F470838

General Info

Members Datasets Scaffolds Average Seq Length
630 288 630 203

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_10161441|Ga0207708_101614413
Length 198
Sequence MAIRKVARLGHPVLRQRAEEVPETEISSPRVQGIIEDLLVTMVEYDGAGLAAPQIHESVRIAVLVLDEQTDPHIWINPVITPIGDEMISSYEGCLSVPGLRGAVARHAEIEVDAVDRTGRPLHFHLKGFPAIVAQHECDHLDGVLFPQRMTDLTLLAYNDEPGPLAREVHENPDGIDPLFIDLVERWPGRGRWFPGKS

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
174 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
175 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
178 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
180 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
184 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
189 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
201 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
202 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
203 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
204 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
205 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
206 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
207 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
214 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
215 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
216 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
217 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
218 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
225 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
226 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
227 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
228 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
229 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
234 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
261 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
262 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
266 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
267 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
268 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
271 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
272 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
273 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.79
Rhizosphere 99.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10036712 3300003203 Bacteria 1775
2 Ga0065707_10082232 3300005295 Bacteria 18627
3 Ga0065707_10140127 3300005295 Bacteria 1771
4 Ga0070658_10106268 3300005327 Bacteria 2322
5 Ga0070676_10001054 3300005328 Bacteria 13725
6 Ga0070683_100009336 3300005329 Bacteria 8383
7 Ga0070683_100072418 3300005329 Bacteria 3216
8 Ga0070690_100000289 3300005330 Bacteria 25771
9 Ga0070690_100008257 3300005330 Bacteria 5989
10 Ga0070690_100010634 3300005330 Bacteria 5361
11 Ga0070690_100395550 3300005330 Unclassified 1014
12 Ga0070690_100840140 3300005330 Bacteria 715
13 Ga0070677_10018848 3300005333 Bacteria 2492
14 Ga0070677_10142766 3300005333 Bacteria 1106
15 Ga0068869_100000299 3300005334 Bacteria 26389
16 Ga0068869_100000782 3300005334 Bacteria 18135
17 Ga0068869_100186958 3300005334 Bacteria 1627
18 Ga0070666_10001388 3300005335 Bacteria 14648
19 Ga0070666_10025570 3300005335 Bacteria 3849
20 Ga0070666_10097599 3300005335 Bacteria 2023
21 Ga0070680_100007424 3300005336 Bacteria 8367
22 Ga0070680_100118235 3300005336 Bacteria 2211
23 Ga0070680_100401851 3300005336 Bacteria 1168
24 Ga0070680_100607685 3300005336 Bacteria 939
25 Ga0068868_100000531 3300005338 Bacteria 25572
26 Ga0068868_100024328 3300005338 Bacteria 4595
27 Ga0070689_100190308 3300005340 Bacteria 1671
28 Ga0070689_100202158 3300005340 Bacteria 1623
29 Ga0070689_100611661 3300005340 Bacteria 945
30 Ga0070691_10050732 3300005341 Bacteria 1980
31 Ga0070691_10154485 3300005341 Bacteria 1179
32 Ga0070687_100000355 3300005343 Bacteria 15578
33 Ga0070687_100000403 3300005343 Bacteria 14616
34 Ga0070687_100265429 3300005343 Unclassified 1073
35 Ga0070687_100410856 3300005343 Bacteria 890
36 Ga0070661_100200273 3300005344 Bacteria 1525
37 Ga0070692_10002606 3300005345 Bacteria 7035
38 Ga0070692_10021627 3300005345 Bacteria 3131
39 Ga0070692_10145540 3300005345 Unclassified 1345
40 Ga0070692_10408477 3300005345 Unclassified 859
41 Ga0070692_10584384 3300005345 Unclassified 737
42 Ga0070668_100000682 3300005347 Bacteria 23141
43 Ga0070668_100015073 3300005347 Bacteria 5775
44 Ga0070669_100001513 3300005353 Bacteria 16797
45 Ga0070669_100015151 3300005353 Bacteria 5492
46 Ga0070675_100016038 3300005354 Bacteria 5938
47 Ga0070675_100073810 3300005354 Bacteria 2833
48 Ga0070671_100006885 3300005355 Bacteria 9104
49 Ga0070671_101096191 3300005355 Bacteria 699
50 Ga0070674_100018912 3300005356 Bacteria 4365
51 Ga0070673_100074393 3300005364 Bacteria 2738
52 Ga0070673_101180577 3300005364 Bacteria 717
53 Ga0070688_100132976 3300005365 Bacteria 1681
54 Ga0070688_100177189 3300005365 Bacteria 1476
55 Ga0070659_100007009 3300005366 Bacteria 8162
56 Ga0070659_100429031 3300005366 Bacteria 1119
57 Ga0070667_100007737 3300005367 Bacteria 8909
58 Ga0070667_100260245 3300005367 Bacteria 1553
59 Ga0070667_100584965 3300005367 Bacteria 1028
60 Ga0070703_10014022 3300005406 Bacteria 2279
61 Ga0070709_10110900 3300005434 Bacteria 1844
62 Ga0070714_100085824 3300005435 Bacteria 2750
63 Ga0070710_10026915 3300005437 Bacteria 3062
64 Ga0070701_10000387 3300005438 Bacteria 14831
65 Ga0070711_100452062 3300005439 Bacteria 1052
66 Ga0070711_100589699 3300005439 Bacteria 926
67 Ga0070705_100000472 3300005440 Bacteria 23179
68 Ga0070705_100021219 3300005440 Bacteria 3452
69 Ga0070705_100082742 3300005440 Bacteria 1976
70 Ga0070705_100313315 3300005440 Bacteria 1130
71 Ga0070700_100002641 3300005441 Bacteria 9172
72 Ga0070700_100041008 3300005441 Bacteria 2836
73 Ga0070700_100076914 3300005441 Unclassified 2145
74 Ga0070700_100384540 3300005441 Bacteria 1051
75 Ga0070694_100000249 3300005444 Bacteria 28513
76 Ga0070694_100002755 3300005444 Bacteria 10423
77 Ga0070694_100032351 3300005444 Bacteria 3435
78 Ga0070694_100096109 3300005444 Bacteria 2088
79 Ga0070694_100103234 3300005444 Bacteria 2020
80 Ga0070694_100413170 3300005444 Bacteria 1059
81 Ga0070694_100576624 3300005444 Bacteria 903
82 Ga0070708_100071153 3300005445 Bacteria 3131
83 Ga0070708_100874873 3300005445 Bacteria 844
84 Ga0070663_100043422 3300005455 Bacteria 3164
85 Ga0070678_100016206 3300005456 Bacteria 4760
86 Ga0070662_100034124 3300005457 Bacteria 3586
87 Ga0070662_100150582 3300005457 Bacteria 1811
88 Ga0070662_100282450 3300005457 Unclassified 1344
89 Ga0070662_100333996 3300005457 Bacteria 1239
90 Ga0070681_10492617 3300005458 Bacteria 1139
91 Ga0068867_100000430 3300005459 Bacteria 28048
92 Ga0068867_100002651 3300005459 Bacteria 12626
93 Ga0070706_100163026 3300005467 Bacteria 2082
94 Ga0070698_100829766 3300005471 Unclassified 869
95 Ga0070699_100093706 3300005518 Bacteria 2628
96 Ga0070679_100089258 3300005530 Bacteria 3070
97 Ga0070679_100332692 3300005530 Bacteria 1467
98 Ga0070684_100026670 3300005535 Bacteria 4869
99 Ga0070697_100001293 3300005536 Bacteria 18848
100 Ga0070697_100997659 3300005536 Bacteria 744
101 Ga0068853_100270386 3300005539 Unclassified 1565
102 Ga0068853_100297181 3300005539 Bacteria 1492
103 Ga0070672_100001295 3300005543 Bacteria 15400
104 Ga0070672_100063248 3300005543 Bacteria 2922
105 Ga0070672_100184813 3300005543 Bacteria 1738
106 Ga0070672_100430916 3300005543 Unclassified 1134
107 Ga0070686_100000392 3300005544 Bacteria 27736
108 Ga0070686_100034552 3300005544 Bacteria 3116
109 Ga0070686_100596758 3300005544 Unclassified 870
110 Ga0070695_100000185 3300005545 Bacteria 29879
111 Ga0070695_100495729 3300005545 Bacteria 944
112 Ga0070696_100000519 3300005546 Bacteria 24408
113 Ga0070696_100002012 3300005546 Bacteria 13331
114 Ga0070696_100018323 3300005546 Bacteria 4731
115 Ga0070696_100104966 3300005546 Bacteria 2029
116 Ga0070696_100444546 3300005546 Bacteria 1022
117 Ga0070696_100646344 3300005546 Bacteria 857
118 Ga0070693_100000135 3300005547 Bacteria 33350
119 Ga0070693_100257096 3300005547 Bacteria 1160
120 Ga0070693_100326404 3300005547 Unclassified 1043
121 Ga0070704_100000108 3300005549 Bacteria 28920
122 Ga0070704_100083896 3300005549 Bacteria 2353
123 Ga0070704_100086465 3300005549 Bacteria 2324
124 Ga0070704_100193204 3300005549 Unclassified 1638
125 Ga0070704_100481566 3300005549 Bacteria 1074
126 Ga0068855_100002231 3300005563 Bacteria 23944
127 Ga0070664_100056977 3300005564 Bacteria 3321
128 Ga0068857_100645306 3300005577 Bacteria 1003
129 Ga0068857_100737021 3300005577 Bacteria 938
130 Ga0068854_100006272 3300005578 Bacteria 7557
131 Ga0068856_100013516 3300005614 Bacteria 7903
132 Ga0068856_100086145 3300005614 Bacteria 3121
133 Ga0068856_100109958 3300005614 Bacteria 2753
134 Ga0068856_100158041 3300005614 Bacteria 2277
135 Ga0070702_100000557 3300005615 Bacteria 13590
136 Ga0070702_100076821 3300005615 Unclassified 1989
137 Ga0068852_100018182 3300005616 Bacteria 5534
138 Ga0068852_100277055 3300005616 Bacteria 1616
139 Ga0068852_100738304 3300005616 Bacteria 996
140 Ga0068859_100001399 3300005617 Bacteria 24477
141 Ga0068859_100090027 3300005617 Bacteria 3119
142 Ga0068859_100112847 3300005617 Bacteria 2781
143 Ga0068864_100039636 3300005618 Bacteria 4026
144 Ga0068864_100272380 3300005618 Bacteria 1578
145 Ga0068864_100452285 3300005618 Bacteria 1228
146 Ga0068866_10001478 3300005718 Bacteria 10015
147 Ga0068866_10002633 3300005718 Bacteria 7421
148 Ga0068861_100001038 3300005719 Bacteria 17033
149 Ga0068861_100001358 3300005719 Bacteria 15388
150 Ga0068861_100010298 3300005719 Bacteria 6488
151 Ga0068861_100074216 3300005719 Bacteria 2644
152 Ga0068861_100752008 3300005719 Bacteria 911
153 Ga0068851_10014733 3300005834 Bacteria 3716
154 Ga0068870_10149137 3300005840 Bacteria 1376
155 Ga0068863_100001611 3300005841 Bacteria 22315
156 Ga0068863_100125147 3300005841 Bacteria 2452
157 Ga0068863_100138342 3300005841 Bacteria 2327
158 Ga0068863_100910362 3300005841 Bacteria 880
159 Ga0068858_100003840 3300005842 Bacteria 14854
160 Ga0068858_100593837 3300005842 Bacteria 1074
161 Ga0068860_100001826 3300005843 Bacteria 22678
162 Ga0068860_100002413 3300005843 Bacteria 19606
163 Ga0068860_100030311 3300005843 Bacteria 5203
164 Ga0068862_100001204 3300005844 Bacteria 24408
165 Ga0068862_100003042 3300005844 Bacteria 14608
166 Ga0068862_100017851 3300005844 Bacteria 5907
167 Ga0068862_100070394 3300005844 Bacteria 3020
168 Ga0068862_100093124 3300005844 Bacteria 2627
169 Ga0068862_100141810 3300005844 Unclassified 2133
170 Ga0068862_100273829 3300005844 Bacteria 1545
171 Ga0081539_10000462 3300005985 Bacteria 86060
172 Ga0070716_100290864 3300006173 Bacteria 1132
173 Ga0097621_100001049 3300006237 Bacteria 19393
174 Ga0097621_100004130 3300006237 Bacteria 10069
175 Ga0097621_100282111 3300006237 Unclassified 1462
176 Ga0097621_100388660 3300006237 Bacteria 1247
177 Ga0068871_100000370 3300006358 Bacteria 31403
178 Ga0068871_100004173 3300006358 Bacteria 10001
179 Ga0068871_100561979 3300006358 Archaea 1034
180 Ga0075428_100000993 3300006844 Bacteria 30002
181 Ga0075428_100066543 3300006844 Bacteria 3945
182 Ga0075428_100243377 3300006844 Bacteria 1940
183 Ga0075428_100503100 3300006844 Bacteria 1296
184 Ga0075430_100002561 3300006846 Bacteria 15154
185 Ga0075430_100563165 3300006846 Bacteria 940
186 Ga0075430_100809367 3300006846 Unclassified 772
187 Ga0075431_100267579 3300006847 Bacteria 1733
188 Ga0075433_10007872 3300006852 Bacteria 8476
189 Ga0075433_10061416 3300006852 Bacteria 3292
190 Ga0075433_10146936 3300006852 Bacteria 2096
191 Ga0075433_10292049 3300006852 Bacteria 1444
192 Ga0075434_100003359 3300006871 Bacteria 14318
193 Ga0075434_100030678 3300006871 Bacteria 5295
194 Ga0075434_100211253 3300006871 Bacteria 1961
195 Ga0075434_100830456 3300006871 Bacteria 940
196 Ga0075434_101068199 3300006871 Bacteria 821
197 Ga0075429_100000003 3300006880 Bacteria 130377
198 Ga0075429_100002816 3300006880 Bacteria 14713
199 Ga0075429_100029199 3300006880 Bacteria 4789
200 Ga0075429_100177510 3300006880 Bacteria 1866
201 Ga0075429_100562320 3300006880 Bacteria 999
202 Ga0068865_100000283 3300006881 Bacteria 27881
203 Ga0068865_100000599 3300006881 Bacteria 20236
204 Ga0068865_100521630 3300006881 Bacteria 994
205 Ga0075436_100001687 3300006914 Bacteria 15098
206 Ga0075436_100026392 3300006914 Bacteria 4000
207 Ga0075436_100116709 3300006914 Unclassified 1865
208 Ga0097620_100001399 3300006931 Bacteria 24477
209 Ga0097620_100090025 3300006931 Bacteria 3119
210 Ga0097620_100112848 3300006931 Bacteria 2781
211 Ga0075435_100001908 3300007076 Bacteria 13571
212 Ga0075435_100045483 3300007076 Bacteria 3519
213 Ga0075435_100281364 3300007076 Bacteria 1420
214 Ga0075435_100418794 3300007076 Bacteria 1153
215 Ga0075435_100645168 3300007076 Bacteria 919
216 Ga0099794_10009654 3300007265 Bacteria 4070
217 Ga0105250_10019097 3300009092 Bacteria 2771
218 Ga0105240_11287381 3300009093 Bacteria 771
219 Ga0111539_10023346 3300009094 Bacteria 7599
220 Ga0111539_10027656 3300009094 Bacteria 6928
221 Ga0111539_10065980 3300009094 Bacteria 4275
222 Ga0111539_10125633 3300009094 Bacteria 3006
223 Ga0111539_10131849 3300009094 Bacteria 2926
224 Ga0111539_10203580 3300009094 Bacteria 2308
225 Ga0111539_10304718 3300009094 Bacteria 1854
226 Ga0111539_11679898 3300009094 Unclassified 736
227 Ga0105245_10001066 3300009098 Bacteria 24858
228 Ga0105245_10012082 3300009098 Bacteria 7509
229 Ga0114129_10001138 3300009147 Bacteria 35164
230 Ga0114129_10005359 3300009147 Bacteria 18104
231 Ga0114129_10318058 3300009147 Bacteria 2070
232 Ga0114129_10651601 3300009147 Bacteria 1359
233 Ga0105243_10000708 3300009148 Bacteria 32162
234 Ga0105243_10002376 3300009148 Bacteria 15759
235 Ga0105243_10011238 3300009148 Bacteria 6773
236 Ga0105243_10067067 3300009148 Bacteria 2888
237 Ga0105241_10010132 3300009174 Bacteria 6919
238 Ga0105241_10015810 3300009174 Bacteria 5529
239 Ga0105242_10001614 3300009176 Bacteria 17755
240 Ga0105242_10003692 3300009176 Bacteria 11916
241 Ga0105242_10150666 3300009176 Bacteria 2028
242 Ga0105248_10002161 3300009177 Bacteria 21753
243 Ga0105248_10005188 3300009177 Bacteria 14360
244 Ga0105248_10202109 3300009177 Bacteria 2239
245 Ga0105248_10316364 3300009177 Bacteria 1758
246 Ga0105238_10815244 3300009551 Unclassified 949
247 Ga0105249_10000996 3300009553 Bacteria 25124
248 Ga0105249_10005638 3300009553 Bacteria 10832
249 Ga0105249_10092104 3300009553 Bacteria 2837
250 Ga0105249_10105216 3300009553 Bacteria 2660
251 Ga0157371_10298535 3300013102 Bacteria 1166
252 Ga0157370_10125797 3300013104 Bacteria 2392
253 Ga0157374_10303333 3300013296 Unclassified 1580
254 Ga0157378_10001153 3300013297 Bacteria 24026
255 Ga0157378_10123484 3300013297 Bacteria 2389
256 Ga0163162_10005059 3300013306 Bacteria 12702
257 Ga0163162_10107920 3300013306 Bacteria 2880
258 Ga0163162_10117859 3300013306 Bacteria 2757
259 Ga0163162_11572580 3300013306 Unclassified 750
260 Ga0157372_10959801 3300013307 Bacteria 991
261 Ga0157375_10000906 3300013308 Bacteria 25775
262 Ga0157375_10119505 3300013308 Bacteria 2743
263 Ga0157375_11304148 3300013308 Bacteria 854
264 Ga0157380_10002623 3300014326 Bacteria 12166
265 Ga0157380_10023634 3300014326 Bacteria 4639
266 Ga0157380_10049523 3300014326 Bacteria 3314
267 Ga0157380_10172289 3300014326 Bacteria 1892
268 Ga0157379_10028553 3300014968 Bacteria 4961
269 Ga0157379_10198166 3300014968 Bacteria 1815
270 Ga0157376_10069460 3300014969 Bacteria 2987
271 Ga0157376_10165442 3300014969 Bacteria 2009
272 Ga0163161_10000551 3300017792 Bacteria 30373
273 Ga0163161_10175190 3300017792 Unclassified 1642
274 Ga0206353_10563905 3300020082 Bacteria 1224
275 Ga0207697_10004623 3300025315 Bacteria 6542
276 Ga0207656_10005122 3300025321 Bacteria 4610
277 Ga0207653_10022602 3300025885 Bacteria 1999
278 Ga0207653_10142339 3300025885 Bacteria 878
279 Ga0207682_10030051 3300025893 Unclassified 2175
280 Ga0207642_10000750 3300025899 Bacteria 10038
281 Ga0207642_10022003 3300025899 Bacteria 2520
282 Ga0207680_10002557 3300025903 Bacteria 8482
283 Ga0207680_10080910 3300025903 Bacteria 2041
284 Ga0207645_10000390 3300025907 Bacteria 36191
285 Ga0207645_10011013 3300025907 Bacteria 6189
286 Ga0207645_10153332 3300025907 Bacteria 1505
287 Ga0207684_10038808 3300025910 Bacteria 4041
288 Ga0207654_10023548 3300025911 Bacteria 3300
289 Ga0207707_10021374 3300025912 Bacteria 5657
290 Ga0207707_10116193 3300025912 Bacteria 2338
291 Ga0207707_10149245 3300025912 Bacteria 2044
292 Ga0207707_10394523 3300025912 Bacteria 1189
293 Ga0207671_10063237 3300025914 Bacteria 2750
294 Ga0207660_10010154 3300025917 Bacteria 6100
295 Ga0207660_10117480 3300025917 Bacteria 2010
296 Ga0207660_10149366 3300025917 Bacteria 1794
297 Ga0207660_10237780 3300025917 Bacteria 1434
298 Ga0207660_10438416 3300025917 Bacteria 1055
299 Ga0207662_10000191 3300025918 Bacteria 28718
300 Ga0207662_10001816 3300025918 Bacteria 10480
301 Ga0207662_10234386 3300025918 Bacteria 1200
302 Ga0207662_10433685 3300025918 Bacteria 896
303 Ga0207657_10009108 3300025919 Bacteria 10013
304 Ga0207649_10011618 3300025920 Bacteria 4862
305 Ga0207652_10108716 3300025921 Bacteria 2457
306 Ga0207652_10174442 3300025921 Bacteria 1930
307 Ga0207652_10272847 3300025921 Bacteria 1525
308 Ga0207652_10804993 3300025921 Bacteria 834
309 Ga0207646_10199130 3300025922 Bacteria 1809
310 Ga0207646_10805360 3300025922 Bacteria 836
311 Ga0207681_10010837 3300025923 Bacteria 5600
312 Ga0207681_10016603 3300025923 Bacteria 4608
313 Ga0207681_10128293 3300025923 Bacteria 1871
314 Ga0207681_10424901 3300025923 Bacteria 1077
315 Ga0207659_10019827 3300025926 Bacteria 4434
316 Ga0207659_10026847 3300025926 Bacteria 3891
317 Ga0207687_10001813 3300025927 Bacteria 14697
318 Ga0207664_10029789 3300025929 Bacteria 4161
319 Ga0207644_10004980 3300025931 Bacteria 8666
320 Ga0207706_10002980 3300025933 Bacteria 16337
321 Ga0207706_10067822 3300025933 Bacteria 3140
322 Ga0207706_10122008 3300025933 Bacteria 2292
323 Ga0207706_10214488 3300025933 Bacteria 1686
324 Ga0207706_10572404 3300025933 Bacteria 971
325 Ga0207686_10001418 3300025934 Bacteria 13594
326 Ga0207686_10022309 3300025934 Bacteria 3645
327 Ga0207709_10001098 3300025935 Bacteria 19845
328 Ga0207709_10021268 3300025935 Bacteria 3671
329 Ga0207709_10073500 3300025935 Bacteria 2179
330 Ga0207709_10228264 3300025935 Bacteria 1347
331 Ga0207670_10243838 3300025936 Bacteria 1385
332 Ga0207670_10533694 3300025936 Unclassified 957
333 Ga0207670_10908467 3300025936 Unclassified 738
334 Ga0207669_10027920 3300025937 Bacteria 3097
335 Ga0207669_10392891 3300025937 Unclassified 1084
336 Ga0207704_10000409 3300025938 Bacteria 19434
337 Ga0207704_10003731 3300025938 Bacteria 6935
338 Ga0207704_10015773 3300025938 Bacteria 3861
339 Ga0207665_10530664 3300025939 Bacteria 912
340 Ga0207691_10001079 3300025940 Bacteria 27155
341 Ga0207691_10016817 3300025940 Bacteria 6943
342 Ga0207691_10095012 3300025940 Bacteria 2667
343 Ga0207691_10148924 3300025940 Bacteria 2059
344 Ga0207711_10007838 3300025941 Bacteria 8926
345 Ga0207711_10026903 3300025941 Bacteria 4828
346 Ga0207711_10063905 3300025941 Bacteria 3178
347 Ga0207689_10000921 3300025942 Bacteria 28235
348 Ga0207689_10036897 3300025942 Bacteria 4056
349 Ga0207661_10112997 3300025944 Bacteria 2300
350 Ga0207679_10148749 3300025945 Bacteria 1903
351 Ga0207667_10017372 3300025949 Bacteria 8098
352 Ga0207667_10018772 3300025949 Bacteria 7743
353 Ga0207667_10347196 3300025949 Bacteria 1513
354 Ga0207651_10109064 3300025960 Bacteria 2073
355 Ga0207651_10221178 3300025960 Unclassified 1531
356 Ga0207651_10226974 3300025960 Unclassified 1513
357 Ga0207712_10007728 3300025961 Bacteria 6798
358 Ga0207712_10117711 3300025961 Bacteria 2004
359 Ga0207712_10258394 3300025961 Bacteria 1411
360 Ga0207712_10608927 3300025961 Unclassified 946
361 Ga0207668_10002352 3300025972 Bacteria 11046
362 Ga0207668_10017408 3300025972 Bacteria 4503
363 Ga0207668_10157848 3300025972 Bacteria 1764
364 Ga0207668_10658016 3300025972 Bacteria 917
365 Ga0207640_10001592 3300025981 Bacteria 12198
366 Ga0207640_10074462 3300025981 Bacteria 2298
367 Ga0207640_10956978 3300025981 Bacteria 751
368 Ga0207658_10019716 3300025986 Bacteria 4664
369 Ga0207658_10347392 3300025986 Bacteria 1291
370 Ga0207677_10000592 3300026023 Bacteria 22464
371 Ga0207677_10056605 3300026023 Bacteria 2687
372 Ga0207703_10000937 3300026035 Bacteria 28276
373 Ga0207703_10007345 3300026035 Bacteria 8758
374 Ga0207703_10704467 3300026035 Bacteria 960
375 Ga0207639_10098519 3300026041 Bacteria 2357
376 Ga0207639_10318305 3300026041 Unclassified 1381
377 Ga0207678_10003010 3300026067 Bacteria 15242
378 Ga0207708_10000451 3300026075 Bacteria 31936
379 Ga0207708_10015956 3300026075 Bacteria 5640
380 Ga0207708_10084591 3300026075 Bacteria 2439
381 Ga0207708_10152389 3300026075 Bacteria 1821
382 Ga0207708_10161441 3300026075 Bacteria 1770
383 Ga0207708_10182809 3300026075 Unclassified 1665
384 Ga0207708_10210666 3300026075 Bacteria 1553
385 Ga0207702_10178909 3300026078 Bacteria 1951
386 Ga0207702_10312875 3300026078 Bacteria 1493
387 Ga0207641_10004844 3300026088 Bacteria 11591
388 Ga0207641_10164194 3300026088 Bacteria 2021
389 Ga0207648_10000245 3300026089 Bacteria 58564
390 Ga0207648_10001462 3300026089 Bacteria 25984
391 Ga0207648_10001948 3300026089 Bacteria 22560
392 Ga0207648_10394633 3300026089 Bacteria 1253
393 Ga0207676_10004835 3300026095 Bacteria 9549
394 Ga0207676_10089139 3300026095 Bacteria 2527
395 Ga0207674_10000956 3300026116 Bacteria 37766
396 Ga0207674_10573581 3300026116 Bacteria 1090
397 Ga0207674_10661770 3300026116 Bacteria 1008
398 Ga0207675_100001447 3300026118 Bacteria 23783
399 Ga0207675_100001475 3300026118 Bacteria 23622
400 Ga0207675_100023625 3300026118 Bacteria 5719
401 Ga0207675_100053681 3300026118 Unclassified 3760
402 Ga0207675_100325628 3300026118 Bacteria 1501
403 Ga0207683_10021770 3300026121 Bacteria 5496
404 Ga0207683_10472796 3300026121 Bacteria 1156
405 Ga0207698_10007473 3300026142 Bacteria 6846
406 Ga0207698_10095027 3300026142 Bacteria 2453
407 Ga0207698_10157694 3300026142 Bacteria 1980
408 Ga0209967_1004895 3300027364 Bacteria 1791
409 Ga0210000_1004416 3300027462 Bacteria 2033
410 Ga0210000_1004622 3300027462 Bacteria 1986
411 Ga0209968_1008484 3300027526 Bacteria 1567
412 Ga0209999_1002327 3300027543 Bacteria 3347
413 Ga0209999_1047153 3300027543 Bacteria 811
414 Ga0209974_10032126 3300027876 Bacteria 1739
415 Ga0207428_10004232 3300027907 Bacteria 13746
416 Ga0207428_10022897 3300027907 Bacteria 5264
417 Ga0207428_10035347 3300027907 Bacteria 4084
418 Ga0207428_10210576 3300027907 Bacteria 1460
419 Ga0268265_10000627 3300028380 Bacteria 35202
420 Ga0268265_10004164 3300028380 Bacteria 10135
421 Ga0268265_10053870 3300028380 Bacteria 3049
422 Ga0268265_10105537 3300028380 Bacteria 2286
423 Ga0268265_10397766 3300028380 Bacteria 1272
424 Ga0268265_10404334 3300028380 Bacteria 1263
425 Ga0268265_10932691 3300028380 Bacteria 854
426 Ga0268264_10003335 3300028381 Bacteria 13874
427 Ga0268264_10007307 3300028381 Bacteria 9238
428 Ga0268264_10118738 3300028381 Bacteria 2328
429 Ga0307410_10367056 3300031852 Bacteria 1155
430 Ga0307416_100115903 3300032002 Bacteria 2374
431 Ga0307415_100514897 3300032126 Bacteria 1049
432 Ga0373958_0003458 3300034819 Bacteria 2278
433 Ga0373944_0003060 3300035089 Bacteria 4298
434 Ga0373952_0006344 3300035092 Bacteria 2182
435 Ga0373923_0086627 3300035111 Bacteria 1365
436 Ga0373932_0002139 3300035112 Bacteria 5133
437 Ga0373932_0030359 3300035112 Bacteria 1497
438 Ga0373936_0022250 3300035113 Bacteria 2468
439 Ga0373939_0040560 3300035114 Bacteria 1399
440 Ga0373939_0074281 3300035114 Bacteria 1115
441 Ga0373939_0113772 3300035114 Bacteria 946
442 Ga0373941_0027364 3300035115 Bacteria 1664
443 Ga0373941_0078473 3300035115 Bacteria 1110
444 Ga0373954_0000032 3300035118 Bacteria 54647
445 Ga0373956_0021330 3300035119 Bacteria 2764
446 Ga0373956_0060881 3300035119 Bacteria 1710
447 Ga0373957_0015053 3300035120 Bacteria 2655
448 Ga0373960_0072352 3300035121 Bacteria 1069
449 Ga0373960_0091159 3300035121 Bacteria 974
450 Ga0373943_0015453 3300035170 Bacteria 3467
451 Ga0373946_0004376 3300035171 Bacteria 5059
452 Ga0373955_0058778 3300035172 Bacteria 2116
453 Ga0373955_0082820 3300035172 Bacteria 1816
454 Ga0373961_0108783 3300035241 Bacteria 906
455 Ga0373924_0002130 3300035410 Bacteria 6621
456 Ga0373924_0024984 3300035410 Bacteria 2359
457 Ga0373931_0008988 3300035691 Bacteria 4763
458 Ga0373931_0159154 3300035691 Bacteria 1322
459 Ga0373931_0372671 3300035691 Bacteria 898
460 Ga0373935_0024504 3300035692 Bacteria 3714
461 Ga0373927_0007300 3300035695 Bacteria 7492
462 Ga0373927_0109431 3300035695 Bacteria 1800
463 Ga0373933_0007401 3300035724 Bacteria 5987
464 Ga0373933_0014146 3300035724 Bacteria 4431
465 Ga0373947_0024500 3300035725 Bacteria 3516
466 Ga0373947_0074559 3300035725 Bacteria 2088
467 Ga0373937_0006288 3300036401 Bacteria 10240
468 Ga0373937_0017415 3300036401 Bacteria 6400
469 Ga0373937_0103509 3300036401 Bacteria 2644
470 Ga0373925_0000920 3300037068 Bacteria 26852
471 Ga0373925_0231515 3300037068 Bacteria 1477
472 Ga0373925_0345946 3300037068 Bacteria 1206
473 Ga0395900_0189368 3300037418 Bacteria 2088
474 Ga0395905_0197937 3300037471 Bacteria 1884
475 Ga0395901_0028910 3300038443 Bacteria 5703
476 Ga0451807_1967121 3300041486 Bacteria 3599
477 Ga0439443_002918 3300042003 Bacteria 2102
478 Ga0439456_033300 3300042013 Bacteria 1108
479 Ga0439446_0024779 3300042156 Bacteria 1713
480 Ga0439434_0002357 3300042435 Bacteria 5495
481 Ga0439435_0000277 3300042436 Bacteria 7580
482 Ga0439435_0000676 3300042436 Bacteria 5657
483 Ga0439435_0001802 3300042436 Bacteria 4086
484 Ga0439435_0121908 3300042436 Bacteria 817
485 Ga0439444_0003955 3300042437 Bacteria 2122
486 Ga0439460_0000454 3300042461 Bacteria 8823
487 Ga0451577_0197282 3300042876 Unclassified 1817
488 Ga0453684_0235436 3300044712 Bacteria 2111
489 Ga0451576_0003473 3300045051 Bacteria 21579
490 Ga0451576_0049688 3300045051 Bacteria 4401
491 Ga0451576_0530937 3300045051 Bacteria 1236
492 Ga0451576_0834465 3300045051 Bacteria 967
493 Ga0495592_0014466 3300046454 Bacteria 5988
494 Ga0495603_0000212 3300046455 Bacteria 30148
495 Ga0495641_0063311 3300046461 Bacteria 1667
496 Ga0495651_0158507 3300046462 Bacteria 1624
497 Ga0495580_0000358 3300046472 Bacteria 37269
498 Ga0495639_0015755 3300046475 Bacteria 3278
499 Ga0495662_0070368 3300046476 Bacteria 1695
500 Ga0495664_0150041 3300046477 Bacteria 1414
501 Ga0495594_0123671 3300046499 Bacteria 1463
502 Ga0495608_0007343 3300046511 Bacteria 7791
503 Ga0495618_0010594 3300046514 Bacteria 5579
504 Ga0495628_0111971 3300046516 Bacteria 2098
505 Ga0495628_0470421 3300046516 Bacteria 911
506 Ga0495630_0015067 3300046517 Bacteria 5640
507 Ga0495630_0046809 3300046517 Bacteria 3234
508 Ga0495666_0004532 3300046526 Bacteria 7020
509 Ga0495652_0069125 3300046529 Bacteria 2957
510 Ga0495640_0006892 3300046533 Bacteria 8950
511 Ga0495640_0034541 3300046533 Bacteria 3584
512 Ga0495586_0003782 3300046535 Bacteria 8110
513 Ga0495586_0004396 3300046535 Bacteria 7525
514 Ga0495587_0081319 3300046536 Bacteria 1877
515 Ga0495598_0108243 3300046537 Bacteria 928
516 Ga0495667_0014654 3300046559 Bacteria 5297
517 Ga0495634_0031176 3300046642 Bacteria 3673
518 Ga0495635_0029037 3300046663 Bacteria 3845
519 Ga0495659_0073017 3300046664 Unclassified 1289
520 Ga0495657_0387458 3300046675 Bacteria 824
521 Ga0495599_0060146 3300046678 Bacteria 2375
522 Ga0495647_0000273 3300046681 Bacteria 14274
523 Ga0495647_0210352 3300046681 Bacteria 855
524 Ga0495658_0000620 3300046683 Bacteria 19327
525 Ga0495658_0091324 3300046683 Bacteria 1803
526 Ga0495658_0097342 3300046683 Bacteria 1751
527 Ga0495658_0276181 3300046683 Bacteria 1060
528 Ga0495613_0068075 3300046689 Bacteria 2597
529 Ga0495600_0205199 3300046809 Bacteria 1264
530 Ga0495581_0020108 3300047315 Bacteria 3876
531 Ga0495604_0031472 3300047317 Bacteria 4207
532 Ga0495680_0162865 3300047322 Bacteria 1618
533 Ga0495684_0209859 3300047471 Bacteria 1433
534 Ga0495593_0234686 3300047673 Bacteria 919
535 Ga0495593_0236836 3300047673 Bacteria 915
536 Ga0496101_0319526 3300048904 Bacteria 1218
537 Ga0496102_0057948 3300048905 Bacteria 3539
538 Ga0496106_0211012 3300048909 Bacteria 1547
539 Ga0496110_0837834 3300048913 Bacteria 825
540 Ga0501031_0568009 3300049568 Bacteria 730
541 Ga0501033_0302959 3300049570 Bacteria 1125
542 Ga0501033_0527337 3300049570 Bacteria 815
543 Ga0501036_0373856 3300049572 Bacteria 1190
544 Ga0501037_0169095 3300049573 Bacteria 1555
545 Ga0501038_0078941 3300049574 Bacteria 2776
546 Ga0501038_0210273 3300049574 Bacteria 1557
547 Ga0501039_0025541 3300049575 Bacteria 4540
548 Ga0501040_0112159 3300049576 Bacteria 1907
549 Ga0501040_0203387 3300049576 Bacteria 1406
550 Ga0501040_0460507 3300049576 Bacteria 916
551 Ga0501041_0078132 3300049577 Bacteria 2036
552 Ga0501041_0118273 3300049577 Bacteria 1646
553 Ga0501041_0449162 3300049577 Bacteria 818
554 Ga0501042_0021872 3300049578 Bacteria 4463
555 Ga0501042_0126504 3300049578 Bacteria 1840
556 Ga0501046_0040314 3300049580 Bacteria 3733
557 Ga0501046_0264577 3300049580 Bacteria 1263
558 Ga0501046_0331182 3300049580 Bacteria 1108
559 Ga0501046_0839855 3300049580 Bacteria 642
560 Ga0501048_0085162 3300049582 Bacteria 2229
561 Ga0501067_0468490 3300049583 Bacteria 704
562 Ga0501067_0506835 3300049583 Bacteria 675
563 Ga0501068_0237690 3300049584 Bacteria 1159
564 Ga0501069_0061323 3300049585 Bacteria 2100
565 Ga0501071_0557572 3300049587 Bacteria 880
566 Ga0501072_0005763 3300049588 Bacteria 9432
567 Ga0501072_0047052 3300049588 Bacteria 3397
568 Ga0501072_0060729 3300049588 Bacteria 2980
569 Ga0501072_0123105 3300049588 Bacteria 2066
570 Ga0501072_0767351 3300049588 Bacteria 756
571 Ga0501075_0003753 3300049591 Bacteria 10205
572 Ga0501075_0008430 3300049591 Bacteria 7191
573 Ga0501076_0001091 3300049592 Bacteria 17844
574 Ga0501076_0034277 3300049592 Bacteria 3967
575 Ga0501077_0073045 3300049593 Bacteria 2173
576 Ga0501079_0011674 3300049741 Bacteria 6711
577 Ga0501079_0093779 3300049741 Bacteria 2326
578 Ga0501080_0070566 3300049742 Bacteria 3249
579 Ga0501081_0006843 3300049743 Bacteria 7414
580 Ga0501081_0149592 3300049743 Bacteria 1677
581 Ga0501081_0295520 3300049743 Unclassified 1188
582 Ga0501278_020757 3300049774 Bacteria 605
583 Ga0501283_034324 3300049779 Bacteria 861
584 Ga0501045_0007341 3300049824 Bacteria 7664
585 Ga0501045_0139426 3300049824 Bacteria 1803
586 Ga0501045_0574747 3300049824 Bacteria 835
587 nmdc:mga05p37_5151_c1 3300050507 Bacteria 15316
588 nmdc:mga05p37_77_c1 3300050507 Bacteria 86224
589 nmdc:mga09592_1000729_c1 3300050508 Unclassified 699
590 nmdc:mga09592_111078_c1 3300050508 Bacteria 2352
591 nmdc:mga09592_140_c1 3300050508 Bacteria 48059
592 nmdc:mga09592_150391_c1 3300050508 Bacteria 2008
593 nmdc:mga09592_5031_c1 3300050508 Bacteria 10722
594 nmdc:mga09592_66735_c1 3300050508 Bacteria 3050
595 nmdc:mga0qj67_188814_c1 3300050509 Bacteria 1675
596 nmdc:mga0qj67_309704_c1 3300050509 Bacteria 1279
597 nmdc:mga0qj67_416279_c1 3300050509 Bacteria 1084
598 nmdc:mga0qj67_779747_c1 3300050509 Unclassified 757
599 nmdc:mga06r32_106764_c1 3300050510 Bacteria 2751
600 nmdc:mga06r32_190120_c1 3300050510 Bacteria 2041
601 nmdc:mga06r32_232898_c1 3300050510 Bacteria 1830
602 nmdc:mga06r32_61973_c1 3300050510 Bacteria 3602
603 nmdc:mga08y16_18790_c1 3300050511 Bacteria 7282
604 nmdc:mga08y16_33511_c1 3300050511 Bacteria 5394
605 nmdc:mga08y16_427085_c1 3300050511 Unclassified 1354
606 nmdc:mga08y16_56264_c1 3300050511 Bacteria 4112
607 nmdc:mga08y16_69948_c1 3300050511 Bacteria 3659
608 nmdc:mga08y16_94304_c1 3300050511 Bacteria 3118
609 nmdc:mga0n895_125607_c1 3300050512 Bacteria 2589
610 nmdc:mga0n895_201043_c1 3300050512 Bacteria 2023
611 nmdc:mga0n895_48283_c1 3300050512 Unclassified 4166
612 nmdc:mga0n895_553083_c1 3300050512 Bacteria 1156
613 nmdc:mga0n895_78559_c1 3300050512 Bacteria 3285
614 nmdc:mga0n895_792501_c1 3300050512 Bacteria 938
615 nmdc:mga0rr50_113866_c1 3300050513 Bacteria 2144
616 nmdc:mga0rr50_381_c1 3300050513 Bacteria 24264
617 nmdc:mga0rr50_736127_c1 3300050513 Bacteria 842
618 nmdc:mga08x19_21885_c1 3300050514 Bacteria 3952
619 nmdc:mga08x19_2762_c1 3300050514 Bacteria 10593
620 nmdc:mga08x19_37850_c1 3300050514 Bacteria 3063
621 nmdc:mga08x19_381577_c1 3300050514 Bacteria 987
622 nmdc:mga08x19_4927_c2 3300050514 Bacteria 5296
623 nmdc:mga0a205_83595_c1 3300050515 Unclassified 3083
624 nmdc:mga0a205_93_c2 3300050515 Bacteria 37118
625 Ga0495601_0047730 3300053077 Bacteria 2696
626 Ga0495619_0308469 3300053085 Bacteria 1096
627 Ga0501084_0745201 3300054114 Bacteria 825
628 Ga0590071_014584 3300059421 Bacteria 1844
629 Ga0501082_0003995 3300060353 Bacteria 12872
630 Ga0530510_0002851 3300061734 Bacteria 11883

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0235436 Ga0453684_0235436_71_574 164
2 3300031852 Ga0307410_10367056 Ga0307410_103670561 177
3 3300049774 Ga0501278_020757 Ga0501278_020757_50_592 178
4 3300005364 Ga0070673_101180577 Ga0070673_1011805771 181
5 3300005327 Ga0070658_10106268 Ga0070658_101062682 185
6 3300005329 Ga0070683_100072418 Ga0070683_1000724183 185
7 3300005335 Ga0070666_10025570 Ga0070666_100255702 185
8 3300005344 Ga0070661_100200273 Ga0070661_1002002732 185
9 3300005355 Ga0070671_100006885 Ga0070671_1000068855 185
10 3300005366 Ga0070659_100007009 Ga0070659_1000070093 185
11 3300005366 Ga0070659_100429031 Ga0070659_1004290311 185
12 3300005367 Ga0070667_100584965 Ga0070667_1005849652 185
13 3300005434 Ga0070709_10110900 Ga0070709_101109002 185
14 3300005435 Ga0070714_100085824 Ga0070714_1000858242 185
15 3300005457 Ga0070662_100150582 Ga0070662_1001505821 185
16 3300005530 Ga0070679_100332692 Ga0070679_1003326922 185
17 3300005535 Ga0070684_100026670 Ga0070684_1000266703 185
18 3300005543 Ga0070672_100184813 Ga0070672_1001848132 185
19 3300005564 Ga0070664_100056977 Ga0070664_1000569773 185
20 3300005578 Ga0068854_100006272 Ga0068854_1000062724 185
21 3300005614 Ga0068856_100086145 Ga0068856_1000861452 185
22 3300005616 Ga0068852_100277055 Ga0068852_1002770552 185
23 3300005719 Ga0068861_100752008 Ga0068861_1007520082 185
24 3300005834 Ga0068851_10014733 Ga0068851_100147333 185
25 3300005841 Ga0068863_100125147 Ga0068863_1001251474 185
26 3300005844 Ga0068862_100273829 Ga0068862_1002738292 185
27 3300006237 Ga0097621_100388660 Ga0097621_1003886602 185
28 3300009093 Ga0105240_11287381 Ga0105240_112873811 185
29 3300009174 Ga0105241_10010132 Ga0105241_100101325 185
30 3300009177 Ga0105248_10002161 Ga0105248_100021613 185
31 3300013104 Ga0157370_10125797 Ga0157370_101257971 185
32 3300013307 Ga0157372_10959801 Ga0157372_109598012 185
33 3300013308 Ga0157375_11304148 Ga0157375_113041482 185
34 3300020082 Ga0206353_10563905 Ga0206353_105639051 185
35 3300025321 Ga0207656_10005122 Ga0207656_100051224 185
36 3300025911 Ga0207654_10023548 Ga0207654_100235483 185
37 3300025912 Ga0207707_10021374 Ga0207707_100213745 185
38 3300025912 Ga0207707_10116193 Ga0207707_101161933 185
39 3300025914 Ga0207671_10063237 Ga0207671_100632372 185
40 3300025917 Ga0207660_10010154 Ga0207660_100101545 185
41 3300025919 Ga0207657_10009108 Ga0207657_100091088 185
42 3300025920 Ga0207649_10011618 Ga0207649_100116182 185
43 3300025921 Ga0207652_10174442 Ga0207652_101744422 185
44 3300025921 Ga0207652_10272847 Ga0207652_102728472 185
45 3300025923 Ga0207681_10424901 Ga0207681_104249012 185
46 3300025929 Ga0207664_10029789 Ga0207664_100297893 185
47 3300025931 Ga0207644_10004980 Ga0207644_100049806 185
48 3300025933 Ga0207706_10067822 Ga0207706_100678222 185
49 3300025933 Ga0207706_10214488 Ga0207706_102144882 185
50 3300025940 Ga0207691_10095012 Ga0207691_100950123 185
51 3300025941 Ga0207711_10007838 Ga0207711_100078385 185
52 3300025944 Ga0207661_10112997 Ga0207661_101129972 185
53 3300025945 Ga0207679_10148749 Ga0207679_101487492 185
54 3300025949 Ga0207667_10018772 Ga0207667_100187725 185
55 3300025949 Ga0207667_10347196 Ga0207667_103471962 185
56 3300025960 Ga0207651_10109064 Ga0207651_101090642 185
57 3300025972 Ga0207668_10658016 Ga0207668_106580161 185
58 3300025981 Ga0207640_10074462 Ga0207640_100744621 185
59 3300026067 Ga0207678_10003010 Ga0207678_1000301012 185
60 3300026116 Ga0207674_10000956 Ga0207674_100009564 185
61 3300026142 Ga0207698_10007473 Ga0207698_100074735 185
62 3300037418 Ga0395900_0189368 Ga0395900_0189368_1061_1642 185
63 3300037471 Ga0395905_0197937 Ga0395905_0197937_683_1264 185
64 3300038443 Ga0395901_0028910 Ga0395901_0028910_74_655 185
65 3300048904 Ga0496101_0319526 Ga0496101_0319526_467_1048 185
66 3300048905 Ga0496102_0057948 Ga0496102_0057948_1222_1803 185
67 3300048909 Ga0496106_0211012 Ga0496106_0211012_227_808 185
68 3300048913 Ga0496110_0837834 Ga0496110_0837834_220_801 185
69 3300050514 nmdc:mga08x19_381577_c1 nmdc:mga08x19_381577_c1_11_592 185
70 3300049583 Ga0501067_0468490 Ga0501067_0468490_10_582 190
71 3300050511 nmdc:mga08y16_94304_c1 nmdc:mga08y16_94304_c1_1524_2105 193
72 3300026075 Ga0207708_10161441 Ga0207708_101614413 194
73 3300049572 Ga0501036_0373856 Ga0501036_0373856_481_1065 194
74 3300049577 Ga0501041_0449162 Ga0501041_0449162_184_768 194
75 3300049580 Ga0501046_0264577 Ga0501046_0264577_528_1112 194
76 3300049584 Ga0501068_0237690 Ga0501068_0237690_103_687 194
77 3300049588 Ga0501072_0123105 Ga0501072_0123105_500_1084 194
78 3300049591 Ga0501075_0008430 Ga0501075_0008430_6027_6611 194
79 3300049592 Ga0501076_0034277 Ga0501076_0034277_3122_3706 194
80 3300049741 Ga0501079_0093779 Ga0501079_0093779_1342_1926 194
81 3300049824 Ga0501045_0139426 Ga0501045_0139426_883_1467 194
82 3300054114 Ga0501084_0745201 Ga0501084_0745201_99_683 194
83 3300005471 Ga0070698_100829766 Ga0070698_1008297661 196
84 3300005536 Ga0070697_100997659 Ga0070697_1009976591 196
85 3300006173 Ga0070716_100290864 Ga0070716_1002908642 196
86 3300006852 Ga0075433_10061416 Ga0075433_100614163 196
87 3300006871 Ga0075434_100030678 Ga0075434_1000306786 196
88 3300006914 Ga0075436_100116709 Ga0075436_1001167092 196
89 3300007076 Ga0075435_100418794 Ga0075435_1004187942 196
90 3300009147 Ga0114129_10005359 Ga0114129_100053595 196
91 3300009148 Ga0105243_10067067 Ga0105243_100670673 196
92 3300025917 Ga0207660_10237780 Ga0207660_102377802 196
93 3300025939 Ga0207665_10530664 Ga0207665_105306642 196
94 3300032002 Ga0307416_100115903 Ga0307416_1001159032 196
95 3300045051 Ga0451576_0834465 Ga0451576_0834465_21_611 196
96 3300049580 Ga0501046_0331182 Ga0501046_0331182_505_1098 196
97 3300049580 Ga0501046_0839855 Ga0501046_0839855_39_632 196
98 3300050507 nmdc:mga05p37_77_c1 nmdc:mga05p37_77_c1_54150_54752 196
99 3300050508 nmdc:mga09592_1000729_c1 nmdc:mga09592_1000729_c1_14_613 196
100 3300050508 nmdc:mga09592_140_c1 nmdc:mga09592_140_c1_22782_23384 196
101 3300050510 nmdc:mga06r32_61973_c1 nmdc:mga06r32_61973_c1_1854_2456 196
102 3300050512 nmdc:mga0n895_48283_c1 nmdc:mga0n895_48283_c1_966_1559 196
103 3300050512 nmdc:mga0n895_792501_c1 nmdc:mga0n895_792501_c1_13_612 196
104 3300050513 nmdc:mga0rr50_736127_c1 nmdc:mga0rr50_736127_c1_172_765 196
105 3300050515 nmdc:mga0a205_83595_c1 nmdc:mga0a205_83595_c1_2214_2807 196
106 3300005341 Ga0070691_10050732 Ga0070691_100507322 201
107 3300005444 Ga0070694_100103234 Ga0070694_1001032343 201
108 3300005444 Ga0070694_100576624 Ga0070694_1005766242 201
109 3300005546 Ga0070696_100444546 Ga0070696_1004445462 201
110 3300005549 Ga0070704_100193204 Ga0070704_1001932042 201
111 3300006852 Ga0075433_10292049 Ga0075433_102920492 201
112 3300006871 Ga0075434_100211253 Ga0075434_1002112532 201
113 3300006871 Ga0075434_100830456 Ga0075434_1008304562 201
114 3300006871 Ga0075434_101068199 Ga0075434_1010681991 201
115 3300006880 Ga0075429_100177510 Ga0075429_1001775102 201
116 3300009094 Ga0111539_10131849 Ga0111539_101318494 201
117 3300026089 Ga0207648_10394633 Ga0207648_103946332 201
118 3300036401 Ga0373937_0103509 Ga0373937_0103509_1103_1708 201
119 3300046454 Ga0495592_0014466 Ga0495592_0014466_3835_4440 201
120 3300046461 Ga0495641_0063311 Ga0495641_0063311_512_1117 201
121 3300046476 Ga0495662_0070368 Ga0495662_0070368_410_1015 201
122 3300046477 Ga0495664_0150041 Ga0495664_0150041_637_1242 201
123 3300046511 Ga0495608_0007343 Ga0495608_0007343_2839_3444 201
124 3300046514 Ga0495618_0010594 Ga0495618_0010594_1529_2134 201
125 3300046516 Ga0495628_0111971 Ga0495628_0111971_733_1338 201
126 3300046517 Ga0495630_0015067 Ga0495630_0015067_1275_1880 201
127 3300046529 Ga0495652_0069125 Ga0495652_0069125_1484_2089 201
128 3300046533 Ga0495640_0006892 Ga0495640_0006892_7958_8563 201
129 3300046533 Ga0495640_0034541 Ga0495640_0034541_1980_2585 201
130 3300046535 Ga0495586_0004396 Ga0495586_0004396_1767_2372 201
131 3300046536 Ga0495587_0081319 Ga0495587_0081319_573_1178 201
132 3300046559 Ga0495667_0014654 Ga0495667_0014654_869_1474 201
133 3300046642 Ga0495634_0031176 Ga0495634_0031176_1666_2271 201
134 3300046663 Ga0495635_0029037 Ga0495635_0029037_2673_3278 201
135 3300046678 Ga0495599_0060146 Ga0495599_0060146_236_841 201
136 3300046683 Ga0495658_0091324 Ga0495658_0091324_1067_1672 201
137 3300046683 Ga0495658_0276181 Ga0495658_0276181_304_909 201
138 3300046689 Ga0495613_0068075 Ga0495613_0068075_1251_1856 201
139 3300046809 Ga0495600_0205199 Ga0495600_0205199_632_1237 201
140 3300047317 Ga0495604_0031472 Ga0495604_0031472_1117_1722 201
141 3300047322 Ga0495680_0162865 Ga0495680_0162865_847_1452 201
142 3300047471 Ga0495684_0209859 Ga0495684_0209859_406_1011 201
143 3300047673 Ga0495593_0234686 Ga0495593_0234686_159_764 201
144 3300047673 Ga0495593_0236836 Ga0495593_0236836_14_619 201
145 3300050508 nmdc:mga09592_150391_c1 nmdc:mga09592_150391_c1_398_1003 201
146 3300050512 nmdc:mga0n895_125607_c1 nmdc:mga0n895_125607_c1_1149_1754 201
147 3300050512 nmdc:mga0n895_553083_c1 nmdc:mga0n895_553083_c1_483_1088 201
148 3300053077 Ga0495601_0047730 Ga0495601_0047730_1202_1807 201
149 3300053085 Ga0495619_0308469 Ga0495619_0308469_25_630 201
150 3300005437 Ga0070710_10026915 Ga0070710_100269152 202
151 3300005439 Ga0070711_100589699 Ga0070711_1005896992 202
152 3300032126 Ga0307415_100514897 Ga0307415_1005148972 202
153 3300035119 Ga0373956_0021330 Ga0373956_0021330_423_1031 202
154 3300035120 Ga0373957_0015053 Ga0373957_0015053_244_852 202
155 3300035172 Ga0373955_0058778 Ga0373955_0058778_1435_2043 202
156 3300035410 Ga0373924_0002130 Ga0373924_0002130_563_1171 202
157 3300035724 Ga0373933_0014146 Ga0373933_0014146_3307_3915 202
158 3300036401 Ga0373937_0017415 Ga0373937_0017415_5660_6268 202
159 3300042156 Ga0439446_0024779 Ga0439446_0024779_470_1114 202
160 3300046675 Ga0495657_0387458 Ga0495657_0387458_96_704 202
161 3300005295 Ga0065707_10082232 Ga0065707_100822322 203
162 3300006844 Ga0075428_100503100 Ga0075428_1005031002 203
163 3300006846 Ga0075430_100563165 Ga0075430_1005631651 203
164 3300025917 Ga0207660_10117480 Ga0207660_101174804 203
165 3300027526 Ga0209968_1008484 Ga0209968_10084842 203
166 3300035695 Ga0373927_0109431 Ga0373927_0109431_500_1111 203
167 3300035725 Ga0373947_0074559 Ga0373947_0074559_1119_1730 203
168 3300037068 Ga0373925_0000920 Ga0373925_0000920_6414_7025 203
169 3300042003 Ga0439443_002918 Ga0439443_002918_400_1011 203
170 3300042436 Ga0439435_0000277 Ga0439435_0000277_433_1044 203
171 3300042436 Ga0439435_0001802 Ga0439435_0001802_1076_1687 203
172 3300042436 Ga0439435_0121908 Ga0439435_0121908_138_749 203
173 3300042437 Ga0439444_0003955 Ga0439444_0003955_871_1482 203
174 3300042461 Ga0439460_0000454 Ga0439460_0000454_8172_8783 203
175 3300046664 Ga0495659_0073017 Ga0495659_0073017_282_893 203
176 3300046681 Ga0495647_0210352 Ga0495647_0210352_223_834 203
177 3300046683 Ga0495658_0097342 Ga0495658_0097342_1075_1686 203
178 3300049570 Ga0501033_0527337 Ga0501033_0527337_145_756 203
179 3300049573 Ga0501037_0169095 Ga0501037_0169095_35_646 203
180 3300049574 Ga0501038_0078941 Ga0501038_0078941_968_1579 203
181 3300049575 Ga0501039_0025541 Ga0501039_0025541_1835_2446 203
182 3300049576 Ga0501040_0112159 Ga0501040_0112159_1184_1795 203
183 3300049576 Ga0501040_0203387 Ga0501040_0203387_698_1309 203
184 3300049576 Ga0501040_0460507 Ga0501040_0460507_71_682 203
185 3300049577 Ga0501041_0078132 Ga0501041_0078132_57_668 203
186 3300049578 Ga0501042_0021872 Ga0501042_0021872_2191_2802 203
187 3300049580 Ga0501046_0040314 Ga0501046_0040314_1353_1964 203
188 3300049582 Ga0501048_0085162 Ga0501048_0085162_313_924 203
189 3300049588 Ga0501072_0005763 Ga0501072_0005763_1204_1815 203
190 3300049591 Ga0501075_0003753 Ga0501075_0003753_5679_6290 203
191 3300049592 Ga0501076_0001091 Ga0501076_0001091_9960_10571 203
192 3300049593 Ga0501077_0073045 Ga0501077_0073045_362_973 203
193 3300049741 Ga0501079_0011674 Ga0501079_0011674_5104_5715 203
194 3300049742 Ga0501080_0070566 Ga0501080_0070566_1426_2037 203
195 3300049743 Ga0501081_0006843 Ga0501081_0006843_2465_3076 203
196 3300049743 Ga0501081_0149592 Ga0501081_0149592_364_975 203
197 3300049743 Ga0501081_0295520 Ga0501081_0295520_111_722 203
198 3300049824 Ga0501045_0007341 Ga0501045_0007341_2804_3415 203
199 3300050509 nmdc:mga0qj67_779747_c1 nmdc:mga0qj67_779747_c1_68_679 203
200 3300059421 Ga0590071_014584 Ga0590071_014584_382_993 203
201 3300060353 Ga0501082_0003995 Ga0501082_0003995_8633_9244 203
202 3300061734 Ga0530510_0002851 Ga0530510_0002851_4869_5480 203
203 3300003203 JGI25406J46586_10036712 JGI25406J46586_100367122 204
204 3300005295 Ga0065707_10140127 Ga0065707_101401272 204
205 3300005328 Ga0070676_10001054 Ga0070676_1000105420 204
206 3300005329 Ga0070683_100009336 Ga0070683_1000093362 204
207 3300005330 Ga0070690_100000289 Ga0070690_10000028919 204
208 3300005330 Ga0070690_100008257 Ga0070690_1000082572 204
209 3300005330 Ga0070690_100010634 Ga0070690_1000106343 204
210 3300005330 Ga0070690_100395550 Ga0070690_1003955502 204
211 3300005330 Ga0070690_100840140 Ga0070690_1008401401 204
212 3300005333 Ga0070677_10018848 Ga0070677_100188482 204
213 3300005333 Ga0070677_10142766 Ga0070677_101427662 204
214 3300005334 Ga0068869_100000299 Ga0068869_1000002998 204
215 3300005334 Ga0068869_100000782 Ga0068869_10000078233 204
216 3300005334 Ga0068869_100186958 Ga0068869_1001869583 204
217 3300005335 Ga0070666_10001388 Ga0070666_100013884 204
218 3300005335 Ga0070666_10097599 Ga0070666_100975992 204
219 3300005336 Ga0070680_100007424 Ga0070680_1000074244 204
220 3300005336 Ga0070680_100118235 Ga0070680_1001182354 204
221 3300005336 Ga0070680_100401851 Ga0070680_1004018511 204
222 3300005336 Ga0070680_100607685 Ga0070680_1006076852 204
223 3300005338 Ga0068868_100000531 Ga0068868_10000053119 204
224 3300005338 Ga0068868_100024328 Ga0068868_1000243288 204
225 3300005340 Ga0070689_100190308 Ga0070689_1001903082 204
226 3300005340 Ga0070689_100202158 Ga0070689_1002021582 204
227 3300005340 Ga0070689_100611661 Ga0070689_1006116612 204
228 3300005341 Ga0070691_10154485 Ga0070691_101544853 204
229 3300005343 Ga0070687_100000355 Ga0070687_1000003556 204
230 3300005343 Ga0070687_100000403 Ga0070687_10000040311 204
231 3300005343 Ga0070687_100265429 Ga0070687_1002654292 204
232 3300005343 Ga0070687_100410856 Ga0070687_1004108561 204
233 3300005345 Ga0070692_10002606 Ga0070692_100026064 204
234 3300005345 Ga0070692_10021627 Ga0070692_100216277 204
235 3300005345 Ga0070692_10145540 Ga0070692_101455402 204
236 3300005345 Ga0070692_10408477 Ga0070692_104084772 204
237 3300005345 Ga0070692_10584384 Ga0070692_105843841 204
238 3300005347 Ga0070668_100000682 Ga0070668_1000006827 204
239 3300005347 Ga0070668_100015073 Ga0070668_1000150732 204
240 3300005353 Ga0070669_100001513 Ga0070669_1000015137 204
241 3300005353 Ga0070669_100015151 Ga0070669_1000151514 204
242 3300005354 Ga0070675_100016038 Ga0070675_1000160385 204
243 3300005354 Ga0070675_100073810 Ga0070675_1000738105 204
244 3300005355 Ga0070671_101096191 Ga0070671_1010961911 204
245 3300005356 Ga0070674_100018912 Ga0070674_1000189123 204
246 3300005364 Ga0070673_100074393 Ga0070673_1000743934 204
247 3300005365 Ga0070688_100132976 Ga0070688_1001329763 204
248 3300005365 Ga0070688_100177189 Ga0070688_1001771892 204
249 3300005367 Ga0070667_100007737 Ga0070667_1000077378 204
250 3300005367 Ga0070667_100260245 Ga0070667_1002602453 204
251 3300005406 Ga0070703_10014022 Ga0070703_100140223 204
252 3300005438 Ga0070701_10000387 Ga0070701_1000038713 204
253 3300005439 Ga0070711_100452062 Ga0070711_1004520621 204
254 3300005440 Ga0070705_100000472 Ga0070705_10000047210 204
255 3300005440 Ga0070705_100021219 Ga0070705_1000212195 204
256 3300005440 Ga0070705_100082742 Ga0070705_1000827422 204
257 3300005440 Ga0070705_100313315 Ga0070705_1003133152 204
258 3300005441 Ga0070700_100002641 Ga0070700_1000026412 204
259 3300005441 Ga0070700_100041008 Ga0070700_1000410082 204
260 3300005441 Ga0070700_100076914 Ga0070700_1000769143 204
261 3300005441 Ga0070700_100384540 Ga0070700_1003845402 204
262 3300005444 Ga0070694_100000249 Ga0070694_10000024917 204
263 3300005444 Ga0070694_100002755 Ga0070694_10000275511 204
264 3300005444 Ga0070694_100032351 Ga0070694_1000323512 204
265 3300005444 Ga0070694_100096109 Ga0070694_1000961093 204
266 3300005444 Ga0070694_100413170 Ga0070694_1004131702 204
267 3300005445 Ga0070708_100071153 Ga0070708_1000711532 204
268 3300005445 Ga0070708_100874873 Ga0070708_1008748731 204
269 3300005455 Ga0070663_100043422 Ga0070663_1000434223 204
270 3300005456 Ga0070678_100016206 Ga0070678_1000162065 204
271 3300005457 Ga0070662_100034124 Ga0070662_1000341243 204
272 3300005457 Ga0070662_100282450 Ga0070662_1002824502 204
273 3300005457 Ga0070662_100333996 Ga0070662_1003339962 204
274 3300005458 Ga0070681_10492617 Ga0070681_104926172 204
275 3300005459 Ga0068867_100000430 Ga0068867_1000004309 204
276 3300005459 Ga0068867_100002651 Ga0068867_10000265124 204
277 3300005467 Ga0070706_100163026 Ga0070706_1001630261 204
278 3300005518 Ga0070699_100093706 Ga0070699_1000937062 204
279 3300005530 Ga0070679_100089258 Ga0070679_1000892583 204
280 3300005536 Ga0070697_100001293 Ga0070697_10000129312 204
281 3300005539 Ga0068853_100270386 Ga0068853_1002703862 204
282 3300005539 Ga0068853_100297181 Ga0068853_1002971812 204
283 3300005543 Ga0070672_100001295 Ga0070672_1000012958 204
284 3300005543 Ga0070672_100063248 Ga0070672_1000632483 204
285 3300005543 Ga0070672_100430916 Ga0070672_1004309162 204
286 3300005544 Ga0070686_100000392 Ga0070686_10000039222 204
287 3300005544 Ga0070686_100034552 Ga0070686_1000345525 204
288 3300005544 Ga0070686_100596758 Ga0070686_1005967582 204
289 3300005545 Ga0070695_100000185 Ga0070695_10000018511 204
290 3300005545 Ga0070695_100495729 Ga0070695_1004957292 204
291 3300005546 Ga0070696_100000519 Ga0070696_10000051917 204
292 3300005546 Ga0070696_100002012 Ga0070696_10000201214 204
293 3300005546 Ga0070696_100018323 Ga0070696_1000183233 204
294 3300005546 Ga0070696_100104966 Ga0070696_1001049663 204
295 3300005546 Ga0070696_100646344 Ga0070696_1006463441 204
296 3300005547 Ga0070693_100000135 Ga0070693_10000013527 204
297 3300005547 Ga0070693_100257096 Ga0070693_1002570962 204
298 3300005547 Ga0070693_100326404 Ga0070693_1003264042 204
299 3300005549 Ga0070704_100000108 Ga0070704_1000001084 204
300 3300005549 Ga0070704_100083896 Ga0070704_1000838962 204
301 3300005549 Ga0070704_100086465 Ga0070704_1000864653 204
302 3300005549 Ga0070704_100481566 Ga0070704_1004815662 204
303 3300005563 Ga0068855_100002231 Ga0068855_1000022318 204
304 3300005577 Ga0068857_100645306 Ga0068857_1006453062 204
305 3300005577 Ga0068857_100737021 Ga0068857_1007370212 204
306 3300005614 Ga0068856_100013516 Ga0068856_1000135169 204
307 3300005614 Ga0068856_100109958 Ga0068856_1001099582 204
308 3300005614 Ga0068856_100158041 Ga0068856_1001580412 204
309 3300005615 Ga0070702_100000557 Ga0070702_10000055714 204
310 3300005615 Ga0070702_100076821 Ga0070702_1000768212 204
311 3300005616 Ga0068852_100018182 Ga0068852_1000181822 204
312 3300005616 Ga0068852_100738304 Ga0068852_1007383042 204
313 3300005617 Ga0068859_100001399 Ga0068859_10000139910 204
314 3300005617 Ga0068859_100090027 Ga0068859_1000900274 204
315 3300005617 Ga0068859_100112847 Ga0068859_1001128473 204
316 3300005618 Ga0068864_100039636 Ga0068864_1000396364 204
317 3300005618 Ga0068864_100272380 Ga0068864_1002723803 204
318 3300005618 Ga0068864_100452285 Ga0068864_1004522852 204
319 3300005718 Ga0068866_10001478 Ga0068866_100014782 204
320 3300005718 Ga0068866_10002633 Ga0068866_1000263313 204
321 3300005719 Ga0068861_100001038 Ga0068861_1000010384 204
322 3300005719 Ga0068861_100001358 Ga0068861_1000013581 204
323 3300005719 Ga0068861_100010298 Ga0068861_1000102988 204
324 3300005719 Ga0068861_100074216 Ga0068861_1000742163 204
325 3300005840 Ga0068870_10149137 Ga0068870_101491373 204
326 3300005841 Ga0068863_100001611 Ga0068863_1000016112 204
327 3300005841 Ga0068863_100138342 Ga0068863_1001383422 204
328 3300005841 Ga0068863_100910362 Ga0068863_1009103622 204
329 3300005842 Ga0068858_100003840 Ga0068858_1000038406 204
330 3300005842 Ga0068858_100593837 Ga0068858_1005938372 204
331 3300005843 Ga0068860_100001826 Ga0068860_10000182630 204
332 3300005843 Ga0068860_100002413 Ga0068860_1000024138 204
333 3300005843 Ga0068860_100030311 Ga0068860_1000303114 204
334 3300005844 Ga0068862_100001204 Ga0068862_10000120417 204
335 3300005844 Ga0068862_100003042 Ga0068862_1000030427 204
336 3300005844 Ga0068862_100017851 Ga0068862_1000178516 204
337 3300005844 Ga0068862_100070394 Ga0068862_1000703943 204
338 3300005844 Ga0068862_100093124 Ga0068862_1000931245 204
339 3300005844 Ga0068862_100141810 Ga0068862_1001418102 204
340 3300005985 Ga0081539_10000462 Ga0081539_1000046231 204
341 3300006237 Ga0097621_100001049 Ga0097621_10000104912 204
342 3300006237 Ga0097621_100004130 Ga0097621_1000041306 204
343 3300006237 Ga0097621_100282111 Ga0097621_1002821112 204
344 3300006358 Ga0068871_100000370 Ga0068871_1000003709 204
345 3300006358 Ga0068871_100004173 Ga0068871_10000417312 204
346 3300006358 Ga0068871_100561979 Ga0068871_1005619792 204
347 3300006844 Ga0075428_100000993 Ga0075428_10000099313 204
348 3300006844 Ga0075428_100066543 Ga0075428_1000665433 204
349 3300006844 Ga0075428_100243377 Ga0075428_1002433772 204
350 3300006846 Ga0075430_100002561 Ga0075430_10000256113 204
351 3300006846 Ga0075430_100809367 Ga0075430_1008093672 204
352 3300006847 Ga0075431_100267579 Ga0075431_1002675792 204
353 3300006852 Ga0075433_10007872 Ga0075433_100078728 204
354 3300006852 Ga0075433_10146936 Ga0075433_101469363 204
355 3300006871 Ga0075434_100003359 Ga0075434_10000335913 204
356 3300006880 Ga0075429_100000003 Ga0075429_10000000362 204
357 3300006880 Ga0075429_100002816 Ga0075429_10000281614 204
358 3300006880 Ga0075429_100029199 Ga0075429_1000291993 204
359 3300006880 Ga0075429_100562320 Ga0075429_1005623202 204
360 3300006881 Ga0068865_100000283 Ga0068865_10000028322 204
361 3300006881 Ga0068865_100000599 Ga0068865_10000059913 204
362 3300006881 Ga0068865_100521630 Ga0068865_1005216302 204
363 3300006914 Ga0075436_100001687 Ga0075436_10000168710 204
364 3300006914 Ga0075436_100026392 Ga0075436_1000263925 204
365 3300006931 Ga0097620_100001399 Ga0097620_10000139910 204
366 3300006931 Ga0097620_100090025 Ga0097620_1000900253 204
367 3300006931 Ga0097620_100112848 Ga0097620_1001128483 204
368 3300007076 Ga0075435_100001908 Ga0075435_10000190813 204
369 3300007076 Ga0075435_100045483 Ga0075435_1000454833 204
370 3300007076 Ga0075435_100281364 Ga0075435_1002813641 204
371 3300007076 Ga0075435_100645168 Ga0075435_1006451681 204
372 3300007265 Ga0099794_10009654 Ga0099794_100096544 204
373 3300009092 Ga0105250_10019097 Ga0105250_100190972 204
374 3300009094 Ga0111539_10023346 Ga0111539_100233462 204
375 3300009094 Ga0111539_10027656 Ga0111539_100276564 204
376 3300009094 Ga0111539_10065980 Ga0111539_100659803 204
377 3300009094 Ga0111539_10125633 Ga0111539_101256333 204
378 3300009094 Ga0111539_10203580 Ga0111539_102035804 204
379 3300009094 Ga0111539_10304718 Ga0111539_103047185 204
380 3300009094 Ga0111539_11679898 Ga0111539_116798981 204
381 3300009098 Ga0105245_10001066 Ga0105245_100010667 204
382 3300009098 Ga0105245_10012082 Ga0105245_100120828 204
383 3300009147 Ga0114129_10001138 Ga0114129_1000113818 204
384 3300009147 Ga0114129_10318058 Ga0114129_103180582 204
385 3300009147 Ga0114129_10651601 Ga0114129_106516012 204
386 3300009148 Ga0105243_10000708 Ga0105243_1000070827 204
387 3300009148 Ga0105243_10002376 Ga0105243_100023768 204
388 3300009148 Ga0105243_10011238 Ga0105243_100112387 204
389 3300009174 Ga0105241_10015810 Ga0105241_100158107 204
390 3300009176 Ga0105242_10001614 Ga0105242_100016149 204
391 3300009176 Ga0105242_10003692 Ga0105242_100036925 204
392 3300009176 Ga0105242_10150666 Ga0105242_101506663 204
393 3300009177 Ga0105248_10005188 Ga0105248_1000518817 204
394 3300009177 Ga0105248_10202109 Ga0105248_102021092 204
395 3300009177 Ga0105248_10316364 Ga0105248_103163642 204
396 3300009551 Ga0105238_10815244 Ga0105238_108152442 204
397 3300009553 Ga0105249_10000996 Ga0105249_1000099614 204
398 3300009553 Ga0105249_10005638 Ga0105249_100056382 204
399 3300009553 Ga0105249_10092104 Ga0105249_100921043 204
400 3300009553 Ga0105249_10105216 Ga0105249_101052163 204
401 3300013102 Ga0157371_10298535 Ga0157371_102985352 204
402 3300013296 Ga0157374_10303333 Ga0157374_103033332 204
403 3300013297 Ga0157378_10001153 Ga0157378_1000115317 204
404 3300013297 Ga0157378_10123484 Ga0157378_101234844 204
405 3300013306 Ga0163162_10005059 Ga0163162_1000505917 204
406 3300013306 Ga0163162_10107920 Ga0163162_101079202 204
407 3300013306 Ga0163162_10117859 Ga0163162_101178592 204
408 3300013306 Ga0163162_11572580 Ga0163162_115725801 204
409 3300013308 Ga0157375_10000906 Ga0157375_1000090617 204
410 3300013308 Ga0157375_10119505 Ga0157375_101195053 204
411 3300014326 Ga0157380_10002623 Ga0157380_1000262317 204
412 3300014326 Ga0157380_10023634 Ga0157380_100236347 204
413 3300014326 Ga0157380_10049523 Ga0157380_100495234 204
414 3300014326 Ga0157380_10172289 Ga0157380_101722892 204
415 3300014968 Ga0157379_10028553 Ga0157379_100285534 204
416 3300014968 Ga0157379_10198166 Ga0157379_101981662 204
417 3300014969 Ga0157376_10069460 Ga0157376_100694604 204
418 3300014969 Ga0157376_10165442 Ga0157376_101654424 204
419 3300017792 Ga0163161_10000551 Ga0163161_1000055123 204
420 3300017792 Ga0163161_10175190 Ga0163161_101751901 204
421 3300025315 Ga0207697_10004623 Ga0207697_100046235 204
422 3300025885 Ga0207653_10022602 Ga0207653_100226022 204
423 3300025885 Ga0207653_10142339 Ga0207653_101423392 204
424 3300025893 Ga0207682_10030051 Ga0207682_100300513 204
425 3300025899 Ga0207642_10000750 Ga0207642_100007502 204
426 3300025899 Ga0207642_10022003 Ga0207642_100220034 204
427 3300025903 Ga0207680_10002557 Ga0207680_100025575 204
428 3300025903 Ga0207680_10080910 Ga0207680_100809102 204
429 3300025907 Ga0207645_10000390 Ga0207645_1000039066 204
430 3300025907 Ga0207645_10011013 Ga0207645_100110138 204
431 3300025907 Ga0207645_10153332 Ga0207645_101533322 204
432 3300025910 Ga0207684_10038808 Ga0207684_100388085 204
433 3300025912 Ga0207707_10149245 Ga0207707_101492452 204
434 3300025912 Ga0207707_10394523 Ga0207707_103945232 204
435 3300025917 Ga0207660_10149366 Ga0207660_101493663 204
436 3300025917 Ga0207660_10438416 Ga0207660_104384162 204
437 3300025918 Ga0207662_10000191 Ga0207662_1000019122 204
438 3300025918 Ga0207662_10001816 Ga0207662_1000181612 204
439 3300025918 Ga0207662_10234386 Ga0207662_102343862 204
440 3300025918 Ga0207662_10433685 Ga0207662_104336852 204
441 3300025921 Ga0207652_10108716 Ga0207652_101087163 204
442 3300025921 Ga0207652_10804993 Ga0207652_108049931 204
443 3300025922 Ga0207646_10199130 Ga0207646_101991302 204
444 3300025922 Ga0207646_10805360 Ga0207646_108053601 204
445 3300025923 Ga0207681_10010837 Ga0207681_100108377 204
446 3300025923 Ga0207681_10016603 Ga0207681_100166037 204
447 3300025923 Ga0207681_10128293 Ga0207681_101282932 204
448 3300025926 Ga0207659_10019827 Ga0207659_100198276 204
449 3300025926 Ga0207659_10026847 Ga0207659_100268475 204
450 3300025927 Ga0207687_10001813 Ga0207687_1000181311 204
451 3300025933 Ga0207706_10002980 Ga0207706_1000298019 204
452 3300025933 Ga0207706_10122008 Ga0207706_101220081 204
453 3300025933 Ga0207706_10572404 Ga0207706_105724042 204
454 3300025934 Ga0207686_10001418 Ga0207686_100014185 204
455 3300025934 Ga0207686_10022309 Ga0207686_100223093 204
456 3300025935 Ga0207709_10001098 Ga0207709_100010988 204
457 3300025935 Ga0207709_10021268 Ga0207709_100212682 204
458 3300025935 Ga0207709_10073500 Ga0207709_100735002 204
459 3300025935 Ga0207709_10228264 Ga0207709_102282643 204
460 3300025936 Ga0207670_10243838 Ga0207670_102438382 204
461 3300025936 Ga0207670_10533694 Ga0207670_105336941 204
462 3300025936 Ga0207670_10908467 Ga0207670_109084671 204
463 3300025937 Ga0207669_10027920 Ga0207669_100279206 204
464 3300025937 Ga0207669_10392891 Ga0207669_103928911 204
465 3300025938 Ga0207704_10000409 Ga0207704_100004099 204
466 3300025938 Ga0207704_10003731 Ga0207704_1000373111 204
467 3300025938 Ga0207704_10015773 Ga0207704_100157736 204
468 3300025940 Ga0207691_10001079 Ga0207691_1000107943 204
469 3300025940 Ga0207691_10016817 Ga0207691_1001681712 204
470 3300025940 Ga0207691_10148924 Ga0207691_101489244 204
471 3300025941 Ga0207711_10026903 Ga0207711_100269036 204
472 3300025941 Ga0207711_10063905 Ga0207711_100639052 204
473 3300025942 Ga0207689_10000921 Ga0207689_100009219 204
474 3300025942 Ga0207689_10036897 Ga0207689_100368974 204
475 3300025949 Ga0207667_10017372 Ga0207667_100173728 204
476 3300025960 Ga0207651_10221178 Ga0207651_102211782 204
477 3300025960 Ga0207651_10226974 Ga0207651_102269742 204
478 3300025961 Ga0207712_10007728 Ga0207712_1000772810 204
479 3300025961 Ga0207712_10117711 Ga0207712_101177112 204
480 3300025961 Ga0207712_10258394 Ga0207712_102583942 204
481 3300025961 Ga0207712_10608927 Ga0207712_106089271 204
482 3300025972 Ga0207668_10002352 Ga0207668_1000235220 204
483 3300025972 Ga0207668_10017408 Ga0207668_100174083 204
484 3300025972 Ga0207668_10157848 Ga0207668_101578481 204
485 3300025981 Ga0207640_10001592 Ga0207640_100015928 204
486 3300025981 Ga0207640_10956978 Ga0207640_109569782 204
487 3300025986 Ga0207658_10019716 Ga0207658_100197166 204
488 3300025986 Ga0207658_10347392 Ga0207658_103473922 204
489 3300026023 Ga0207677_10000592 Ga0207677_1000059217 204
490 3300026023 Ga0207677_10056605 Ga0207677_100566052 204
491 3300026035 Ga0207703_10000937 Ga0207703_100009372 204
492 3300026035 Ga0207703_10007345 Ga0207703_100073454 204
493 3300026035 Ga0207703_10704467 Ga0207703_107044672 204
494 3300026041 Ga0207639_10098519 Ga0207639_100985192 204
495 3300026041 Ga0207639_10318305 Ga0207639_103183052 204
496 3300026075 Ga0207708_10000451 Ga0207708_1000045122 204
497 3300026075 Ga0207708_10015956 Ga0207708_100159566 204
498 3300026075 Ga0207708_10084591 Ga0207708_100845912 204
499 3300026075 Ga0207708_10152389 Ga0207708_101523892 204
500 3300026075 Ga0207708_10182809 Ga0207708_101828093 204
501 3300026075 Ga0207708_10210666 Ga0207708_102106662 204
502 3300026078 Ga0207702_10178909 Ga0207702_101789092 204
503 3300026078 Ga0207702_10312875 Ga0207702_103128752 204
504 3300026088 Ga0207641_10004844 Ga0207641_100048444 204
505 3300026088 Ga0207641_10164194 Ga0207641_101641943 204
506 3300026089 Ga0207648_10000245 Ga0207648_1000024517 204
507 3300026089 Ga0207648_10001462 Ga0207648_1000146213 204
508 3300026089 Ga0207648_10001948 Ga0207648_1000194829 204
509 3300026095 Ga0207676_10004835 Ga0207676_100048355 204
510 3300026095 Ga0207676_10089139 Ga0207676_100891392 204
511 3300026116 Ga0207674_10573581 Ga0207674_105735812 204
512 3300026116 Ga0207674_10661770 Ga0207674_106617702 204
513 3300026118 Ga0207675_100001447 Ga0207675_10000144717 204
514 3300026118 Ga0207675_100001475 Ga0207675_10000147525 204
515 3300026118 Ga0207675_100023625 Ga0207675_1000236254 204
516 3300026118 Ga0207675_100053681 Ga0207675_1000536813 204
517 3300026118 Ga0207675_100325628 Ga0207675_1003256283 204
518 3300026121 Ga0207683_10021770 Ga0207683_100217702 204
519 3300026121 Ga0207683_10472796 Ga0207683_104727961 204
520 3300026142 Ga0207698_10095027 Ga0207698_100950274 204
521 3300026142 Ga0207698_10157694 Ga0207698_101576942 204
522 3300027364 Ga0209967_1004895 Ga0209967_10048952 204
523 3300027462 Ga0210000_1004416 Ga0210000_10044163 204
524 3300027462 Ga0210000_1004622 Ga0210000_10046222 204
525 3300027543 Ga0209999_1002327 Ga0209999_10023273 204
526 3300027543 Ga0209999_1047153 Ga0209999_10471531 204
527 3300027876 Ga0209974_10032126 Ga0209974_100321263 204
528 3300027907 Ga0207428_10004232 Ga0207428_100042322 204
529 3300027907 Ga0207428_10022897 Ga0207428_100228976 204
530 3300027907 Ga0207428_10035347 Ga0207428_100353473 204
531 3300027907 Ga0207428_10210576 Ga0207428_102105763 204
532 3300028380 Ga0268265_10000627 Ga0268265_1000062711 204
533 3300028380 Ga0268265_10004164 Ga0268265_100041649 204
534 3300028380 Ga0268265_10053870 Ga0268265_100538701 204
535 3300028380 Ga0268265_10105537 Ga0268265_101055372 204
536 3300028380 Ga0268265_10397766 Ga0268265_103977662 204
537 3300028380 Ga0268265_10404334 Ga0268265_104043342 204
538 3300028380 Ga0268265_10932691 Ga0268265_109326911 204
539 3300028381 Ga0268264_10003335 Ga0268264_100033359 204
540 3300028381 Ga0268264_10007307 Ga0268264_1000730719 204
541 3300028381 Ga0268264_10118738 Ga0268264_101187383 204
542 3300034819 Ga0373958_0003458 Ga0373958_0003458_547_1161 204
543 3300035089 Ga0373944_0003060 Ga0373944_0003060_760_1377 204
544 3300035092 Ga0373952_0006344 Ga0373952_0006344_358_972 204
545 3300035111 Ga0373923_0086627 Ga0373923_0086627_456_1073 204
546 3300035112 Ga0373932_0002139 Ga0373932_0002139_3004_3618 204
547 3300035112 Ga0373932_0030359 Ga0373932_0030359_461_1075 204
548 3300035113 Ga0373936_0022250 Ga0373936_0022250_280_897 204
549 3300035114 Ga0373939_0040560 Ga0373939_0040560_126_788 204
550 3300035114 Ga0373939_0074281 Ga0373939_0074281_417_1031 204
551 3300035114 Ga0373939_0113772 Ga0373939_0113772_312_926 204
552 3300035115 Ga0373941_0027364 Ga0373941_0027364_427_1089 204
553 3300035115 Ga0373941_0078473 Ga0373941_0078473_229_843 204
554 3300035118 Ga0373954_0000032 Ga0373954_0000032_15913_16530 204
555 3300035119 Ga0373956_0060881 Ga0373956_0060881_419_1036 204
556 3300035121 Ga0373960_0072352 Ga0373960_0072352_85_699 204
557 3300035121 Ga0373960_0091159 Ga0373960_0091159_198_812 204
558 3300035170 Ga0373943_0015453 Ga0373943_0015453_2202_2816 204
559 3300035171 Ga0373946_0004376 Ga0373946_0004376_4406_5020 204
560 3300035172 Ga0373955_0082820 Ga0373955_0082820_481_1098 204
561 3300035241 Ga0373961_0108783 Ga0373961_0108783_262_876 204
562 3300035410 Ga0373924_0024984 Ga0373924_0024984_91_708 204
563 3300035691 Ga0373931_0008988 Ga0373931_0008988_2877_3491 204
564 3300035691 Ga0373931_0159154 Ga0373931_0159154_299_913 204
565 3300035691 Ga0373931_0372671 Ga0373931_0372671_190_852 204
566 3300035692 Ga0373935_0024504 Ga0373935_0024504_2518_3135 204
567 3300035695 Ga0373927_0007300 Ga0373927_0007300_5783_6400 204
568 3300035724 Ga0373933_0007401 Ga0373933_0007401_1491_2108 204
569 3300035725 Ga0373947_0024500 Ga0373947_0024500_1843_2460 204
570 3300036401 Ga0373937_0006288 Ga0373937_0006288_5093_5710 204
571 3300037068 Ga0373925_0231515 Ga0373925_0231515_281_895 204
572 3300037068 Ga0373925_0345946 Ga0373925_0345946_309_926 204
573 3300041486 Ga0451807_1967121 Ga0451807_1967121_1527_2189 204
574 3300042013 Ga0439456_033300 Ga0439456_033300_262_876 204
575 3300042435 Ga0439434_0002357 Ga0439434_0002357_3089_3703 204
576 3300042436 Ga0439435_0000676 Ga0439435_0000676_3498_4112 204
577 3300042876 Ga0451577_0197282 Ga0451577_0197282_1096_1710 204
578 3300045051 Ga0451576_0003473 Ga0451576_0003473_20453_21067 204
579 3300045051 Ga0451576_0049688 Ga0451576_0049688_2877_3491 204
580 3300045051 Ga0451576_0530937 Ga0451576_0530937_158_772 204
581 3300046455 Ga0495603_0000212 Ga0495603_0000212_27647_28264 204
582 3300046462 Ga0495651_0158507 Ga0495651_0158507_473_1096 204
583 3300046472 Ga0495580_0000358 Ga0495580_0000358_5693_6310 204
584 3300046475 Ga0495639_0015755 Ga0495639_0015755_1084_1701 204
585 3300046499 Ga0495594_0123671 Ga0495594_0123671_119_736 204
586 3300046516 Ga0495628_0470421 Ga0495628_0470421_106_729 204
587 3300046517 Ga0495630_0046809 Ga0495630_0046809_2239_2856 204
588 3300046526 Ga0495666_0004532 Ga0495666_0004532_5071_5688 204
589 3300046535 Ga0495586_0003782 Ga0495586_0003782_6379_6996 204
590 3300046537 Ga0495598_0108243 Ga0495598_0108243_80_694 204
591 3300046681 Ga0495647_0000273 Ga0495647_0000273_6598_7215 204
592 3300046683 Ga0495658_0000620 Ga0495658_0000620_8178_8795 204
593 3300047315 Ga0495581_0020108 Ga0495581_0020108_997_1614 204
594 3300049568 Ga0501031_0568009 Ga0501031_0568009_11_631 204
595 3300049570 Ga0501033_0302959 Ga0501033_0302959_317_949 204
596 3300049574 Ga0501038_0210273 Ga0501038_0210273_926_1543 204
597 3300049577 Ga0501041_0118273 Ga0501041_0118273_61_693 204
598 3300049578 Ga0501042_0126504 Ga0501042_0126504_466_1083 204
599 3300049583 Ga0501067_0506835 Ga0501067_0506835_49_663 204
600 3300049585 Ga0501069_0061323 Ga0501069_0061323_786_1400 204
601 3300049587 Ga0501071_0557572 Ga0501071_0557572_175_792 204
602 3300049588 Ga0501072_0047052 Ga0501072_0047052_2062_2679 204
603 3300049588 Ga0501072_0060729 Ga0501072_0060729_946_1578 204
604 3300049588 Ga0501072_0767351 Ga0501072_0767351_131_745 204
605 3300049779 Ga0501283_034324 Ga0501283_034324_111_728 204
606 3300049824 Ga0501045_0574747 Ga0501045_0574747_104_721 204
607 3300050507 nmdc:mga05p37_5151_c1 nmdc:mga05p37_5151_c1_3321_3935 204
608 3300050508 nmdc:mga09592_111078_c1 nmdc:mga09592_111078_c1_1050_1664 204
609 3300050508 nmdc:mga09592_5031_c1 nmdc:mga09592_5031_c1_3130_3744 204
610 3300050508 nmdc:mga09592_66735_c1 nmdc:mga09592_66735_c1_2220_2837 204
611 3300050509 nmdc:mga0qj67_188814_c1 nmdc:mga0qj67_188814_c1_174_791 204
612 3300050509 nmdc:mga0qj67_309704_c1 nmdc:mga0qj67_309704_c1_69_683 204
613 3300050509 nmdc:mga0qj67_416279_c1 nmdc:mga0qj67_416279_c1_249_863 204
614 3300050510 nmdc:mga06r32_106764_c1 nmdc:mga06r32_106764_c1_1864_2481 204
615 3300050510 nmdc:mga06r32_190120_c1 nmdc:mga06r32_190120_c1_167_781 204
616 3300050510 nmdc:mga06r32_232898_c1 nmdc:mga06r32_232898_c1_395_1018 204
617 3300050511 nmdc:mga08y16_18790_c1 nmdc:mga08y16_18790_c1_6654_7268 204
618 3300050511 nmdc:mga08y16_33511_c1 nmdc:mga08y16_33511_c1_3450_4064 204
619 3300050511 nmdc:mga08y16_427085_c1 nmdc:mga08y16_427085_c1_715_1329 204
620 3300050511 nmdc:mga08y16_56264_c1 nmdc:mga08y16_56264_c1_3474_4091 204
621 3300050511 nmdc:mga08y16_69948_c1 nmdc:mga08y16_69948_c1_2135_2749 204
622 3300050512 nmdc:mga0n895_201043_c1 nmdc:mga0n895_201043_c1_574_1188 204
623 3300050512 nmdc:mga0n895_78559_c1 nmdc:mga0n895_78559_c1_2622_3236 204
624 3300050513 nmdc:mga0rr50_113866_c1 nmdc:mga0rr50_113866_c1_91_708 204
625 3300050513 nmdc:mga0rr50_381_c1 nmdc:mga0rr50_381_c1_14528_15142 204
626 3300050514 nmdc:mga08x19_21885_c1 nmdc:mga08x19_21885_c1_2085_2702 204
627 3300050514 nmdc:mga08x19_2762_c1 nmdc:mga08x19_2762_c1_6356_6970 204
628 3300050514 nmdc:mga08x19_37850_c1 nmdc:mga08x19_37850_c1_207_824 204
629 3300050514 nmdc:mga08x19_4927_c2 nmdc:mga08x19_4927_c2_4034_4648 204
630 3300050515 nmdc:mga0a205_93_c2 nmdc:mga0a205_93_c2_13595_14209 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

3

155

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vcp-assembly1.cif.gz_A crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin 0.954 4 165
5vcp-assembly2.cif.gz_B crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin 0.9539 4 165
5vcp-assembly2.cif.gz_D crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin 0.9528 2 165
5kob-assembly2.cif.gz_D crystal structure of a peptide deformylase from burkholderia xenovorans 0.9513 4 167
5vcp-assembly1.cif.gz_C crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin 0.9484 4 171
ID Description Score Start End Superfamily
5vcpA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.954 4 165 3.90.45.10
af_Q2G265_1_160_3.90.45.10 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9344 1 159 3.90.45.10
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9327 1 158 3.90.45.10
4je6A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9234 2 169 3.90.45.10
5mtdB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9222 4 152 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A6P2FFK4-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9771 1 168 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A2E4X5C6-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9693 1 196 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A380T935-F1-model_v4 Peptide deformylase 2 (EC 3.5.1.88) 0.9659 1 168 GO:0042586
GO:0043686
AF-A0A1G6WQC2-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9654 1 165 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A3C2DWQ1-F1-model_v4 Peptide deformylase (EC 3.5.1.88) 0.9652 1 132 GO:0042586
GO:0043686

Feature Viewer

pLDDT pTM Quality
91.79 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map