 624 | nmdc:mga0a205_93_c2 | 3300050515 | Bacteria | 37118 |
| 625 | Ga0495601_0047730 | 3300053077 | Bacteria | 2696 |
| 626 | Ga0495619_0308469 | 3300053085 | Bacteria | 1096 |
| 627 | Ga0501084_0745201 | 3300054114 | Bacteria | 825 |
| 628 | Ga0590071_014584 | 3300059421 | Bacteria | 1844 |
| 629 | Ga0501082_0003995 | 3300060353 | Bacteria | 12872 |
| 630 | Ga0530510_0002851 | 3300061734 | Bacteria | 11883 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044712 | Ga0453684_0235436 | Ga0453684_0235436_71_574 | 164 |
| 2 | 3300031852 | Ga0307410_10367056 | Ga0307410_103670561 | 177 |
| 3 | 3300049774 | Ga0501278_020757 | Ga0501278_020757_50_592 | 178 |
| 4 | 3300005364 | Ga0070673_101180577 | Ga0070673_1011805771 | 181 |
| 5 | 3300005327 | Ga0070658_10106268 | Ga0070658_101062682 | 185 |
| 6 | 3300005329 | Ga0070683_100072418 | Ga0070683_1000724183 | 185 |
| 7 | 3300005335 | Ga0070666_10025570 | Ga0070666_100255702 | 185 |
| 8 | 3300005344 | Ga0070661_100200273 | Ga0070661_1002002732 | 185 |
| 9 | 3300005355 | Ga0070671_100006885 | Ga0070671_1000068855 | 185 |
| 10 | 3300005366 | Ga0070659_100007009 | Ga0070659_1000070093 | 185 |
| 11 | 3300005366 | Ga0070659_100429031 | Ga0070659_1004290311 | 185 |
| 12 | 3300005367 | Ga0070667_100584965 | Ga0070667_1005849652 | 185 |
| 13 | 3300005434 | Ga0070709_10110900 | Ga0070709_101109002 | 185 |
| 14 | 3300005435 | Ga0070714_100085824 | Ga0070714_1000858242 | 185 |
| 15 | 3300005457 | Ga0070662_100150582 | Ga0070662_1001505821 | 185 |
| 16 | 3300005530 | Ga0070679_100332692 | Ga0070679_1003326922 | 185 |
| 17 | 3300005535 | Ga0070684_100026670 | Ga0070684_1000266703 | 185 |
| 18 | 3300005543 | Ga0070672_100184813 | Ga0070672_1001848132 | 185 |
| 19 | 3300005564 | Ga0070664_100056977 | Ga0070664_1000569773 | 185 |
| 20 | 3300005578 | Ga0068854_100006272 | Ga0068854_1000062724 | 185 |
| 21 | 3300005614 | Ga0068856_100086145 | Ga0068856_1000861452 | 185 |
| 22 | 3300005616 | Ga0068852_100277055 | Ga0068852_1002770552 | 185 |
| 23 | 3300005719 | Ga0068861_100752008 | Ga0068861_1007520082 | 185 |
| 24 | 3300005834 | Ga0068851_10014733 | Ga0068851_100147333 | 185 |
| 25 | 3300005841 | Ga0068863_100125147 | Ga0068863_1001251474 | 185 |
| 26 | 3300005844 | Ga0068862_100273829 | Ga0068862_1002738292 | 185 |
| 27 | 3300006237 | Ga0097621_100388660 | Ga0097621_1003886602 | 185 |
| 28 | 3300009093 | Ga0105240_11287381 | Ga0105240_112873811 | 185 |
| 29 | 3300009174 | Ga0105241_10010132 | Ga0105241_100101325 | 185 |
| 30 | 3300009177 | Ga0105248_10002161 | Ga0105248_100021613 | 185 |
| 31 | 3300013104 | Ga0157370_10125797 | Ga0157370_101257971 | 185 |
| 32 | 3300013307 | Ga0157372_10959801 | Ga0157372_109598012 | 185 |
| 33 | 3300013308 | Ga0157375_11304148 | Ga0157375_113041482 | 185 |
| 34 | 3300020082 | Ga0206353_10563905 | Ga0206353_105639051 | 185 |
| 35 | 3300025321 | Ga0207656_10005122 | Ga0207656_100051224 | 185 |
| 36 | 3300025911 | Ga0207654_10023548 | Ga0207654_100235483 | 185 |
| 37 | 3300025912 | Ga0207707_10021374 | Ga0207707_100213745 | 185 |
| 38 | 3300025912 | Ga0207707_10116193 | Ga0207707_101161933 | 185 |
| 39 | 3300025914 | Ga0207671_10063237 | Ga0207671_100632372 | 185 |
| 40 | 3300025917 | Ga0207660_10010154 | Ga0207660_100101545 | 185 |
| 41 | 3300025919 | Ga0207657_10009108 | Ga0207657_100091088 | 185 |
| 42 | 3300025920 | Ga0207649_10011618 | Ga0207649_100116182 | 185 |
| 43 | 3300025921 | Ga0207652_10174442 | Ga0207652_101744422 | 185 |
| 44 | 3300025921 | Ga0207652_10272847 | Ga0207652_102728472 | 185 |
| 45 | 3300025923 | Ga0207681_10424901 | Ga0207681_104249012 | 185 |
| 46 | 3300025929 | Ga0207664_10029789 | Ga0207664_100297893 | 185 |
| 47 | 3300025931 | Ga0207644_10004980 | Ga0207644_100049806 | 185 |
| 48 | 3300025933 | Ga0207706_10067822 | Ga0207706_100678222 | 185 |
| 49 | 3300025933 | Ga0207706_10214488 | Ga0207706_102144882 | 185 |
| 50 | 3300025940 | Ga0207691_10095012 | Ga0207691_100950123 | 185 |
| 51 | 3300025941 | Ga0207711_10007838 | Ga0207711_100078385 | 185 |
| 52 | 3300025944 | Ga0207661_10112997 | Ga0207661_101129972 | 185 |
| 53 | 3300025945 | Ga0207679_10148749 | Ga0207679_101487492 | 185 |
| 54 | 3300025949 | Ga0207667_10018772 | Ga0207667_100187725 | 185 |
| 55 | 3300025949 | Ga0207667_10347196 | Ga0207667_103471962 | 185 |
| 56 | 3300025960 | Ga0207651_10109064 | Ga0207651_101090642 | 185 |
| 57 | 3300025972 | Ga0207668_10658016 | Ga0207668_106580161 | 185 |
| 58 | 3300025981 | Ga0207640_10074462 | Ga0207640_100744621 | 185 |
| 59 | 3300026067 | Ga0207678_10003010 | Ga0207678_1000301012 | 185 |
| 60 | 3300026116 | Ga0207674_10000956 | Ga0207674_100009564 | 185 |
| 61 | 3300026142 | Ga0207698_10007473 | Ga0207698_100074735 | 185 |
| 62 | 3300037418 | Ga0395900_0189368 | Ga0395900_0189368_1061_1642 | 185 |
| 63 | 3300037471 | Ga0395905_0197937 | Ga0395905_0197937_683_1264 | 185 |
| 64 | 3300038443 | Ga0395901_0028910 | Ga0395901_0028910_74_655 | 185 |
| 65 | 3300048904 | Ga0496101_0319526 | Ga0496101_0319526_467_1048 | 185 |
| 66 | 3300048905 | Ga0496102_0057948 | Ga0496102_0057948_1222_1803 | 185 |
| 67 | 3300048909 | Ga0496106_0211012 | Ga0496106_0211012_227_808 | 185 |
| 68 | 3300048913 | Ga0496110_0837834 | Ga0496110_0837834_220_801 | 185 |
| 69 | 3300050514 | nmdc:mga08x19_381577_c1 | nmdc:mga08x19_381577_c1_11_592 | 185 |
| 70 | 3300049583 | Ga0501067_0468490 | Ga0501067_0468490_10_582 | 190 |
| 71 | 3300050511 | nmdc:mga08y16_94304_c1 | nmdc:mga08y16_94304_c1_1524_2105 | 193 |
| 72 | 3300026075 | Ga0207708_10161441 | Ga0207708_101614413 | 194 |
| 73 | 3300049572 | Ga0501036_0373856 | Ga0501036_0373856_481_1065 | 194 |
| 74 | 3300049577 | Ga0501041_0449162 | Ga0501041_0449162_184_768 | 194 |
| 75 | 3300049580 | Ga0501046_0264577 | Ga0501046_0264577_528_1112 | 194 |
| 76 | 3300049584 | Ga0501068_0237690 | Ga0501068_0237690_103_687 | 194 |
| 77 | 3300049588 | Ga0501072_0123105 | Ga0501072_0123105_500_1084 | 194 |
| 78 | 3300049591 | Ga0501075_0008430 | Ga0501075_0008430_6027_6611 | 194 |
| 79 | 3300049592 | Ga0501076_0034277 | Ga0501076_0034277_3122_3706 | 194 |
| 80 | 3300049741 | Ga0501079_0093779 | Ga0501079_0093779_1342_1926 | 194 |
| 81 | 3300049824 | Ga0501045_0139426 | Ga0501045_0139426_883_1467 | 194 |
| 82 | 3300054114 | Ga0501084_0745201 | Ga0501084_0745201_99_683 | 194 |
| 83 | 3300005471 | Ga0070698_100829766 | Ga0070698_1008297661 | 196 |
| 84 | 3300005536 | Ga0070697_100997659 | Ga0070697_1009976591 | 196 |
| 85 | 3300006173 | Ga0070716_100290864 | Ga0070716_1002908642 | 196 |
| 86 | 3300006852 | Ga0075433_10061416 | Ga0075433_100614163 | 196 |
| 87 | 3300006871 | Ga0075434_100030678 | Ga0075434_1000306786 | 196 |
| 88 | 3300006914 | Ga0075436_100116709 | Ga0075436_1001167092 | 196 |
| 89 | 3300007076 | Ga0075435_100418794 | Ga0075435_1004187942 | 196 |
| 90 | 3300009147 | Ga0114129_10005359 | Ga0114129_100053595 | 196 |
| 91 | 3300009148 | Ga0105243_10067067 | Ga0105243_100670673 | 196 |
| 92 | 3300025917 | Ga0207660_10237780 | Ga0207660_102377802 | 196 |
| 93 | 3300025939 | Ga0207665_10530664 | Ga0207665_105306642 | 196 |
| 94 | 3300032002 | Ga0307416_100115903 | Ga0307416_1001159032 | 196 |
| 95 | 3300045051 | Ga0451576_0834465 | Ga0451576_0834465_21_611 | 196 |
| 96 | 3300049580 | Ga0501046_0331182 | Ga0501046_0331182_505_1098 | 196 |
| 97 | 3300049580 | Ga0501046_0839855 | Ga0501046_0839855_39_632 | 196 |
| 98 | 3300050507 | nmdc:mga05p37_77_c1 | nmdc:mga05p37_77_c1_54150_54752 | 196 |
| 99 | 3300050508 | nmdc:mga09592_1000729_c1 | nmdc:mga09592_1000729_c1_14_613 | 196 |
| 100 | 3300050508 | nmdc:mga09592_140_c1 | nmdc:mga09592_140_c1_22782_23384 | 196 |
| 101 | 3300050510 | nmdc:mga06r32_61973_c1 | nmdc:mga06r32_61973_c1_1854_2456 | 196 |
| 102 | 3300050512 | nmdc:mga0n895_48283_c1 | nmdc:mga0n895_48283_c1_966_1559 | 196 |
| 103 | 3300050512 | nmdc:mga0n895_792501_c1 | nmdc:mga0n895_792501_c1_13_612 | 196 |
| 104 | 3300050513 | nmdc:mga0rr50_736127_c1 | nmdc:mga0rr50_736127_c1_172_765 | 196 |
| 105 | 3300050515 | nmdc:mga0a205_83595_c1 | nmdc:mga0a205_83595_c1_2214_2807 | 196 |
| 106 | 3300005341 | Ga0070691_10050732 | Ga0070691_100507322 | 201 |
| 107 | 3300005444 | Ga0070694_100103234 | Ga0070694_1001032343 | 201 |
| 108 | 3300005444 | Ga0070694_100576624 | Ga0070694_1005766242 | 201 |
| 109 | 3300005546 | Ga0070696_100444546 | Ga0070696_1004445462 | 201 |
| 110 | 3300005549 | Ga0070704_100193204 | Ga0070704_1001932042 | 201 |
| 111 | 3300006852 | Ga0075433_10292049 | Ga0075433_102920492 | 201 |
| 112 | 3300006871 | Ga0075434_100211253 | Ga0075434_1002112532 | 201 |
| 113 | 3300006871 | Ga0075434_100830456 | Ga0075434_1008304562 | 201 |
| 114 | 3300006871 | Ga0075434_101068199 | Ga0075434_1010681991 | 201 |
| 115 | 3300006880 | Ga0075429_100177510 | Ga0075429_1001775102 | 201 |
| 116 | 3300009094 | Ga0111539_10131849 | Ga0111539_101318494 | 201 |
| 117 | 3300026089 | Ga0207648_10394633 | Ga0207648_103946332 | 201 |
| 118 | 3300036401 | Ga0373937_0103509 | Ga0373937_0103509_1103_1708 | 201 |
| 119 | 3300046454 | Ga0495592_0014466 | Ga0495592_0014466_3835_4440 | 201 |
| 120 | 3300046461 | Ga0495641_0063311 | Ga0495641_0063311_512_1117 | 201 |
| 121 | 3300046476 | Ga0495662_0070368 | Ga0495662_0070368_410_1015 | 201 |
| 122 | 3300046477 | Ga0495664_0150041 | Ga0495664_0150041_637_1242 | 201 |
| 123 | 3300046511 | Ga0495608_0007343 | Ga0495608_0007343_2839_3444 | 201 |
| 124 | 3300046514 | Ga0495618_0010594 | Ga0495618_0010594_1529_2134 | 201 |
| 125 | 3300046516 | Ga0495628_0111971 | Ga0495628_0111971_733_1338 | 201 |
| 126 | 3300046517 | Ga0495630_0015067 | Ga0495630_0015067_1275_1880 | 201 |
| 127 | 3300046529 | Ga0495652_0069125 | Ga0495652_0069125_1484_2089 | 201 |
| 128 | 3300046533 | Ga0495640_0006892 | Ga0495640_0006892_7958_8563 | 201 |
| 129 | 3300046533 | Ga0495640_0034541 | Ga0495640_0034541_1980_2585 | 201 |
| 130 | 3300046535 | Ga0495586_0004396 | Ga0495586_0004396_1767_2372 | 201 |
| 131 | 3300046536 | Ga0495587_0081319 | Ga0495587_0081319_573_1178 | 201 |
| 132 | 3300046559 | Ga0495667_0014654 | Ga0495667_0014654_869_1474 | 201 |
| 133 | 3300046642 | Ga0495634_0031176 | Ga0495634_0031176_1666_2271 | 201 |
| 134 | 3300046663 | Ga0495635_0029037 | Ga0495635_0029037_2673_3278 | 201 |
| 135 | 3300046678 | Ga0495599_0060146 | Ga0495599_0060146_236_841 | 201 |
| 136 | 3300046683 | Ga0495658_0091324 | Ga0495658_0091324_1067_1672 | 201 |
| 137 | 3300046683 | Ga0495658_0276181 | Ga0495658_0276181_304_909 | 201 |
| 138 | 3300046689 | Ga0495613_0068075 | Ga0495613_0068075_1251_1856 | 201 |
| 139 | 3300046809 | Ga0495600_0205199 | Ga0495600_0205199_632_1237 | 201 |
| 140 | 3300047317 | Ga0495604_0031472 | Ga0495604_0031472_1117_1722 | 201 |
| 141 | 3300047322 | Ga0495680_0162865 | Ga0495680_0162865_847_1452 | 201 |
| 142 | 3300047471 | Ga0495684_0209859 | Ga0495684_0209859_406_1011 | 201 |
| 143 | 3300047673 | Ga0495593_0234686 | Ga0495593_0234686_159_764 | 201 |
| 144 | 3300047673 | Ga0495593_0236836 | Ga0495593_0236836_14_619 | 201 |
| 145 | 3300050508 | nmdc:mga09592_150391_c1 | nmdc:mga09592_150391_c1_398_1003 | 201 |
| 146 | 3300050512 | nmdc:mga0n895_125607_c1 | nmdc:mga0n895_125607_c1_1149_1754 | 201 |
| 147 | 3300050512 | nmdc:mga0n895_553083_c1 | nmdc:mga0n895_553083_c1_483_1088 | 201 |
| 148 | 3300053077 | Ga0495601_0047730 | Ga0495601_0047730_1202_1807 | 201 |
| 149 | 3300053085 | Ga0495619_0308469 | Ga0495619_0308469_25_630 | 201 |
| 150 | 3300005437 | Ga0070710_10026915 | Ga0070710_100269152 | 202 |
| 151 | 3300005439 | Ga0070711_100589699 | Ga0070711_1005896992 | 202 |
| 152 | 3300032126 | Ga0307415_100514897 | Ga0307415_1005148972 | 202 |
| 153 | 3300035119 | Ga0373956_0021330 | Ga0373956_0021330_423_1031 | 202 |
| 154 | 3300035120 | Ga0373957_0015053 | Ga0373957_0015053_244_852 | 202 |
| 155 | 3300035172 | Ga0373955_0058778 | Ga0373955_0058778_1435_2043 | 202 |
| 156 | 3300035410 | Ga0373924_0002130 | Ga0373924_0002130_563_1171 | 202 |
| 157 | 3300035724 | Ga0373933_0014146 | Ga0373933_0014146_3307_3915 | 202 |
| 158 | 3300036401 | Ga0373937_0017415 | Ga0373937_0017415_5660_6268 | 202 |
| 159 | 3300042156 | Ga0439446_0024779 | Ga0439446_0024779_470_1114 | 202 |
| 160 | 3300046675 | Ga0495657_0387458 | Ga0495657_0387458_96_704 | 202 |
| 161 | 3300005295 | Ga0065707_10082232 | Ga0065707_100822322 | 203 |
| 162 | 3300006844 | Ga0075428_100503100 | Ga0075428_1005031002 | 203 |
| 163 | 3300006846 | Ga0075430_100563165 | Ga0075430_1005631651 | 203 |
| 164 | 3300025917 | Ga0207660_10117480 | Ga0207660_101174804 | 203 |
| 165 | 3300027526 | Ga0209968_1008484 | Ga0209968_10084842 | 203 |
| 166 | 3300035695 | Ga0373927_0109431 | Ga0373927_0109431_500_1111 | 203 |
| 167 | 3300035725 | Ga0373947_0074559 | Ga0373947_0074559_1119_1730 | 203 |
| 168 | 3300037068 | Ga0373925_0000920 | Ga0373925_0000920_6414_7025 | 203 |
| 169 | 3300042003 | Ga0439443_002918 | Ga0439443_002918_400_1011 | 203 |
| 170 | 3300042436 | Ga0439435_0000277 | Ga0439435_0000277_433_1044 | 203 |
| 171 | 3300042436 | Ga0439435_0001802 | Ga0439435_0001802_1076_1687 | 203 |
| 172 | 3300042436 | Ga0439435_0121908 | Ga0439435_0121908_138_749 | 203 |
| 173 | 3300042437 | Ga0439444_0003955 | Ga0439444_0003955_871_1482 | 203 |
| 174 | 3300042461 | Ga0439460_0000454 | Ga0439460_0000454_8172_8783 | 203 |
| 175 | 3300046664 | Ga0495659_0073017 | Ga0495659_0073017_282_893 | 203 |
| 176 | 3300046681 | Ga0495647_0210352 | Ga0495647_0210352_223_834 | 203 |
| 177 | 3300046683 | Ga0495658_0097342 | Ga0495658_0097342_1075_1686 | 203 |
| 178 | 3300049570 | Ga0501033_0527337 | Ga0501033_0527337_145_756 | 203 |
| 179 | 3300049573 | Ga0501037_0169095 | Ga0501037_0169095_35_646 | 203 |
| 180 | 3300049574 | Ga0501038_0078941 | Ga0501038_0078941_968_1579 | 203 |
| 181 | 3300049575 | Ga0501039_0025541 | Ga0501039_0025541_1835_2446 | 203 |
| 182 | 3300049576 | Ga0501040_0112159 | Ga0501040_0112159_1184_1795 | 203 |
| 183 | 3300049576 | Ga0501040_0203387 | Ga0501040_0203387_698_1309 | 203 |
| 184 | 3300049576 | Ga0501040_0460507 | Ga0501040_0460507_71_682 | 203 |
| 185 | 3300049577 | Ga0501041_0078132 | Ga0501041_0078132_57_668 | 203 |
| 186 | 3300049578 | Ga0501042_0021872 | Ga0501042_0021872_2191_2802 | 203 |
| 187 | 3300049580 | Ga0501046_0040314 | Ga0501046_0040314_1353_1964 | 203 |
| 188 | 3300049582 | Ga0501048_0085162 | Ga0501048_0085162_313_924 | 203 |
| 189 | 3300049588 | Ga0501072_0005763 | Ga0501072_0005763_1204_1815 | 203 |
| 190 | 3300049591 | Ga0501075_0003753 | Ga0501075_0003753_5679_6290 | 203 |
| 191 | 3300049592 | Ga0501076_0001091 | Ga0501076_0001091_9960_10571 | 203 |
| 192 | 3300049593 | Ga0501077_0073045 | Ga0501077_0073045_362_973 | 203 |
| 193 | 3300049741 | Ga0501079_0011674 | Ga0501079_0011674_5104_5715 | 203 |
| 194 | 3300049742 | Ga0501080_0070566 | Ga0501080_0070566_1426_2037 | 203 |
| 195 | 3300049743 | Ga0501081_0006843 | Ga0501081_0006843_2465_3076 | 203 |
| 196 | 3300049743 | Ga0501081_0149592 | Ga0501081_0149592_364_975 | 203 |
| 197 | 3300049743 | Ga0501081_0295520 | Ga0501081_0295520_111_722 | 203 |
| 198 | 3300049824 | Ga0501045_0007341 | Ga0501045_0007341_2804_3415 | 203 |
| 199 | 3300050509 | nmdc:mga0qj67_779747_c1 | nmdc:mga0qj67_779747_c1_68_679 | 203 |
| 200 | 3300059421 | Ga0590071_014584 | Ga0590071_014584_382_993 | 203 |
| 201 | 3300060353 | Ga0501082_0003995 | Ga0501082_0003995_8633_9244 | 203 |
| 202 | 3300061734 | Ga0530510_0002851 | Ga0530510_0002851_4869_5480 | 203 |
| 203 | 3300003203 | JGI25406J46586_10036712 | JGI25406J46586_100367122 | 204 |
| 204 | 3300005295 | Ga0065707_10140127 | Ga0065707_101401272 | 204 |
| 205 | 3300005328 | Ga0070676_10001054 | Ga0070676_1000105420 | 204 |
| 206 | 3300005329 | Ga0070683_100009336 | Ga0070683_1000093362 | 204 |
| 207 | 3300005330 | Ga0070690_100000289 | Ga0070690_10000028919 | 204 |
| 208 | 3300005330 | Ga0070690_100008257 | Ga0070690_1000082572 | 204 |
| 209 | 3300005330 | Ga0070690_100010634 | Ga0070690_1000106343 | 204 |
| 210 | 3300005330 | Ga0070690_100395550 | Ga0070690_1003955502 | 204 |
| 211 | 3300005330 | Ga0070690_100840140 | Ga0070690_1008401401 | 204 |
| 212 | 3300005333 | Ga0070677_10018848 | Ga0070677_100188482 | 204 |
| 213 | 3300005333 | Ga0070677_10142766 | Ga0070677_101427662 | 204 |
| 214 | 3300005334 | Ga0068869_100000299 | Ga0068869_1000002998 | 204 |
| 215 | 3300005334 | Ga0068869_100000782 | Ga0068869_10000078233 | 204 |
| 216 | 3300005334 | Ga0068869_100186958 | Ga0068869_1001869583 | 204 |
| 217 | 3300005335 | Ga0070666_10001388 | Ga0070666_100013884 | 204 |
| 218 | 3300005335 | Ga0070666_10097599 | Ga0070666_100975992 | 204 |
| 219 | 3300005336 | Ga0070680_100007424 | Ga0070680_1000074244 | 204 |
| 220 | 3300005336 | Ga0070680_100118235 | Ga0070680_1001182354 | 204 |
| 221 | 3300005336 | Ga0070680_100401851 | Ga0070680_1004018511 | 204 |
| 222 | 3300005336 | Ga0070680_100607685 | Ga0070680_1006076852 | 204 |
| 223 | 3300005338 | Ga0068868_100000531 | Ga0068868_10000053119 | 204 |
| 224 | 3300005338 | Ga0068868_100024328 | Ga0068868_1000243288 | 204 |
| 225 | 3300005340 | Ga0070689_100190308 | Ga0070689_1001903082 | 204 |
| 226 | 3300005340 | Ga0070689_100202158 | Ga0070689_1002021582 | 204 |
| 227 | 3300005340 | Ga0070689_100611661 | Ga0070689_1006116612 | 204 |
| 228 | 3300005341 | Ga0070691_10154485 | Ga0070691_101544853 | 204 |
| 229 | 3300005343 | Ga0070687_100000355 | Ga0070687_1000003556 | 204 |
| 230 | 3300005343 | Ga0070687_100000403 | Ga0070687_10000040311 | 204 |
| 231 | 3300005343 | Ga0070687_100265429 | Ga0070687_1002654292 | 204 |
| 232 | 3300005343 | Ga0070687_100410856 | Ga0070687_1004108561 | 204 |
| 233 | 3300005345 | Ga0070692_10002606 | Ga0070692_100026064 | 204 |
| 234 | 3300005345 | Ga0070692_10021627 | Ga0070692_100216277 | 204 |
| 235 | 3300005345 | Ga0070692_10145540 | Ga0070692_101455402 | 204 |
| 236 | 3300005345 | Ga0070692_10408477 | Ga0070692_104084772 | 204 |
| 237 | 3300005345 | Ga0070692_10584384 | Ga0070692_105843841 | 204 |
| 238 | 3300005347 | Ga0070668_100000682 | Ga0070668_1000006827 | 204 |
| 239 | 3300005347 | Ga0070668_100015073 | Ga0070668_1000150732 | 204 |
| 240 | 3300005353 | Ga0070669_100001513 | Ga0070669_1000015137 | 204 |
| 241 | 3300005353 | Ga0070669_100015151 | Ga0070669_1000151514 | 204 |
| 242 | 3300005354 | Ga0070675_100016038 | Ga0070675_1000160385 | 204 |
| 243 | 3300005354 | Ga0070675_100073810 | Ga0070675_1000738105 | 204 |
| 244 | 3300005355 | Ga0070671_101096191 | Ga0070671_1010961911 | 204 |
| 245 | 3300005356 | Ga0070674_100018912 | Ga0070674_1000189123 | 204 |
| 246 | 3300005364 | Ga0070673_100074393 | Ga0070673_1000743934 | 204 |
| 247 | 3300005365 | Ga0070688_100132976 | Ga0070688_1001329763 | 204 |
| 248 | 3300005365 | Ga0070688_100177189 | Ga0070688_1001771892 | 204 |
| 249 | 3300005367 | Ga0070667_100007737 | Ga0070667_1000077378 | 204 |
| 250 | 3300005367 | Ga0070667_100260245 | Ga0070667_1002602453 | 204 |
| 251 | 3300005406 | Ga0070703_10014022 | Ga0070703_100140223 | 204 |
| 252 | 3300005438 | Ga0070701_10000387 | Ga0070701_1000038713 | 204 |
| 253 | 3300005439 | Ga0070711_100452062 | Ga0070711_1004520621 | 204 |
| 254 | 3300005440 | Ga0070705_100000472 | Ga0070705_10000047210 | 204 |
| 255 | 3300005440 | Ga0070705_100021219 | Ga0070705_1000212195 | 204 |
| 256 | 3300005440 | Ga0070705_100082742 | Ga0070705_1000827422 | 204 |
| 257 | 3300005440 | Ga0070705_100313315 | Ga0070705_1003133152 | 204 |
| 258 | 3300005441 | Ga0070700_100002641 | Ga0070700_1000026412 | 204 |
| 259 | 3300005441 | Ga0070700_100041008 | Ga0070700_1000410082 | 204 |
| 260 | 3300005441 | Ga0070700_100076914 | Ga0070700_1000769143 | 204 |
| 261 | 3300005441 | Ga0070700_100384540 | Ga0070700_1003845402 | 204 |
| 262 | 3300005444 | Ga0070694_100000249 | Ga0070694_10000024917 | 204 |
| 263 | 3300005444 | Ga0070694_100002755 | Ga0070694_10000275511 | 204 |
| 264 | 3300005444 | Ga0070694_100032351 | Ga0070694_1000323512 | 204 |
| 265 | 3300005444 | Ga0070694_100096109 | Ga0070694_1000961093 | 204 |
| 266 | 3300005444 | Ga0070694_100413170 | Ga0070694_1004131702 | 204 |
| 267 | 3300005445 | Ga0070708_100071153 | Ga0070708_1000711532 | 204 |
| 268 | 3300005445 | Ga0070708_100874873 | Ga0070708_1008748731 | 204 |
| 269 | 3300005455 | Ga0070663_100043422 | Ga0070663_1000434223 | 204 |
| 270 | 3300005456 | Ga0070678_100016206 | Ga0070678_1000162065 | 204 |
| 271 | 3300005457 | Ga0070662_100034124 | Ga0070662_1000341243 | 204 |
| 272 | 3300005457 | Ga0070662_100282450 | Ga0070662_1002824502 | 204 |
| 273 | 3300005457 | Ga0070662_100333996 | Ga0070662_1003339962 | 204 |
| 274 | 3300005458 | Ga0070681_10492617 | Ga0070681_104926172 | 204 |
| 275 | 3300005459 | Ga0068867_100000430 | Ga0068867_1000004309 | 204 |
| 276 | 3300005459 | Ga0068867_100002651 | Ga0068867_10000265124 | 204 |
| 277 | 3300005467 | Ga0070706_100163026 | Ga0070706_1001630261 | 204 |
| 278 | 3300005518 | Ga0070699_100093706 | Ga0070699_1000937062 | 204 |
| 279 | 3300005530 | Ga0070679_100089258 | Ga0070679_1000892583 | 204 |
| 280 | 3300005536 | Ga0070697_100001293 | Ga0070697_10000129312 | 204 |
| 281 | 3300005539 | Ga0068853_100270386 | Ga0068853_1002703862 | 204 |
| 282 | 3300005539 | Ga0068853_100297181 | Ga0068853_1002971812 | 204 |
| 283 | 3300005543 | Ga0070672_100001295 | Ga0070672_1000012958 | 204 |
| 284 | 3300005543 | Ga0070672_100063248 | Ga0070672_1000632483 | 204 |
| 285 | 3300005543 | Ga0070672_100430916 | Ga0070672_1004309162 | 204 |
| 286 | 3300005544 | Ga0070686_100000392 | Ga0070686_10000039222 | 204 |
| 287 | 3300005544 | Ga0070686_100034552 | Ga0070686_1000345525 | 204 |
| 288 | 3300005544 | Ga0070686_100596758 | Ga0070686_1005967582 | 204 |
| 289 | 3300005545 | Ga0070695_100000185 | Ga0070695_10000018511 | 204 |
| 290 | 3300005545 | Ga0070695_100495729 | Ga0070695_1004957292 | 204 |
| 291 | 3300005546 | Ga0070696_100000519 | Ga0070696_10000051917 | 204 |
| 292 | 3300005546 | Ga0070696_100002012 | Ga0070696_10000201214 | 204 |
| 293 | 3300005546 | Ga0070696_100018323 | Ga0070696_1000183233 | 204 |
| 294 | 3300005546 | Ga0070696_100104966 | Ga0070696_1001049663 | 204 |
| 295 | 3300005546 | Ga0070696_100646344 | Ga0070696_1006463441 | 204 |
| 296 | 3300005547 | Ga0070693_100000135 | Ga0070693_10000013527 | 204 |
| 297 | 3300005547 | Ga0070693_100257096 | Ga0070693_1002570962 | 204 |
| 298 | 3300005547 | Ga0070693_100326404 | Ga0070693_1003264042 | 204 |
| 299 | 3300005549 | Ga0070704_100000108 | Ga0070704_1000001084 | 204 |
| 300 | 3300005549 | Ga0070704_100083896 | Ga0070704_1000838962 | 204 |
| 301 | 3300005549 | Ga0070704_100086465 | Ga0070704_1000864653 | 204 |
| 302 | 3300005549 | Ga0070704_100481566 | Ga0070704_1004815662 | 204 |
| 303 | 3300005563 | Ga0068855_100002231 | Ga0068855_1000022318 | 204 |
| 304 | 3300005577 | Ga0068857_100645306 | Ga0068857_1006453062 | 204 |
| 305 | 3300005577 | Ga0068857_100737021 | Ga0068857_1007370212 | 204 |
| 306 | 3300005614 | Ga0068856_100013516 | Ga0068856_1000135169 | 204 |
| 307 | 3300005614 | Ga0068856_100109958 | Ga0068856_1001099582 | 204 |
| 308 | 3300005614 | Ga0068856_100158041 | Ga0068856_1001580412 | 204 |
| 309 | 3300005615 | Ga0070702_100000557 | Ga0070702_10000055714 | 204 |
| 310 | 3300005615 | Ga0070702_100076821 | Ga0070702_1000768212 | 204 |
| 311 | 3300005616 | Ga0068852_100018182 | Ga0068852_1000181822 | 204 |
| 312 | 3300005616 | Ga0068852_100738304 | Ga0068852_1007383042 | 204 |
| 313 | 3300005617 | Ga0068859_100001399 | Ga0068859_10000139910 | 204 |
| 314 | 3300005617 | Ga0068859_100090027 | Ga0068859_1000900274 | 204 |
| 315 | 3300005617 | Ga0068859_100112847 | Ga0068859_1001128473 | 204 |
| 316 | 3300005618 | Ga0068864_100039636 | Ga0068864_1000396364 | 204 |
| 317 | 3300005618 | Ga0068864_100272380 | Ga0068864_1002723803 | 204 |
| 318 | 3300005618 | Ga0068864_100452285 | Ga0068864_1004522852 | 204 |
| 319 | 3300005718 | Ga0068866_10001478 | Ga0068866_100014782 | 204 |
| 320 | 3300005718 | Ga0068866_10002633 | Ga0068866_1000263313 | 204 |
| 321 | 3300005719 | Ga0068861_100001038 | Ga0068861_1000010384 | 204 |
| 322 | 3300005719 | Ga0068861_100001358 | Ga0068861_1000013581 | 204 |
| 323 | 3300005719 | Ga0068861_100010298 | Ga0068861_1000102988 | 204 |
| 324 | 3300005719 | Ga0068861_100074216 | Ga0068861_1000742163 | 204 |
| 325 | 3300005840 | Ga0068870_10149137 | Ga0068870_101491373 | 204 |
| 326 | 3300005841 | Ga0068863_100001611 | Ga0068863_1000016112 | 204 |
| 327 | 3300005841 | Ga0068863_100138342 | Ga0068863_1001383422 | 204 |
| 328 | 3300005841 | Ga0068863_100910362 | Ga0068863_1009103622 | 204 |
| 329 | 3300005842 | Ga0068858_100003840 | Ga0068858_1000038406 | 204 |
| 330 | 3300005842 | Ga0068858_100593837 | Ga0068858_1005938372 | 204 |
| 331 | 3300005843 | Ga0068860_100001826 | Ga0068860_10000182630 | 204 |
| 332 | 3300005843 | Ga0068860_100002413 | Ga0068860_1000024138 | 204 |
| 333 | 3300005843 | Ga0068860_100030311 | Ga0068860_1000303114 | 204 |
| 334 | 3300005844 | Ga0068862_100001204 | Ga0068862_10000120417 | 204 |
| 335 | 3300005844 | Ga0068862_100003042 | Ga0068862_1000030427 | 204 |
| 336 | 3300005844 | Ga0068862_100017851 | Ga0068862_1000178516 | 204 |
| 337 | 3300005844 | Ga0068862_100070394 | Ga0068862_1000703943 | 204 |
| 338 | 3300005844 | Ga0068862_100093124 | Ga0068862_1000931245 | 204 |
| 339 | 3300005844 | Ga0068862_100141810 | Ga0068862_1001418102 | 204 |
| 340 | 3300005985 | Ga0081539_10000462 | Ga0081539_1000046231 | 204 |
| 341 | 3300006237 | Ga0097621_100001049 | Ga0097621_10000104912 | 204 |
| 342 | 3300006237 | Ga0097621_100004130 | Ga0097621_1000041306 | 204 |
| 343 | 3300006237 | Ga0097621_100282111 | Ga0097621_1002821112 | 204 |
| 344 | 3300006358 | Ga0068871_100000370 | Ga0068871_1000003709 | 204 |
| 345 | 3300006358 | Ga0068871_100004173 | Ga0068871_10000417312 | 204 |
| 346 | 3300006358 | Ga0068871_100561979 | Ga0068871_1005619792 | 204 |
| 347 | 3300006844 | Ga0075428_100000993 | Ga0075428_10000099313 | 204 |
| 348 | 3300006844 | Ga0075428_100066543 | Ga0075428_1000665433 | 204 |
| 349 | 3300006844 | Ga0075428_100243377 | Ga0075428_1002433772 | 204 |
| 350 | 3300006846 | Ga0075430_100002561 | Ga0075430_10000256113 | 204 |
| 351 | 3300006846 | Ga0075430_100809367 | Ga0075430_1008093672 | 204 |
| 352 | 3300006847 | Ga0075431_100267579 | Ga0075431_1002675792 | 204 |
| 353 | 3300006852 | Ga0075433_10007872 | Ga0075433_100078728 | 204 |
| 354 | 3300006852 | Ga0075433_10146936 | Ga0075433_101469363 | 204 |
| 355 | 3300006871 | Ga0075434_100003359 | Ga0075434_10000335913 | 204 |
| 356 | 3300006880 | Ga0075429_100000003 | Ga0075429_10000000362 | 204 |
| 357 | 3300006880 | Ga0075429_100002816 | Ga0075429_10000281614 | 204 |
| 358 | 3300006880 | Ga0075429_100029199 | Ga0075429_1000291993 | 204 |
| 359 | 3300006880 | Ga0075429_100562320 | Ga0075429_1005623202 | 204 |
| 360 | 3300006881 | Ga0068865_100000283 | Ga0068865_10000028322 | 204 |
| 361 | 3300006881 | Ga0068865_100000599 | Ga0068865_10000059913 | 204 |
| 362 | 3300006881 | Ga0068865_100521630 | Ga0068865_1005216302 | 204 |
| 363 | 3300006914 | Ga0075436_100001687 | Ga0075436_10000168710 | 204 |
| 364 | 3300006914 | Ga0075436_100026392 | Ga0075436_1000263925 | 204 |
| 365 | 3300006931 | Ga0097620_100001399 | Ga0097620_10000139910 | 204 |
| 366 | 3300006931 | Ga0097620_100090025 | Ga0097620_1000900253 | 204 |
| 367 | 3300006931 | Ga0097620_100112848 | Ga0097620_1001128483 | 204 |
| 368 | 3300007076 | Ga0075435_100001908 | Ga0075435_10000190813 | 204 |
| 369 | 3300007076 | Ga0075435_100045483 | Ga0075435_1000454833 | 204 |
| 370 | 3300007076 | Ga0075435_100281364 | Ga0075435_1002813641 | 204 |
| 371 | 3300007076 | Ga0075435_100645168 | Ga0075435_1006451681 | 204 |
| 372 | 3300007265 | Ga0099794_10009654 | Ga0099794_100096544 | 204 |
| 373 | 3300009092 | Ga0105250_10019097 | Ga0105250_100190972 | 204 |
| 374 | 3300009094 | Ga0111539_10023346 | Ga0111539_100233462 | 204 |
| 375 | 3300009094 | Ga0111539_10027656 | Ga0111539_100276564 | 204 |
| 376 | 3300009094 | Ga0111539_10065980 | Ga0111539_100659803 | 204 |
| 377 | 3300009094 | Ga0111539_10125633 | Ga0111539_101256333 | 204 |
| 378 | 3300009094 | Ga0111539_10203580 | Ga0111539_102035804 | 204 |
| 379 | 3300009094 | Ga0111539_10304718 | Ga0111539_103047185 | 204 |
| 380 | 3300009094 | Ga0111539_11679898 | Ga0111539_116798981 | 204 |
| 381 | 3300009098 | Ga0105245_10001066 | Ga0105245_100010667 | 204 |
| 382 | 3300009098 | Ga0105245_10012082 | Ga0105245_100120828 | 204 |
| 383 | 3300009147 | Ga0114129_10001138 | Ga0114129_1000113818 | 204 |
| 384 | 3300009147 | Ga0114129_10318058 | Ga0114129_103180582 | 204 |
| 385 | 3300009147 | Ga0114129_10651601 | Ga0114129_106516012 | 204 |
| 386 | 3300009148 | Ga0105243_10000708 | Ga0105243_1000070827 | 204 |
| 387 | 3300009148 | Ga0105243_10002376 | Ga0105243_100023768 | 204 |
| 388 | 3300009148 | Ga0105243_10011238 | Ga0105243_100112387 | 204 |
| 389 | 3300009174 | Ga0105241_10015810 | Ga0105241_100158107 | 204 |
| 390 | 3300009176 | Ga0105242_10001614 | Ga0105242_100016149 | 204 |
| 391 | 3300009176 | Ga0105242_10003692 | Ga0105242_100036925 | 204 |
| 392 | 3300009176 | Ga0105242_10150666 | Ga0105242_101506663 | 204 |
| 393 | 3300009177 | Ga0105248_10005188 | Ga0105248_1000518817 | 204 |
| 394 | 3300009177 | Ga0105248_10202109 | Ga0105248_102021092 | 204 |
| 395 | 3300009177 | Ga0105248_10316364 | Ga0105248_103163642 | 204 |
| 396 | 3300009551 | Ga0105238_10815244 | Ga0105238_108152442 | 204 |
| 397 | 3300009553 | Ga0105249_10000996 | Ga0105249_1000099614 | 204 |
| 398 | 3300009553 | Ga0105249_10005638 | Ga0105249_100056382 | 204 |
| 399 | 3300009553 | Ga0105249_10092104 | Ga0105249_100921043 | 204 |
| 400 | 3300009553 | Ga0105249_10105216 | Ga0105249_101052163 | 204 |
| 401 | 3300013102 | Ga0157371_10298535 | Ga0157371_102985352 | 204 |
| 402 | 3300013296 | Ga0157374_10303333 | Ga0157374_103033332 | 204 |
| 403 | 3300013297 | Ga0157378_10001153 | Ga0157378_1000115317 | 204 |
| 404 | 3300013297 | Ga0157378_10123484 | Ga0157378_101234844 | 204 |
| 405 | 3300013306 | Ga0163162_10005059 | Ga0163162_1000505917 | 204 |
| 406 | 3300013306 | Ga0163162_10107920 | Ga0163162_101079202 | 204 |
| 407 | 3300013306 | Ga0163162_10117859 | Ga0163162_101178592 | 204 |
| 408 | 3300013306 | Ga0163162_11572580 | Ga0163162_115725801 | 204 |
| 409 | 3300013308 | Ga0157375_10000906 | Ga0157375_1000090617 | 204 |
| 410 | 3300013308 | Ga0157375_10119505 | Ga0157375_101195053 | 204 |
| 411 | 3300014326 | Ga0157380_10002623 | Ga0157380_1000262317 | 204 |
| 412 | 3300014326 | Ga0157380_10023634 | Ga0157380_100236347 | 204 |
| 413 | 3300014326 | Ga0157380_10049523 | Ga0157380_100495234 | 204 |
| 414 | 3300014326 | Ga0157380_10172289 | Ga0157380_101722892 | 204 |
| 415 | 3300014968 | Ga0157379_10028553 | Ga0157379_100285534 | 204 |
| 416 | 3300014968 | Ga0157379_10198166 | Ga0157379_101981662 | 204 |
| 417 | 3300014969 | Ga0157376_10069460 | Ga0157376_100694604 | 204 |
| 418 | 3300014969 | Ga0157376_10165442 | Ga0157376_101654424 | 204 |
| 419 | 3300017792 | Ga0163161_10000551 | Ga0163161_1000055123 | 204 |
| 420 | 3300017792 | Ga0163161_10175190 | Ga0163161_101751901 | 204 |
| 421 | 3300025315 | Ga0207697_10004623 | Ga0207697_100046235 | 204 |
| 422 | 3300025885 | Ga0207653_10022602 | Ga0207653_100226022 | 204 |
| 423 | 3300025885 | Ga0207653_10142339 | Ga0207653_101423392 | 204 |
| 424 | 3300025893 | Ga0207682_10030051 | Ga0207682_100300513 | 204 |
| 425 | 3300025899 | Ga0207642_10000750 | Ga0207642_100007502 | 204 |
| 426 | 3300025899 | Ga0207642_10022003 | Ga0207642_100220034 | 204 |
| 427 | 3300025903 | Ga0207680_10002557 | Ga0207680_100025575 | 204 |
| 428 | 3300025903 | Ga0207680_10080910 | Ga0207680_100809102 | 204 |
| 429 | 3300025907 | Ga0207645_10000390 | Ga0207645_1000039066 | 204 |
| 430 | 3300025907 | Ga0207645_10011013 | Ga0207645_100110138 | 204 |
| 431 | 3300025907 | Ga0207645_10153332 | Ga0207645_101533322 | 204 |
| 432 | 3300025910 | Ga0207684_10038808 | Ga0207684_100388085 | 204 |
| 433 | 3300025912 | Ga0207707_10149245 | Ga0207707_101492452 | 204 |
| 434 | 3300025912 | Ga0207707_10394523 | Ga0207707_103945232 | 204 |
| 435 | 3300025917 | Ga0207660_10149366 | Ga0207660_101493663 | 204 |
| 436 | 3300025917 | Ga0207660_10438416 | Ga0207660_104384162 | 204 |
| 437 | 3300025918 | Ga0207662_10000191 | Ga0207662_1000019122 | 204 |
| 438 | 3300025918 | Ga0207662_10001816 | Ga0207662_1000181612 | 204 |
| 439 | 3300025918 | Ga0207662_10234386 | Ga0207662_102343862 | 204 |
| 440 | 3300025918 | Ga0207662_10433685 | Ga0207662_104336852 | 204 |
| 441 | 3300025921 | Ga0207652_10108716 | Ga0207652_101087163 | 204 |
| 442 | 3300025921 | Ga0207652_10804993 | Ga0207652_108049931 | 204 |
| 443 | 3300025922 | Ga0207646_10199130 | Ga0207646_101991302 | 204 |
| 444 | 3300025922 | Ga0207646_10805360 | Ga0207646_108053601 | 204 |
| 445 | 3300025923 | Ga0207681_10010837 | Ga0207681_100108377 | 204 |
| 446 | 3300025923 | Ga0207681_10016603 | Ga0207681_100166037 | 204 |
| 447 | 3300025923 | Ga0207681_10128293 | Ga0207681_101282932 | 204 |
| 448 | 3300025926 | Ga0207659_10019827 | Ga0207659_100198276 | 204 |
| 449 | 3300025926 | Ga0207659_10026847 | Ga0207659_100268475 | 204 |
| 450 | 3300025927 | Ga0207687_10001813 | Ga0207687_1000181311 | 204 |
| 451 | 3300025933 | Ga0207706_10002980 | Ga0207706_1000298019 | 204 |
| 452 | 3300025933 | Ga0207706_10122008 | Ga0207706_101220081 | 204 |
| 453 | 3300025933 | Ga0207706_10572404 | Ga0207706_105724042 | 204 |
| 454 | 3300025934 | Ga0207686_10001418 | Ga0207686_100014185 | 204 |
| 455 | 3300025934 | Ga0207686_10022309 | Ga0207686_100223093 | 204 |
| 456 | 3300025935 | Ga0207709_10001098 | Ga0207709_100010988 | 204 |
| 457 | 3300025935 | Ga0207709_10021268 | Ga0207709_100212682 | 204 |
| 458 | 3300025935 | Ga0207709_10073500 | Ga0207709_100735002 | 204 |
| 459 | 3300025935 | Ga0207709_10228264 | Ga0207709_102282643 | 204 |
| 460 | 3300025936 | Ga0207670_10243838 | Ga0207670_102438382 | 204 |
| 461 | 3300025936 | Ga0207670_10533694 | Ga0207670_105336941 | 204 |
| 462 | 3300025936 | Ga0207670_10908467 | Ga0207670_109084671 | 204 |
| 463 | 3300025937 | Ga0207669_10027920 | Ga0207669_100279206 | 204 |
| 464 | 3300025937 | Ga0207669_10392891 | Ga0207669_103928911 | 204 |
| 465 | 3300025938 | Ga0207704_10000409 | Ga0207704_100004099 | 204 |
| 466 | 3300025938 | Ga0207704_10003731 | Ga0207704_1000373111 | 204 |
| 467 | 3300025938 | Ga0207704_10015773 | Ga0207704_100157736 | 204 |
| 468 | 3300025940 | Ga0207691_10001079 | Ga0207691_1000107943 | 204 |
| 469 | 3300025940 | Ga0207691_10016817 | Ga0207691_1001681712 | 204 |
| 470 | 3300025940 | Ga0207691_10148924 | Ga0207691_101489244 | 204 |
| 471 | 3300025941 | Ga0207711_10026903 | Ga0207711_100269036 | 204 |
| 472 | 3300025941 | Ga0207711_10063905 | Ga0207711_100639052 | 204 |
| 473 | 3300025942 | Ga0207689_10000921 | Ga0207689_100009219 | 204 |
| 474 | 3300025942 | Ga0207689_10036897 | Ga0207689_100368974 | 204 |
| 475 | 3300025949 | Ga0207667_10017372 | Ga0207667_100173728 | 204 |
| 476 | 3300025960 | Ga0207651_10221178 | Ga0207651_102211782 | 204 |
| 477 | 3300025960 | Ga0207651_10226974 | Ga0207651_102269742 | 204 |
| 478 | 3300025961 | Ga0207712_10007728 | Ga0207712_1000772810 | 204 |
| 479 | 3300025961 | Ga0207712_10117711 | Ga0207712_101177112 | 204 |
| 480 | 3300025961 | Ga0207712_10258394 | Ga0207712_102583942 | 204 |
| 481 | 3300025961 | Ga0207712_10608927 | Ga0207712_106089271 | 204 |
| 482 | 3300025972 | Ga0207668_10002352 | Ga0207668_1000235220 | 204 |
| 483 | 3300025972 | Ga0207668_10017408 | Ga0207668_100174083 | 204 |
| 484 | 3300025972 | Ga0207668_10157848 | Ga0207668_101578481 | 204 |
| 485 | 3300025981 | Ga0207640_10001592 | Ga0207640_100015928 | 204 |
| 486 | 3300025981 | Ga0207640_10956978 | Ga0207640_109569782 | 204 |
| 487 | 3300025986 | Ga0207658_10019716 | Ga0207658_100197166 | 204 |
| 488 | 3300025986 | Ga0207658_10347392 | Ga0207658_103473922 | 204 |
| 489 | 3300026023 | Ga0207677_10000592 | Ga0207677_1000059217 | 204 |
| 490 | 3300026023 | Ga0207677_10056605 | Ga0207677_100566052 | 204 |
| 491 | 3300026035 | Ga0207703_10000937 | Ga0207703_100009372 | 204 |
| 492 | 3300026035 | Ga0207703_10007345 | Ga0207703_100073454 | 204 |
| 493 | 3300026035 | Ga0207703_10704467 | Ga0207703_107044672 | 204 |
| 494 | 3300026041 | Ga0207639_10098519 | Ga0207639_100985192 | 204 |
| 495 | 3300026041 | Ga0207639_10318305 | Ga0207639_103183052 | 204 |
| 496 | 3300026075 | Ga0207708_10000451 | Ga0207708_1000045122 | 204 |
| 497 | 3300026075 | Ga0207708_10015956 | Ga0207708_100159566 | 204 |
| 498 | 3300026075 | Ga0207708_10084591 | Ga0207708_100845912 | 204 |
| 499 | 3300026075 | Ga0207708_10152389 | Ga0207708_101523892 | 204 |
| 500 | 3300026075 | Ga0207708_10182809 | Ga0207708_101828093 | 204 |
| 501 | 3300026075 | Ga0207708_10210666 | Ga0207708_102106662 | 204 |
| 502 | 3300026078 | Ga0207702_10178909 | Ga0207702_101789092 | 204 |
| 503 | 3300026078 | Ga0207702_10312875 | Ga0207702_103128752 | 204 |
| 504 | 3300026088 | Ga0207641_10004844 | Ga0207641_100048444 | 204 |
| 505 | 3300026088 | Ga0207641_10164194 | Ga0207641_101641943 | 204 |
| 506 | 3300026089 | Ga0207648_10000245 | Ga0207648_1000024517 | 204 |
| 507 | 3300026089 | Ga0207648_10001462 | Ga0207648_1000146213 | 204 |
| 508 | 3300026089 | Ga0207648_10001948 | Ga0207648_1000194829 | 204 |
| 509 | 3300026095 | Ga0207676_10004835 | Ga0207676_100048355 | 204 |
| 510 | 3300026095 | Ga0207676_10089139 | Ga0207676_100891392 | 204 |
| 511 | 3300026116 | Ga0207674_10573581 | Ga0207674_105735812 | 204 |
| 512 | 3300026116 | Ga0207674_10661770 | Ga0207674_106617702 | 204 |
| 513 | 3300026118 | Ga0207675_100001447 | Ga0207675_10000144717 | 204 |
| 514 | 3300026118 | Ga0207675_100001475 | Ga0207675_10000147525 | 204 |
| 515 | 3300026118 | Ga0207675_100023625 | Ga0207675_1000236254 | 204 |
| 516 | 3300026118 | Ga0207675_100053681 | Ga0207675_1000536813 | 204 |
| 517 | 3300026118 | Ga0207675_100325628 | Ga0207675_1003256283 | 204 |
| 518 | 3300026121 | Ga0207683_10021770 | Ga0207683_100217702 | 204 |
| 519 | 3300026121 | Ga0207683_10472796 | Ga0207683_104727961 | 204 |
| 520 | 3300026142 | Ga0207698_10095027 | Ga0207698_100950274 | 204 |
| 521 | 3300026142 | Ga0207698_10157694 | Ga0207698_101576942 | 204 |
| 522 | 3300027364 | Ga0209967_1004895 | Ga0209967_10048952 | 204 |
| 523 | 3300027462 | Ga0210000_1004416 | Ga0210000_10044163 | 204 |
| 524 | 3300027462 | Ga0210000_1004622 | Ga0210000_10046222 | 204 |
| 525 | 3300027543 | Ga0209999_1002327 | Ga0209999_10023273 | 204 |
| 526 | 3300027543 | Ga0209999_1047153 | Ga0209999_10471531 | 204 |
| 527 | 3300027876 | Ga0209974_10032126 | Ga0209974_100321263 | 204 |
| 528 | 3300027907 | Ga0207428_10004232 | Ga0207428_100042322 | 204 |
| 529 | 3300027907 | Ga0207428_10022897 | Ga0207428_100228976 | 204 |
| 530 | 3300027907 | Ga0207428_10035347 | Ga0207428_100353473 | 204 |
| 531 | 3300027907 | Ga0207428_10210576 | Ga0207428_102105763 | 204 |
| 532 | 3300028380 | Ga0268265_10000627 | Ga0268265_1000062711 | 204 |
| 533 | 3300028380 | Ga0268265_10004164 | Ga0268265_100041649 | 204 |
| 534 | 3300028380 | Ga0268265_10053870 | Ga0268265_100538701 | 204 |
| 535 | 3300028380 | Ga0268265_10105537 | Ga0268265_101055372 | 204 |
| 536 | 3300028380 | Ga0268265_10397766 | Ga0268265_103977662 | 204 |
| 537 | 3300028380 | Ga0268265_10404334 | Ga0268265_104043342 | 204 |
| 538 | 3300028380 | Ga0268265_10932691 | Ga0268265_109326911 | 204 |
| 539 | 3300028381 | Ga0268264_10003335 | Ga0268264_100033359 | 204 |
| 540 | 3300028381 | Ga0268264_10007307 | Ga0268264_1000730719 | 204 |
| 541 | 3300028381 | Ga0268264_10118738 | Ga0268264_101187383 | 204 |
| 542 | 3300034819 | Ga0373958_0003458 | Ga0373958_0003458_547_1161 | 204 |
| 543 | 3300035089 | Ga0373944_0003060 | Ga0373944_0003060_760_1377 | 204 |
| 544 | 3300035092 | Ga0373952_0006344 | Ga0373952_0006344_358_972 | 204 |
| 545 | 3300035111 | Ga0373923_0086627 | Ga0373923_0086627_456_1073 | 204 |
| 546 | 3300035112 | Ga0373932_0002139 | Ga0373932_0002139_3004_3618 | 204 |
| 547 | 3300035112 | Ga0373932_0030359 | Ga0373932_0030359_461_1075 | 204 |
| 548 | 3300035113 | Ga0373936_0022250 | Ga0373936_0022250_280_897 | 204 |
| 549 | 3300035114 | Ga0373939_0040560 | Ga0373939_0040560_126_788 | 204 |
| 550 | 3300035114 | Ga0373939_0074281 | Ga0373939_0074281_417_1031 | 204 |
| 551 | 3300035114 | Ga0373939_0113772 | Ga0373939_0113772_312_926 | 204 |
| 552 | 3300035115 | Ga0373941_0027364 | Ga0373941_0027364_427_1089 | 204 |
| 553 | 3300035115 | Ga0373941_0078473 | Ga0373941_0078473_229_843 | 204 |
| 554 | 3300035118 | Ga0373954_0000032 | Ga0373954_0000032_15913_16530 | 204 |
| 555 | 3300035119 | Ga0373956_0060881 | Ga0373956_0060881_419_1036 | 204 |
| 556 | 3300035121 | Ga0373960_0072352 | Ga0373960_0072352_85_699 | 204 |
| 557 | 3300035121 | Ga0373960_0091159 | Ga0373960_0091159_198_812 | 204 |
| 558 | 3300035170 | Ga0373943_0015453 | Ga0373943_0015453_2202_2816 | 204 |
| 559 | 3300035171 | Ga0373946_0004376 | Ga0373946_0004376_4406_5020 | 204 |
| 560 | 3300035172 | Ga0373955_0082820 | Ga0373955_0082820_481_1098 | 204 |
| 561 | 3300035241 | Ga0373961_0108783 | Ga0373961_0108783_262_876 | 204 |
| 562 | 3300035410 | Ga0373924_0024984 | Ga0373924_0024984_91_708 | 204 |
| 563 | 3300035691 | Ga0373931_0008988 | Ga0373931_0008988_2877_3491 | 204 |
| 564 | 3300035691 | Ga0373931_0159154 | Ga0373931_0159154_299_913 | 204 |
| 565 | 3300035691 | Ga0373931_0372671 | Ga0373931_0372671_190_852 | 204 |
| 566 | 3300035692 | Ga0373935_0024504 | Ga0373935_0024504_2518_3135 | 204 |
| 567 | 3300035695 | Ga0373927_0007300 | Ga0373927_0007300_5783_6400 | 204 |
| 568 | 3300035724 | Ga0373933_0007401 | Ga0373933_0007401_1491_2108 | 204 |
| 569 | 3300035725 | Ga0373947_0024500 | Ga0373947_0024500_1843_2460 | 204 |
| 570 | 3300036401 | Ga0373937_0006288 | Ga0373937_0006288_5093_5710 | 204 |
| 571 | 3300037068 | Ga0373925_0231515 | Ga0373925_0231515_281_895 | 204 |
| 572 | 3300037068 | Ga0373925_0345946 | Ga0373925_0345946_309_926 | 204 |
| 573 | 3300041486 | Ga0451807_1967121 | Ga0451807_1967121_1527_2189 | 204 |
| 574 | 3300042013 | Ga0439456_033300 | Ga0439456_033300_262_876 | 204 |
| 575 | 3300042435 | Ga0439434_0002357 | Ga0439434_0002357_3089_3703 | 204 |
| 576 | 3300042436 | Ga0439435_0000676 | Ga0439435_0000676_3498_4112 | 204 |
| 577 | 3300042876 | Ga0451577_0197282 | Ga0451577_0197282_1096_1710 | 204 |
| 578 | 3300045051 | Ga0451576_0003473 | Ga0451576_0003473_20453_21067 | 204 |
| 579 | 3300045051 | Ga0451576_0049688 | Ga0451576_0049688_2877_3491 | 204 |
| 580 | 3300045051 | Ga0451576_0530937 | Ga0451576_0530937_158_772 | 204 |
| 581 | 3300046455 | Ga0495603_0000212 | Ga0495603_0000212_27647_28264 | 204 |
| 582 | 3300046462 | Ga0495651_0158507 | Ga0495651_0158507_473_1096 | 204 |
| 583 | 3300046472 | Ga0495580_0000358 | Ga0495580_0000358_5693_6310 | 204 |
| 584 | 3300046475 | Ga0495639_0015755 | Ga0495639_0015755_1084_1701 | 204 |
| 585 | 3300046499 | Ga0495594_0123671 | Ga0495594_0123671_119_736 | 204 |
| 586 | 3300046516 | Ga0495628_0470421 | Ga0495628_0470421_106_729 | 204 |
| 587 | 3300046517 | Ga0495630_0046809 | Ga0495630_0046809_2239_2856 | 204 |
| 588 | 3300046526 | Ga0495666_0004532 | Ga0495666_0004532_5071_5688 | 204 |
| 589 | 3300046535 | Ga0495586_0003782 | Ga0495586_0003782_6379_6996 | 204 |
| 590 | 3300046537 | Ga0495598_0108243 | Ga0495598_0108243_80_694 | 204 |
| 591 | 3300046681 | Ga0495647_0000273 | Ga0495647_0000273_6598_7215 | 204 |
| 592 | 3300046683 | Ga0495658_0000620 | Ga0495658_0000620_8178_8795 | 204 |
| 593 | 3300047315 | Ga0495581_0020108 | Ga0495581_0020108_997_1614 | 204 |
| 594 | 3300049568 | Ga0501031_0568009 | Ga0501031_0568009_11_631 | 204 |
| 595 | 3300049570 | Ga0501033_0302959 | Ga0501033_0302959_317_949 | 204 |
| 596 | 3300049574 | Ga0501038_0210273 | Ga0501038_0210273_926_1543 | 204 |
| 597 | 3300049577 | Ga0501041_0118273 | Ga0501041_0118273_61_693 | 204 |
| 598 | 3300049578 | Ga0501042_0126504 | Ga0501042_0126504_466_1083 | 204 |
| 599 | 3300049583 | Ga0501067_0506835 | Ga0501067_0506835_49_663 | 204 |
| 600 | 3300049585 | Ga0501069_0061323 | Ga0501069_0061323_786_1400 | 204 |
| 601 | 3300049587 | Ga0501071_0557572 | Ga0501071_0557572_175_792 | 204 |
| 602 | 3300049588 | Ga0501072_0047052 | Ga0501072_0047052_2062_2679 | 204 |
| 603 | 3300049588 | Ga0501072_0060729 | Ga0501072_0060729_946_1578 | 204 |
| 604 | 3300049588 | Ga0501072_0767351 | Ga0501072_0767351_131_745 | 204 |
| 605 | 3300049779 | Ga0501283_034324 | Ga0501283_034324_111_728 | 204 |
| 606 | 3300049824 | Ga0501045_0574747 | Ga0501045_0574747_104_721 | 204 |
| 607 | 3300050507 | nmdc:mga05p37_5151_c1 | nmdc:mga05p37_5151_c1_3321_3935 | 204 |
| 608 | 3300050508 | nmdc:mga09592_111078_c1 | nmdc:mga09592_111078_c1_1050_1664 | 204 |
| 609 | 3300050508 | nmdc:mga09592_5031_c1 | nmdc:mga09592_5031_c1_3130_3744 | 204 |
| 610 | 3300050508 | nmdc:mga09592_66735_c1 | nmdc:mga09592_66735_c1_2220_2837 | 204 |
| 611 | 3300050509 | nmdc:mga0qj67_188814_c1 | nmdc:mga0qj67_188814_c1_174_791 | 204 |
| 612 | 3300050509 | nmdc:mga0qj67_309704_c1 | nmdc:mga0qj67_309704_c1_69_683 | 204 |
| 613 | 3300050509 | nmdc:mga0qj67_416279_c1 | nmdc:mga0qj67_416279_c1_249_863 | 204 |
| 614 | 3300050510 | nmdc:mga06r32_106764_c1 | nmdc:mga06r32_106764_c1_1864_2481 | 204 |
| 615 | 3300050510 | nmdc:mga06r32_190120_c1 | nmdc:mga06r32_190120_c1_167_781 | 204 |
| 616 | 3300050510 | nmdc:mga06r32_232898_c1 | nmdc:mga06r32_232898_c1_395_1018 | 204 |
| 617 | 3300050511 | nmdc:mga08y16_18790_c1 | nmdc:mga08y16_18790_c1_6654_7268 | 204 |
| 618 | 3300050511 | nmdc:mga08y16_33511_c1 | nmdc:mga08y16_33511_c1_3450_4064 | 204 |
| 619 | 3300050511 | nmdc:mga08y16_427085_c1 | nmdc:mga08y16_427085_c1_715_1329 | 204 |
| 620 | 3300050511 | nmdc:mga08y16_56264_c1 | nmdc:mga08y16_56264_c1_3474_4091 | 204 |
| 621 | 3300050511 | nmdc:mga08y16_69948_c1 | nmdc:mga08y16_69948_c1_2135_2749 | 204 |
| 622 | 3300050512 | nmdc:mga0n895_201043_c1 | nmdc:mga0n895_201043_c1_574_1188 | 204 |
| 623 | 3300050512 | nmdc:mga0n895_78559_c1 | nmdc:mga0n895_78559_c1_2622_3236 | 204 |
| 624 | 3300050513 | nmdc:mga0rr50_113866_c1 | nmdc:mga0rr50_113866_c1_91_708 | 204 |
| 625 | 3300050513 | nmdc:mga0rr50_381_c1 | nmdc:mga0rr50_381_c1_14528_15142 | 204 |
| 626 | 3300050514 | nmdc:mga08x19_21885_c1 | nmdc:mga08x19_21885_c1_2085_2702 | 204 |
| 627 | 3300050514 | nmdc:mga08x19_2762_c1 | nmdc:mga08x19_2762_c1_6356_6970 | 204 |
| 628 | 3300050514 | nmdc:mga08x19_37850_c1 | nmdc:mga08x19_37850_c1_207_824 | 204 |
| 629 | 3300050514 | nmdc:mga08x19_4927_c2 | nmdc:mga08x19_4927_c2_4034_4648 | 204 |
| 630 | 3300050515 | nmdc:mga0a205_93_c2 | nmdc:mga0a205_93_c2_13595_14209 | 204 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5vcp-assembly1.cif.gz_A | crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin | 0.954 | 4 | 165 |
| 5vcp-assembly2.cif.gz_B | crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin | 0.9539 | 4 | 165 |
| 5vcp-assembly2.cif.gz_D | crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin | 0.9528 | 2 | 165 |
| 5kob-assembly2.cif.gz_D | crystal structure of a peptide deformylase from burkholderia xenovorans | 0.9513 | 4 | 167 |
| 5vcp-assembly1.cif.gz_C | crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin | 0.9484 | 4 | 171 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5vcpA00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.954 | 4 | 165 | 3.90.45.10 |
| af_Q2G265_1_160_3.90.45.10 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9344 | 1 | 159 | 3.90.45.10 |
| 1ws1A00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9327 | 1 | 158 | 3.90.45.10 |
| 4je6A00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9234 | 2 | 169 | 3.90.45.10 |
| 5mtdB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9222 | 4 | 152 | 3.90.45.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P2FFK4-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9771 | 1 | 168 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A2E4X5C6-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9693 | 1 | 196 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A380T935-F1-model_v4 | Peptide deformylase 2 (EC 3.5.1.88) | 0.9659 | 1 | 168 |
GO:0042586
GO:0043686 |
| AF-A0A1G6WQC2-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9654 | 1 | 165 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A3C2DWQ1-F1-model_v4 | Peptide deformylase (EC 3.5.1.88) | 0.9652 | 1 | 132 |
GO:0042586
GO:0043686 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar