F470810

General Info

Members Datasets Scaffolds Average Seq Length
630 358 606 260

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100018930|Ga0070697_1000189306
Length 291
Sequence MAGLVPAIHVLTSHQRKTNDDNNTRPKSVESHLMDSLNPAAPPITLIPTQRSPRIWKFWGTALWGLFIFAAMFVGQIAVVAWFVLWREGPIDIAAAIHVVGGGLTISLSVIMGLPAVLAALWIAIRFSRTPFADYLALRWPSWTNLLIGVLALFVLVMGWDVLSRAAGREVAPGFMGEVLKSARADGALWLLVIAFTVAAPITEEFFARGFLYRGWSESFLGPVGAIILSSLVWTALHLQYDWFFFGEVFSIGLLLGYLRYRSNSTWLTVVVHGLNNLAAVVQTILLAGST

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
3 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
4 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
5 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
6 2643221651 Afipia sp. Root123D2 Isolate Unclassified
7 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
8 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
9 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
10 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
11 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
12 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
13 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
14 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
15 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
16 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
17 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
18 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
19 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
20 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
172 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
173 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
176 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
184 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
185 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
189 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
190 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
191 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
208 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
220 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
221 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
222 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
227 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
228 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
229 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
233 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
234 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
235 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
236 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
237 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
241 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
245 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
246 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
247 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
248 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
249 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
250 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
251 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
254 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
255 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
256 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
257 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
258 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
259 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
260 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
261 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
262 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
263 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
264 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
265 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
266 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
269 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
270 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
271 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
274 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
279 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
280 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
281 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
282 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
283 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
287 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
288 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
289 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
290 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
291 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
292 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
293 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
294 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
295 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
309 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
310 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
311 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
312 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
313 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
314 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
315 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
316 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
317 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
318 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
319 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
320 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
321 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
322 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
323 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
324 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
325 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
326 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
327 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
328 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
329 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
330 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
331 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
332 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
333 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
334 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
335 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
336 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
337 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
338 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
339 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
340 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
341 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
342 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
343 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
344 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
345 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
346 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
347 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
348 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
349 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
350 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
351 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
352 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
353 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
354 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
355 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
356 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
357 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
358 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.34
Metatranscriptomes 0
Isolates 3.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.27
Nodule 2.06
Rhizoplane 4.92
Rhizosphere 72.86
Stem 0
Stem Tuber 0
Unclassified 8.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000853 3300003203 Bacteria 14355
2 JGI25153J46596_10000691 3300003215 Bacteria 20594
3 rootH1_10266576 3300003323 Bacteria 1399
4 JGI25404J52841_10005203 3300003659 Bacteria 2682
5 JGI25404J52841_10013261 3300003659 Bacteria 1787
6 Ga0070658_10109923 3300005327 Bacteria 2283
7 Ga0070683_100003061 3300005329 Bacteria 13452
8 Ga0070670_100123979 3300005331 Bacteria 2230
9 Ga0068869_100052116 3300005334 Bacteria 2970
10 Ga0068869_100060565 3300005334 Bacteria 2774
11 Ga0070680_100148597 3300005336 Bacteria 1967
12 Ga0070682_100199466 3300005337 Bacteria 1410
13 Ga0070689_100312718 3300005340 Bacteria 1310
14 Ga0070691_10029773 3300005341 Bacteria 2556
15 Ga0070661_100233549 3300005344 Bacteria 1414
16 Ga0070692_10194924 3300005345 Bacteria 1183
17 Ga0070668_100172559 3300005347 Bacteria 1761
18 Ga0070668_100276841 3300005347 Bacteria 1400
19 Ga0070671_100490271 3300005355 Bacteria 1056
20 Ga0070674_100004144 3300005356 Bacteria 8232
21 Ga0070659_100086928 3300005366 Bacteria 2502
22 Ga0070709_10002233 3300005434 Bacteria 10499
23 Ga0070709_10021654 3300005434 Bacteria 3747
24 Ga0070709_10050453 3300005434 Bacteria 2607
25 Ga0070709_10230242 3300005434 Bacteria 1326
26 Ga0070714_100008237 3300005435 Bacteria 8125
27 Ga0070714_100022740 3300005435 Bacteria 5144
28 Ga0070714_100165361 3300005435 Bacteria 2005
29 Ga0070714_100479050 3300005435 Bacteria 1185
30 Ga0070713_100001790 3300005436 Bacteria 13842
31 Ga0070713_100009929 3300005436 Bacteria 6853
32 Ga0070713_100077740 3300005436 Bacteria 2823
33 Ga0070713_100146135 3300005436 Bacteria 2099
34 Ga0070713_100226263 3300005436 Bacteria 1699
35 Ga0070710_10002542 3300005437 Bacteria 8659
36 Ga0070710_10246362 3300005437 Bacteria 1147
37 Ga0070711_100414607 3300005439 Bacteria 1096
38 Ga0070663_100024377 3300005455 Bacteria 4071
39 Ga0070663_100030738 3300005455 Bacteria 3685
40 Ga0070663_100033369 3300005455 Bacteria 3556
41 Ga0070663_100058380 3300005455 Bacteria 2771
42 Ga0070663_100235031 3300005455 Bacteria 1445
43 Ga0070678_100367255 3300005456 Bacteria 1242
44 Ga0070662_100394145 3300005457 Bacteria 1142
45 Ga0070681_10136865 3300005458 Bacteria 2380
46 Ga0070681_10234838 3300005458 Bacteria 1748
47 Ga0068867_100344603 3300005459 Bacteria 1242
48 Ga0070706_100373428 3300005467 Bacteria 1328
49 Ga0070706_100561204 3300005467 Bacteria 1062
50 Ga0070698_100377167 3300005471 Bacteria 1351
51 Ga0070699_100060567 3300005518 Bacteria 3280
52 Ga0070679_100242574 3300005530 Bacteria 1759
53 Ga0070679_100625705 3300005530 Bacteria 1019
54 Ga0070684_100199198 3300005535 Bacteria 1823
55 Ga0070697_100018930 3300005536 Bacteria 5434
56 Ga0070697_100537122 3300005536 Bacteria 1025
57 Ga0068853_100036396 3300005539 Bacteria 4185
58 Ga0068853_100228228 3300005539 Bacteria 1702
59 Ga0068853_100507689 3300005539 Bacteria 1139
60 Ga0068853_100593507 3300005539 Bacteria 1051
61 Ga0070693_100116921 3300005547 Bacteria 1649
62 Ga0070665_100064873 3300005548 Bacteria 3663
63 Ga0070665_100104462 3300005548 Bacteria 2835
64 Ga0070665_100207151 3300005548 Bacteria 1962
65 Ga0068855_100093598 3300005563 Bacteria 3465
66 Ga0068855_100110749 3300005563 Bacteria 3151
67 Ga0068855_100169449 3300005563 Bacteria 2473
68 Ga0068855_100260114 3300005563 Bacteria 1933
69 Ga0068857_100078539 3300005577 Bacteria 2946
70 Ga0068856_100188455 3300005614 Bacteria 2076
71 Ga0068852_100066059 3300005616 Bacteria 3158
72 Ga0068852_100085700 3300005616 Bacteria 2807
73 Ga0068852_100149890 3300005616 Bacteria 2168
74 Ga0068859_100096291 3300005617 Bacteria 3012
75 Ga0068861_100083970 3300005719 Bacteria 2499
76 Ga0068861_100114747 3300005719 Bacteria 2163
77 Ga0068861_100516443 3300005719 Bacteria 1083
78 Ga0068870_10254690 3300005840 Bacteria 1090
79 Ga0068863_100195680 3300005841 Bacteria 1943
80 Ga0068858_100260996 3300005842 Bacteria 1646
81 Ga0068860_100175408 3300005843 Bacteria 2071
82 Ga0068862_100112782 3300005844 Bacteria 2388
83 Ga0068862_100150171 3300005844 Bacteria 2073
84 Ga0081455_10004176 3300005937 Bacteria 16283
85 Ga0081455_10010174 3300005937 Bacteria 9576
86 Ga0081455_10082583 3300005937 Bacteria 2628
87 Ga0081540_1000916 3300005983 Bacteria 26580
88 Ga0081540_1002076 3300005983 Bacteria 16707
89 Ga0081540_1007867 3300005983 Bacteria 7535
90 Ga0081540_1009948 3300005983 Bacteria 6485
91 Ga0081540_1010080 3300005983 Bacteria 6432
92 Ga0081540_1013183 3300005983 Bacteria 5392
93 Ga0081540_1023779 3300005983 Bacteria 3572
94 Ga0081540_1033556 3300005983 Bacteria 2785
95 Ga0081540_1038342 3300005983 Bacteria 2526
96 Ga0081540_1091421 3300005983 Bacteria 1338
97 Ga0081539_10000231 3300005985 Bacteria 131197
98 Ga0081539_10020813 3300005985 Bacteria 4411
99 Ga0070717_10011110 3300006028 Bacteria 6823
100 Ga0070717_10011832 3300006028 Bacteria 6639
101 Ga0070717_10155077 3300006028 Bacteria 1983
102 Ga0075365_10008505 3300006038 Bacteria 5836
103 Ga0075365_10009018 3300006038 Bacteria 5704
104 Ga0075368_10038622 3300006042 Bacteria 1869
105 Ga0075363_100004318 3300006048 Bacteria 6190
106 Ga0075364_10096502 3300006051 Bacteria 1966
107 Ga0075364_10106705 3300006051 Bacteria 1866
108 Ga0075364_10191583 3300006051 Bacteria 1385
109 Ga0070715_10001251 3300006163 Bacteria 7276
110 Ga0070716_100001709 3300006173 Bacteria 9895
111 Ga0070712_100001161 3300006175 Bacteria 15933
112 Ga0070712_100121902 3300006175 Bacteria 1963
113 Ga0075362_10031729 3300006177 Bacteria 2288
114 Ga0075367_10004932 3300006178 Bacteria 6577
115 Ga0075367_10086371 3300006178 Bacteria 1904
116 Ga0097621_100179502 3300006237 Bacteria 1829
117 Ga0075370_10005485 3300006353 Bacteria 6313
118 Ga0068871_100227010 3300006358 Bacteria 1619
119 Ga0075434_100058499 3300006871 Bacteria 3831
120 Ga0075434_100255361 3300006871 Bacteria 1772
121 Ga0097620_100096286 3300006931 Bacteria 3012
122 Ga0099794_10037474 3300007265 Bacteria 2295
123 Ga0099794_10093914 3300007265 Bacteria 1491
124 Ga0099795_10043655 3300007788 Bacteria 1605
125 Ga0099795_10044626 3300007788 Bacteria 1591
126 Ga0105240_10010935 3300009093 Bacteria 12718
127 Ga0105240_10086695 3300009093 Bacteria 3835
128 Ga0105240_10380741 3300009093 Bacteria 1594
129 Ga0105240_10393842 3300009093 Bacteria 1562
130 Ga0111539_10107307 3300009094 Bacteria 3276
131 Ga0105247_10080814 3300009101 Bacteria 2048
132 Ga0114129_10089261 3300009147 Bacteria 4273
133 Ga0105243_10021839 3300009148 Bacteria 4860
134 Ga0105243_10122579 3300009148 Bacteria 2194
135 Ga0105241_10004891 3300009174 Bacteria 9881
136 Ga0105248_10126043 3300009177 Bacteria 2889
137 Ga0105248_10234871 3300009177 Bacteria 2064
138 Ga0105237_10055128 3300009545 Bacteria 3982
139 Ga0105237_10081307 3300009545 Bacteria 3230
140 Ga0105237_10103828 3300009545 Bacteria 2834
141 Ga0105237_10301210 3300009545 Bacteria 1606
142 Ga0105237_10552242 3300009545 Bacteria 1158
143 Ga0105238_10029225 3300009551 Bacteria 5617
144 Ga0105238_10215461 3300009551 Bacteria 1896
145 Ga0105249_10177450 3300009553 Bacteria 2070
146 Ga0099796_10006618 3300010159 Bacteria 2980
147 Ga0105239_10051701 3300010375 Bacteria 4504
148 Ga0105239_10152234 3300010375 Bacteria 2582
149 Ga0105239_10176562 3300010375 Bacteria 2389
150 Ga0105239_10333746 3300010375 Bacteria 1711
151 Ga0105239_10562033 3300010375 Bacteria 1300
152 Ga0105239_10909895 3300010375 Bacteria 1010
153 Ga0105246_10326456 3300011119 Bacteria 1249
154 Ga0157370_10033888 3300013104 Bacteria 4977
155 Ga0157370_10226401 3300013104 Bacteria 1731
156 Ga0157370_10227914 3300013104 Bacteria 1725
157 Ga0157369_10020068 3300013105 Bacteria 7474
158 Ga0157369_10059704 3300013105 Bacteria 4113
159 Ga0157369_10084240 3300013105 Bacteria 3398
160 Ga0157369_10299154 3300013105 Bacteria 1674
161 Ga0157374_10305588 3300013296 Bacteria 1574
162 Ga0157374_10433744 3300013296 Bacteria 1314
163 Ga0157378_10312619 3300013297 Bacteria 1524
164 Ga0163162_10174038 3300013306 Bacteria 2277
165 Ga0163162_10697794 3300013306 Bacteria 1137
166 Ga0157372_10141856 3300013307 Bacteria 2769
167 Ga0157375_10104163 3300013308 Bacteria 2926
168 Ga0157375_10307999 3300013308 Bacteria 1748
169 Ga0163163_10368519 3300014325 Bacteria 1493
170 Ga0157380_10086780 3300014326 Bacteria 2572
171 Ga0157380_10236593 3300014326 Bacteria 1644
172 Ga0157377_10094537 3300014745 Bacteria 1771
173 Ga0157376_10222800 3300014969 Bacteria 1748
174 Ga0157376_10276499 3300014969 Bacteria 1580
175 Ga0157376_10680951 3300014969 Bacteria 1032
176 Ga0163161_10041961 3300017792 Bacteria 3289
177 Ga0213872_10038795 3300021361 Bacteria 2174
178 Ga0213876_10075853 3300021384 Bacteria 1776
179 Ga0207653_10013839 3300025885 Bacteria 2528
180 Ga0207692_10006314 3300025898 Bacteria 4803
181 Ga0207692_10059541 3300025898 Bacteria 1972
182 Ga0207692_10334133 3300025898 Bacteria 930
183 Ga0207642_10066243 3300025899 Bacteria 1700
184 Ga0207710_10017955 3300025900 Bacteria 3005
185 Ga0207710_10058250 3300025900 Bacteria 1746
186 Ga0207688_10072741 3300025901 Bacteria 1953
187 Ga0207647_10142011 3300025904 Bacteria 1407
188 Ga0207699_10032420 3300025906 Bacteria 2944
189 Ga0207699_10109690 3300025906 Bacteria 1767
190 Ga0207645_10076652 3300025907 Bacteria 2142
191 Ga0207643_10070736 3300025908 Bacteria 2007
192 Ga0207643_10207891 3300025908 Bacteria 1194
193 Ga0207707_10032881 3300025912 Bacteria 4540
194 Ga0207707_10223247 3300025912 Bacteria 1640
195 Ga0207695_10080329 3300025913 Bacteria 3302
196 Ga0207695_10119813 3300025913 Bacteria 2601
197 Ga0207695_10282252 3300025913 Bacteria 1554
198 Ga0207671_10220117 3300025914 Bacteria 1487
199 Ga0207671_10232885 3300025914 Bacteria 1445
200 Ga0207693_10002224 3300025915 Bacteria 16891
201 Ga0207693_10010627 3300025915 Bacteria 7469
202 Ga0207693_10098488 3300025915 Bacteria 2293
203 Ga0207663_10004497 3300025916 Bacteria 6939
204 Ga0207663_10076274 3300025916 Bacteria 2178
205 Ga0207660_10247507 3300025917 Bacteria 1406
206 Ga0207660_10255958 3300025917 Bacteria 1383
207 Ga0207657_10128699 3300025919 Bacteria 2077
208 Ga0207657_10238841 3300025919 Bacteria 1451
209 Ga0207649_10154426 3300025920 Bacteria 1584
210 Ga0207652_10059534 3300025921 Bacteria 3293
211 Ga0207694_10151031 3300025924 Bacteria 1871
212 Ga0207694_10208588 3300025924 Bacteria 1591
213 Ga0207650_10163541 3300025925 Bacteria 1765
214 Ga0207687_10515325 3300025927 Bacteria 1000
215 Ga0207700_10001654 3300025928 Bacteria 12677
216 Ga0207700_10043237 3300025928 Bacteria 3308
217 Ga0207700_10057360 3300025928 Bacteria 2936
218 Ga0207664_10023714 3300025929 Bacteria 4602
219 Ga0207664_10185348 3300025929 Bacteria 1789
220 Ga0207664_10695904 3300025929 Bacteria 914
221 Ga0207644_10148517 3300025931 Bacteria 1812
222 Ga0207644_10362503 3300025931 Bacteria 1179
223 Ga0207690_10195817 3300025932 Bacteria 1531
224 Ga0207690_10398114 3300025932 Bacteria 1098
225 Ga0207706_10206067 3300025933 Bacteria 1724
226 Ga0207709_10080150 3300025935 Bacteria 2102
227 Ga0207669_10002996 3300025937 Bacteria 7269
228 Ga0207704_10474287 3300025938 Bacteria 1003
229 Ga0207665_10001251 3300025939 Bacteria 17140
230 Ga0207665_10125910 3300025939 Bacteria 1814
231 Ga0207665_10331897 3300025939 Bacteria 1144
232 Ga0207691_10136105 3300025940 Bacteria 2167
233 Ga0207711_10059809 3300025941 Bacteria 3281
234 Ga0207689_10006687 3300025942 Bacteria 10172
235 Ga0207661_10001651 3300025944 Bacteria 15207
236 Ga0207679_10153634 3300025945 Bacteria 1877
237 Ga0207667_10069936 3300025949 Bacteria 3654
238 Ga0207667_10127208 3300025949 Bacteria 2625
239 Ga0207667_10187767 3300025949 Bacteria 2121
240 Ga0207667_10270002 3300025949 Bacteria 1739
241 Ga0207667_10581632 3300025949 Bacteria 1130
242 Ga0207712_10086004 3300025961 Bacteria 2303
243 Ga0207668_10013209 3300025972 Bacteria 5077
244 Ga0207668_10229939 3300025972 Bacteria 1494
245 Ga0207677_10335451 3300026023 Bacteria 1261
246 Ga0207703_10073383 3300026035 Bacteria 2831
247 Ga0207703_10660064 3300026035 Bacteria 992
248 Ga0207639_10008087 3300026041 Bacteria 7191
249 Ga0207639_10329279 3300026041 Bacteria 1358
250 Ga0207639_10457932 3300026041 Bacteria 1159
251 Ga0207639_10474916 3300026041 Bacteria 1139
252 Ga0207678_10099645 3300026067 Bacteria 2482
253 Ga0207678_10122781 3300026067 Bacteria 2216
254 Ga0207678_10143838 3300026067 Bacteria 2035
255 Ga0207678_10162232 3300026067 Bacteria 1909
256 Ga0207678_10273604 3300026067 Bacteria 1448
257 Ga0207702_10444428 3300026078 Bacteria 1257
258 Ga0207641_10520009 3300026088 Bacteria 1157
259 Ga0207648_10081718 3300026089 Bacteria 2818
260 Ga0207648_10133732 3300026089 Bacteria 2183
261 Ga0207676_10632015 3300026095 Bacteria 1031
262 Ga0207674_10091694 3300026116 Bacteria 3028
263 Ga0207674_10315174 3300026116 Bacteria 1513
264 Ga0207683_10216239 3300026121 Bacteria 1746
265 Ga0209179_1030046 3300027512 Bacteria 1109
266 Ga0209588_1028195 3300027671 Bacteria 1787
267 Ga0209813_10024321 3300027866 Bacteria 1731
268 Ga0268266_10002460 3300028379 Bacteria 19801
269 Ga0268266_10004661 3300028379 Bacteria 13065
270 Ga0268266_10015920 3300028379 Bacteria 6435
271 Ga0268265_10099590 3300028380 Bacteria 2343
272 Ga0268265_10133879 3300028380 Bacteria 2064
273 Ga0268264_10349515 3300028381 Bacteria 1407
274 Ga0307517_10000369 3300028786 Bacteria 77795
275 Ga0307515_10030519 3300028794 Bacteria 9043
276 Ga0307515_10090921 3300028794 Bacteria 3821
277 Ga0265330_10007158 3300031235 Bacteria 5465
278 Ga0265332_10084409 3300031238 Bacteria 1346
279 Ga0265328_10089627 3300031239 Bacteria 1136
280 Ga0265328_10108623 3300031239 Bacteria 1030
281 Ga0265325_10080950 3300031241 Bacteria 1614
282 Ga0265340_10000672 3300031247 Bacteria 19165
283 Ga0265339_10079649 3300031249 Bacteria 1733
284 Ga0265316_10367121 3300031344 Bacteria 1040
285 Ga0307508_10108597 3300031616 Bacteria 2374
286 Ga0265314_10123764 3300031711 Bacteria 1623
287 Ga0265342_10075248 3300031712 Bacteria 1960
288 Ga0307516_10038865 3300031730 Bacteria 4745
289 Ga0307516_10186034 3300031730 Bacteria 1807
290 Ga0307409_100299265 3300031995 Bacteria 1496
291 Ga0307510_10000998 3300033180 Bacteria 30010
292 Ga0307510_10019012 3300033180 Bacteria 8062
293 Ga0373934_0001558 3300035086 Bacteria 8414
294 Ga0373923_0001683 3300035111 Bacteria 6465
295 Ga0373936_0091225 3300035113 Bacteria 1278
296 Ga0373945_0035194 3300035116 Bacteria 1789
297 Ga0373945_0107868 3300035116 Bacteria 1096
298 Ga0373953_0000361 3300035117 Bacteria 12290
299 Ga0373954_0000316 3300035118 Bacteria 17666
300 Ga0373954_0007882 3300035118 Bacteria 4664
301 Ga0373956_0000552 3300035119 Bacteria 15350
302 Ga0373956_0099565 3300035119 Bacteria 1347
303 Ga0373957_0001213 3300035120 Bacteria 6888
304 Ga0373957_0013764 3300035120 Bacteria 2752
305 Ga0373943_0018493 3300035170 Bacteria 3203
306 Ga0373946_0023704 3300035171 Bacteria 2400
307 Ga0373955_0000487 3300035172 Bacteria 16820
308 Ga0373955_0121564 3300035172 Bacteria 1518
309 Ga0373931_0008509 3300035691 Bacteria 4870
310 Ga0373927_0000689 3300035695 Bacteria 25810
311 Ga0373927_0018091 3300035695 Bacteria 4635
312 Ga0373927_0271665 3300035695 Bacteria 1115
313 Ga0373933_0000457 3300035724 Bacteria 25599
314 Ga0373933_0002519 3300035724 Bacteria 10290
315 Ga0373933_0123293 3300035724 Bacteria 1624
316 Ga0373947_0175808 3300035725 Bacteria 1391
317 Ga0373937_0009000 3300036401 Bacteria 8667
318 Ga0373937_0054595 3300036401 Bacteria 3667
319 Ga0373937_0106364 3300036401 Bacteria 2608
320 Ga0373937_0277395 3300036401 Bacteria 1582
321 Ga0373937_0473322 3300036401 Bacteria 1190
322 Ga0373925_0012575 3300037068 Bacteria 6134
323 Ga0373925_0310041 3300037068 Bacteria 1275
324 Ga0395899_0016476 3300037312 Bacteria 5636
325 Ga0395900_0069888 3300037418 Bacteria 3610
326 Ga0395900_0086492 3300037418 Bacteria 3222
327 Ga0395900_0095571 3300037418 Bacteria 3053
328 Ga0395900_0704694 3300037418 Bacteria 943
329 Ga0395898_0069601 3300037466 Bacteria 3404
330 Ga0395905_0247717 3300037471 Bacteria 1665
331 Ga0395901_0025301 3300038443 Bacteria 6093
332 Ga0395901_0170599 3300038443 Bacteria 2283
333 Ga0436365_0093056 3300039437 Bacteria 1193
334 Ga0436365_0481530 3300039437 Bacteria 3606
335 Ga0436361_1013230 3300039447 Bacteria 2454
336 Ga0466966_0136977 3300044684 Bacteria 1497
337 Ga0466963_0025384 3300044694 Bacteria 3779
338 Ga0495592_0003091 3300046454 Bacteria 11883
339 Ga0495592_0023120 3300046454 Bacteria 4728
340 Ga0495603_0000177 3300046455 Bacteria 32632
341 Ga0495603_0009078 3300046455 Bacteria 6010
342 Ga0495603_0034092 3300046455 Bacteria 3063
343 Ga0495629_0000398 3300046459 Bacteria 36605
344 Ga0495629_0035132 3300046459 Bacteria 3543
345 Ga0495629_0076861 3300046459 Bacteria 2330
346 Ga0495638_0029482 3300046460 Bacteria 3538
347 Ga0495638_0095492 3300046460 Bacteria 1785
348 Ga0495638_0237532 3300046460 Bacteria 1011
349 Ga0495651_0118563 3300046462 Bacteria 1947
350 Ga0495651_0236674 3300046462 Bacteria 1254
351 Ga0495653_0000598 3300046463 Bacteria 27691
352 Ga0495580_0000787 3300046472 Bacteria 27379
353 Ga0495582_0000270 3300046473 Bacteria 29034
354 Ga0495639_0000934 3300046475 Bacteria 13202
355 Ga0495639_0046735 3300046475 Bacteria 1960
356 Ga0495639_0132649 3300046475 Bacteria 1193
357 Ga0495662_0000993 3300046476 Bacteria 13882
358 Ga0495662_0072779 3300046476 Bacteria 1667
359 Ga0495664_0010266 3300046477 Bacteria 5254
360 Ga0495594_0020026 3300046499 Bacteria 3561
361 Ga0495596_0051846 3300046500 Bacteria 1607
362 Ga0495608_0003605 3300046511 Bacteria 11110
363 Ga0495608_0048171 3300046511 Bacteria 2832
364 Ga0495618_0031249 3300046514 Bacteria 3330
365 Ga0495628_0020320 3300046516 Bacteria 5480
366 Ga0495628_0059387 3300046516 Bacteria 3002
367 Ga0495628_0173347 3300046516 Bacteria 1635
368 Ga0495632_0023495 3300046519 Bacteria 3292
369 Ga0495643_0051248 3300046522 Bacteria 2221
370 Ga0495644_0036429 3300046523 Bacteria 1856
371 Ga0495644_0063134 3300046523 Bacteria 1392
372 Ga0495648_0000552 3300046524 Bacteria 40192
373 Ga0495648_0121754 3300046524 Bacteria 1401
374 Ga0495652_0009837 3300046529 Bacteria 8667
375 Ga0495652_0053793 3300046529 Bacteria 3430
376 Ga0495665_0003851 3300046531 Bacteria 8124
377 Ga0495640_0018303 3300046533 Bacteria 5200
378 Ga0495640_0180467 3300046533 Bacteria 1345
379 Ga0495587_0001477 3300046536 Bacteria 15649
380 Ga0495587_0018599 3300046536 Bacteria 4309
381 Ga0495587_0240779 3300046536 Bacteria 1018
382 Ga0495598_0016764 3300046537 Bacteria 1876
383 Ga0495645_0013443 3300046543 Bacteria 5787
384 Ga0495645_0026867 3300046543 Bacteria 4180
385 Ga0495645_0048587 3300046543 Bacteria 3089
386 Ga0495622_0187537 3300046557 Bacteria 925
387 Ga0495633_0039699 3300046558 Bacteria 2245
388 Ga0495667_0001371 3300046559 Bacteria 16022
389 Ga0495656_0014338 3300046615 Bacteria 2970
390 Ga0495656_0044632 3300046615 Bacteria 1867
391 Ga0495634_0001270 3300046642 Bacteria 23127
392 Ga0495634_0021114 3300046642 Bacteria 4609
393 Ga0495611_0073044 3300046648 Bacteria 1570
394 Ga0495625_0114741 3300046660 Bacteria 1839
395 Ga0495625_0171506 3300046660 Bacteria 1448
396 Ga0495625_0355898 3300046660 Bacteria 924
397 Ga0495635_0000102 3300046663 Bacteria 50623
398 Ga0495635_0000463 3300046663 Bacteria 25676
399 Ga0495659_0026752 3300046664 Bacteria 1985
400 Ga0495659_0030017 3300046664 Bacteria 1890
401 Ga0495661_0165612 3300046665 Bacteria 1183
402 Ga0495588_0007900 3300046674 Bacteria 4860
403 Ga0495588_0054875 3300046674 Bacteria 2056
404 Ga0495657_0000677 3300046675 Bacteria 30671
405 Ga0495657_0242038 3300046675 Bacteria 1088
406 Ga0495599_0001270 3300046678 Bacteria 14337
407 Ga0495599_0053286 3300046678 Bacteria 2534
408 Ga0495599_0075486 3300046678 Bacteria 2105
409 Ga0495623_0000625 3300046679 Bacteria 23594
410 Ga0495623_0004014 3300046679 Bacteria 9684
411 Ga0495623_0048172 3300046679 Bacteria 2704
412 Ga0495646_0003261 3300046680 Bacteria 10094
413 Ga0495646_0016166 3300046680 Bacteria 4737
414 Ga0495646_0026066 3300046680 Bacteria 3672
415 Ga0495647_0001462 3300046681 Bacteria 7325
416 Ga0495647_0095922 3300046681 Bacteria 1222
417 Ga0495658_0000636 3300046683 Bacteria 19065
418 Ga0495658_0107627 3300046683 Bacteria 1673
419 Ga0495669_0004639 3300046684 Bacteria 5696
420 Ga0495669_0052783 3300046684 Bacteria 1827
421 Ga0495669_0143892 3300046684 Bacteria 1126
422 Ga0495613_0015258 3300046689 Bacteria 5711
423 Ga0495613_0282693 3300046689 Bacteria 1152
424 Ga0495624_0000635 3300046690 Bacteria 27507
425 Ga0495624_0047924 3300046690 Bacteria 2714
426 Ga0495670_0030185 3300046691 Bacteria 2693
427 Ga0495671_0088814 3300046692 Bacteria 1513
428 Ga0495600_0004238 3300046809 Bacteria 8566
429 Ga0495600_0276929 3300046809 Bacteria 1063
430 Ga0495581_0000666 3300047315 Bacteria 18025
431 Ga0495604_0002400 3300047317 Bacteria 15012
432 Ga0495604_0057108 3300047317 Bacteria 3001
433 Ga0495674_0001332 3300047319 Bacteria 24063
434 Ga0495674_0028322 3300047319 Bacteria 5110
435 Ga0495672_0006967 3300047320 Bacteria 8596
436 Ga0495676_0026159 3300047321 Bacteria 5027
437 Ga0495676_0289656 3300047321 Bacteria 1107
438 Ga0495680_0003276 3300047322 Bacteria 16054
439 Ga0495680_0030065 3300047322 Bacteria 4440
440 Ga0495680_0405393 3300047322 Bacteria 941
441 Ga0495675_0000456 3300047444 Bacteria 26992
442 Ga0495685_024527 3300047447 Bacteria 2076
443 Ga0495684_0000088 3300047471 Bacteria 64704
444 Ga0495684_0018537 3300047471 Bacteria 5362
445 Ga0495593_0001738 3300047673 Bacteria 12907
446 Ga0495593_0003108 3300047673 Bacteria 9989
447 Ga0495602_0023364 3300048088 Bacteria 6024
448 Ga0495602_0095292 3300048088 Bacteria 2457
449 Ga0495614_0017326 3300048089 Bacteria 3130
450 Ga0496100_0110818 3300048903 Bacteria 1906
451 Ga0496101_0042282 3300048904 Bacteria 3253
452 Ga0496101_0075487 3300048904 Bacteria 2481
453 Ga0496102_0075575 3300048905 Bacteria 3097
454 Ga0496102_0091895 3300048905 Bacteria 2810
455 Ga0496103_0285117 3300048906 Bacteria 1062
456 Ga0496104_0271820 3300048907 Bacteria 1607
457 Ga0496105_0090242 3300048908 Bacteria 2531
458 Ga0496106_0130805 3300048909 Bacteria 1968
459 Ga0496106_0192418 3300048909 Bacteria 1622
460 Ga0496106_0387529 3300048909 Bacteria 1123
461 Ga0496107_0043664 3300048910 Bacteria 3221
462 Ga0496107_0275090 3300048910 Bacteria 1253
463 Ga0496108_0082776 3300048911 Bacteria 2722
464 Ga0496109_0194808 3300048912 Bacteria 1905
465 Ga0496109_0686808 3300048912 Bacteria 961
466 Ga0496110_0059716 3300048913 Bacteria 3362
467 Ga0496110_0155507 3300048913 Bacteria 2071
468 Ga0496111_0029904 3300048914 Bacteria 3871
469 Ga0496111_0050002 3300048914 Bacteria 3014
470 Ga0496112_0128228 3300048915 Bacteria 2508
471 Ga0496112_0148467 3300048915 Bacteria 2312
472 Ga0496112_0184912 3300048915 Bacteria 2047
473 Ga0496112_0378119 3300048915 Bacteria 1357
474 Ga0496113_0021547 3300048916 Bacteria 4547
475 Ga0496113_0031385 3300048916 Bacteria 3856
476 Ga0496113_0264527 3300048916 Bacteria 1374
477 Ga0496115_0013657 3300048918 Bacteria 6147
478 Ga0496115_0015011 3300048918 Bacteria 5871
479 Ga0496115_0192380 3300048918 Bacteria 1685
480 Ga0496116_0000614 3300048919 Bacteria 47004
481 Ga0496116_0131350 3300048919 Bacteria 1427
482 Ga0496117_0053851 3300048920 Bacteria 2823
483 Ga0496117_0094278 3300048920 Bacteria 1916
484 Ga0496117_0201766 3300048920 Bacteria 1123
485 Ga0496118_0022339 3300048921 Bacteria 5535
486 Ga0496118_0060323 3300048921 Bacteria 2817
487 Ga0496118_0113873 3300048921 Bacteria 1785
488 Ga0496119_0070945 3300048922 Bacteria 2041
489 Ga0496119_0082040 3300048922 Bacteria 1855
490 Ga0496121_0001831 3300048924 Bacteria 34280
491 Ga0496121_0004034 3300048924 Bacteria 20175
492 Ga0496121_0005947 3300048924 Bacteria 15432
493 Ga0496121_0030689 3300048924 Bacteria 4931
494 Ga0496121_0035373 3300048924 Bacteria 4479
495 Ga0496121_0093988 3300048924 Bacteria 2333
496 Ga0496121_0094086 3300048924 Bacteria 2332
497 Ga0496121_0247436 3300048924 Bacteria 1238
498 Ga0496121_0267178 3300048924 Bacteria 1178
499 Ga0496121_0345145 3300048924 Bacteria 993
500 Ga0496123_0026472 3300048926 Bacteria 4342
501 Ga0496124_0084507 3300048927 Bacteria 2602
502 Ga0496124_0165219 3300048927 Bacteria 1721
503 Ga0496124_0450592 3300048927 Bacteria 878
504 Ga0496125_0024640 3300048928 Bacteria 5527
505 Ga0496125_0045551 3300048928 Bacteria 3689
506 Ga0496126_0014520 3300048929 Bacteria 7957
507 Ga0496126_0021086 3300048929 Bacteria 6373
508 Ga0496126_0022214 3300048929 Bacteria 6177
509 Ga0496126_0104296 3300048929 Bacteria 2477
510 Ga0496126_0132457 3300048929 Bacteria 2153
511 Ga0496126_0155357 3300048929 Bacteria 1958
512 Ga0496126_0224218 3300048929 Bacteria 1577
513 Ga0496126_0269117 3300048929 Bacteria 1414
514 Ga0501031_0168821 3300049568 Bacteria 1430
515 Ga0501031_0228355 3300049568 Bacteria 1212
516 Ga0501031_0307165 3300049568 Bacteria 1028
517 Ga0501032_0012575 3300049569 Bacteria 6044
518 Ga0501033_0067426 3300049570 Bacteria 2631
519 Ga0501033_0229516 3300049570 Bacteria 1319
520 Ga0501036_0010711 3300049572 Bacteria 7580
521 Ga0501037_0179541 3300049573 Bacteria 1502
522 Ga0501038_0002212 3300049574 Bacteria 18090
523 Ga0501038_0055463 3300049574 Bacteria 3404
524 Ga0501042_0436386 3300049578 Bacteria 949
525 Ga0501043_0012610 3300049579 Bacteria 6611
526 Ga0501047_0137957 3300049581 Bacteria 2318
527 Ga0501047_0143083 3300049581 Bacteria 2269
528 Ga0501048_0111351 3300049582 Bacteria 1933
529 Ga0501070_0063872 3300049586 Bacteria 3050
530 Ga0501035_0015312 3300049822 Bacteria 7077
531 Ga0501035_0198318 3300049822 Bacteria 1723
532 Ga0501035_0352052 3300049822 Bacteria 1232
533 Ga0501044_0061332 3300049823 Bacteria 3847
534 Ga0501044_0143034 3300049823 Bacteria 2379
535 nmdc:mga03683_29970_c1 3300050489 Bacteria 2174
536 nmdc:mga03n38_4403_c1 3300050490 Bacteria 4662
537 nmdc:mga00v17_217566_c1 3300050491 Bacteria 1236
538 nmdc:mga00v17_40947_c1 3300050491 Bacteria 2780
539 nmdc:mga00v17_5942_c1 3300050491 Bacteria 2477
540 nmdc:mga0yw44_2168_c1 3300050492 Bacteria 8242
541 nmdc:mga0yw44_23552_c1 3300050492 Bacteria 3471
542 nmdc:mga0yw44_84927_c1 3300050492 Bacteria 1991
543 nmdc:mga06z11_28787_c1 3300050494 Bacteria 2669
544 nmdc:mga04h51_111832_c1 3300050495 Bacteria 1008
545 nmdc:mga05p37_450826_c1 3300050507 Bacteria 1489
546 nmdc:mga0n895_13512_c1 3300050512 Bacteria 7370
547 nmdc:mga08x19_347232_c1 3300050514 Bacteria 1035
548 nmdc:mga08x19_73275_c1 3300050514 Bacteria 2235
549 nmdc:mga0sz30_40561_c1 3300050516 Bacteria 1957
550 Ga0495601_0013055 3300053077 Bacteria 4993
551 Ga0495601_0043899 3300053077 Bacteria 2808
552 Ga0495601_0144267 3300053077 Bacteria 1554
553 Ga0495595_0010622 3300053084 Bacteria 3830
554 Ga0495595_0067281 3300053084 Bacteria 1688
555 Ga0495595_0081213 3300053084 Bacteria 1544
556 Ga0495619_0021169 3300053085 Bacteria 4149
557 Ga0495619_0104382 3300053085 Bacteria 1931
558 Ga0495619_0114567 3300053085 Bacteria 1845
559 Ga0500643_065857 3300053087 Bacteria 1010
560 Ga0500644_0048683 3300053088 Bacteria 1443
561 Ga0500646_0027375 3300053090 Bacteria 1551
562 Ga0500583_0055684 3300053092 Bacteria 1850
563 Ga0500583_0136295 3300053092 Bacteria 1219
564 Ga0500641_0000746 3300053096 Bacteria 11801
565 Ga0500641_0084511 3300053096 Bacteria 1350
566 Ga0500650_0003633 3300053098 Bacteria 5420
567 Ga0500554_014121 3300053102 Bacteria 2053
568 Ga0500556_0000030 3300053104 Bacteria 165098
569 Ga0500562_059472 3300053108 Bacteria 1026
570 Ga0500572_001228 3300053111 Bacteria 7232
571 Ga0500595_000159 3300053119 Bacteria 44312
572 Ga0500595_001073 3300053119 Bacteria 15180
573 Ga0500595_001169 3300053119 Bacteria 14529
574 Ga0500595_027758 3300053119 Bacteria 1935
575 Ga0500595_053585 3300053119 Bacteria 1241
576 Ga0500642_0000028 3300053130 Bacteria 117281
577 Ga0500642_0073725 3300053130 Bacteria 1557
578 Ga0500642_0115160 3300053130 Bacteria 1256
579 Ga0500652_000170 3300053131 Bacteria 25102
580 Ga0500655_033405 3300053133 Bacteria 995
581 Ga0500658_0035552 3300053134 Bacteria 1972
582 Ga0500559_0000204 3300053136 Bacteria 47160
583 Ga0500559_0000579 3300053136 Bacteria 25120
584 Ga0500568_0000772 3300053139 Bacteria 22609
585 Ga0500586_005334 3300053145 Bacteria 3243
586 Ga0500590_065914 3300053148 Bacteria 1809
587 Ga0500603_000967 3300053150 Bacteria 6789
588 Ga0500604_0008804 3300053151 Bacteria 2680
589 Ga0500616_0000139 3300053153 Bacteria 123841
590 Ga0500616_0000413 3300053153 Bacteria 57779
591 Ga0500622_0011373 3300053156 Bacteria 4848
592 Ga0500622_0033941 3300053156 Bacteria 2674
593 Ga0500633_0079896 3300053160 Bacteria 1182
594 Ga0500634_0099648 3300053161 Bacteria 1457
595 Ga0500638_016399 3300053162 Bacteria 3418
596 Ga0500639_010198 3300053163 Bacteria 4918
597 Ga0500636_0027080 3300053177 Bacteria 3385
598 Ga0500637_0000349 3300053178 Bacteria 17523
599 Ga0500637_0029118 3300053178 Bacteria 3061
600 Ga0500637_0032667 3300053178 Bacteria 2902
601 Ga0500645_016868 3300053730 Bacteria 2296
602 Ga0500645_025154 3300053730 Bacteria 1817
603 Ga0500609_012676 3300053731 Bacteria 1140
604 Ga0500656_012338 3300053732 Bacteria 964
605 Ga0500596_001122 3300053735 Bacteria 5382
606 Ga0466962_0083658 3300061719 Bacteria 1527

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003659 JGI25404J52841_10005203 JGI25404J52841_100052032 205
2 3300053096 Ga0500641_0084511 Ga0500641_0084511_660_1322 218
3 3300009545 Ga0105237_10055128 Ga0105237_100551284 233
4 3300044694 Ga0466963_0025384 Ga0466963_0025384_810_1538 233
5 3300025949 Ga0207667_10581632 Ga0207667_105816322 234
6 3300037418 Ga0395900_0704694 Ga0395900_0704694_14_796 235
7 3300049568 Ga0501031_0228355 Ga0501031_0228355_11_787 235
8 3300049568 Ga0501031_0307165 Ga0501031_0307165_196_981 235
9 3300049586 Ga0501070_0063872 Ga0501070_0063872_1064_1840 235
10 3300049822 Ga0501035_0198318 Ga0501035_0198318_625_1410 235
11 3300048910 Ga0496107_0043664 Ga0496107_0043664_2088_2861 237
12 3300048924 Ga0496121_0005947 Ga0496121_0005947_11957_12730 237
13 3300048929 Ga0496126_0022214 Ga0496126_0022214_2829_3602 237
14 3300013296 Ga0157374_10305588 Ga0157374_103055882 239
15 3300048912 Ga0496109_0194808 Ga0496109_0194808_162_944 239
16 3300048915 Ga0496112_0148467 Ga0496112_0148467_961_1743 239
17 3300005434 Ga0070709_10002233 Ga0070709_100022334 240
18 3300005435 Ga0070714_100008237 Ga0070714_1000082372 240
19 3300005436 Ga0070713_100009929 Ga0070713_1000099295 240
20 3300005437 Ga0070710_10002542 Ga0070710_100025422 240
21 3300005458 Ga0070681_10136865 Ga0070681_101368652 240
22 3300005539 Ga0068853_100593507 Ga0068853_1005935072 240
23 3300006028 Ga0070717_10155077 Ga0070717_101550772 240
24 3300006163 Ga0070715_10001251 Ga0070715_100012516 240
25 3300006173 Ga0070716_100001709 Ga0070716_10000170912 240
26 3300025898 Ga0207692_10059541 Ga0207692_100595411 240
27 3300025915 Ga0207693_10002224 Ga0207693_100022246 240
28 3300025916 Ga0207663_10004497 Ga0207663_100044978 240
29 3300025928 Ga0207700_10043237 Ga0207700_100432372 240
30 3300025939 Ga0207665_10001251 Ga0207665_100012517 240
31 3300025949 Ga0207667_10270002 Ga0207667_102700022 240
32 3300049578 Ga0501042_0436386 Ga0501042_0436386_13_795 243
33 3300046523 Ga0495644_0036429 Ga0495644_0036429_69_809 244
34 3300046615 Ga0495656_0014338 Ga0495656_0014338_1676_2416 244
35 3300046664 Ga0495659_0026752 Ga0495659_0026752_972_1712 244
36 3300047447 Ga0495685_024527 Ga0495685_024527_928_1668 244
37 3300048924 Ga0496121_0001831 Ga0496121_0001831_17213_17956 244
38 iso_pu_bacteria 2643221651 2644288151 244
39 3300005435 Ga0070714_100165361 Ga0070714_1001653611 245
40 3300025916 Ga0207663_10076274 Ga0207663_100762742 245
41 3300025929 Ga0207664_10695904 Ga0207664_106959041 245
42 3300037312 Ga0395899_0016476 Ga0395899_0016476_1007_1792 245
43 3300037418 Ga0395900_0095571 Ga0395900_0095571_1806_2591 245
44 3300037466 Ga0395898_0069601 Ga0395898_0069601_802_1587 245
45 3300038443 Ga0395901_0025301 Ga0395901_0025301_2132_2917 245
46 3300046459 Ga0495629_0035132 Ga0495629_0035132_1276_2070 245
47 3300046475 Ga0495639_0046735 Ga0495639_0046735_877_1614 245
48 3300049569 Ga0501032_0012575 Ga0501032_0012575_2205_2990 245
49 3300049570 Ga0501033_0229516 Ga0501033_0229516_350_1135 245
50 3300049572 Ga0501036_0010711 Ga0501036_0010711_6508_7293 245
51 3300049573 Ga0501037_0179541 Ga0501037_0179541_650_1435 245
52 3300049574 Ga0501038_0055463 Ga0501038_0055463_1665_2450 245
53 3300049579 Ga0501043_0012610 Ga0501043_0012610_197_982 245
54 3300049581 Ga0501047_0137957 Ga0501047_0137957_990_1775 245
55 3300049582 Ga0501048_0111351 Ga0501048_0111351_1022_1807 245
56 3300049822 Ga0501035_0015312 Ga0501035_0015312_178_963 245
57 3300049822 Ga0501035_0352052 Ga0501035_0352052_256_1032 245
58 3300049823 Ga0501044_0061332 Ga0501044_0061332_2022_2807 245
59 3300053119 Ga0500595_053585 Ga0500595_053585_430_1170 245
60 3300053153 Ga0500616_0000139 Ga0500616_0000139_74548_75312 245
61 iso_pu_bacteria 2824679649 2824686376 245
62 iso_pu_bacteria 2876808645 2876813186 245
63 iso_pu_bacteria 2879110137 2879110350 245
64 iso_pu_bacteria 2885366525 2885373403 245
65 iso_pu_bacteria 2922393267 2922395474 245
66 3300046648 Ga0495611_0073044 Ga0495611_0073044_811_1557 246
67 3300049568 Ga0501031_0168821 Ga0501031_0168821_661_1410 246
68 iso_pu_bacteria 2513237141 2513889370 246
69 3300026041 Ga0207639_10474916 Ga0207639_104749162 247
70 3300049570 Ga0501033_0067426 Ga0501033_0067426_1234_1989 247
71 iso_pu_bacteria 2524023205 2524439722 247
72 iso_pu_bacteria 2602042107 2603859758 247
73 iso_pu_bacteria 2857524615 2857530638 247
74 iso_pu_bacteria 2893066018 2893070283 247
75 iso_pu_bacteria 2919073203 2919076236 247
76 3300005439 Ga0070711_100414607 Ga0070711_1004146072 248
77 3300010375 Ga0105239_10909895 Ga0105239_109098951 248
78 3300044684 Ga0466966_0136977 Ga0466966_0136977_24_797 248
79 3300048924 Ga0496121_0035373 Ga0496121_0035373_3099_3863 248
80 3300048929 Ga0496126_0155357 Ga0496126_0155357_714_1478 248
81 3300053156 Ga0500622_0033941 Ga0500622_0033941_1863_2648 248
82 3300005617 Ga0068859_100096291 Ga0068859_1000962914 249
83 3300006931 Ga0097620_100096286 Ga0097620_1000962864 249
84 3300035113 Ga0373936_0091225 Ga0373936_0091225_27_788 249
85 3300037418 Ga0395900_0086492 Ga0395900_0086492_2343_3119 249
86 3300048911 Ga0496108_0082776 Ga0496108_0082776_1774_2553 249
87 3300048919 Ga0496116_0131350 Ga0496116_0131350_648_1412 249
88 3300048924 Ga0496121_0030689 Ga0496121_0030689_277_1056 249
89 3300048924 Ga0496121_0094086 Ga0496121_0094086_1246_2028 249
90 3300049581 Ga0501047_0143083 Ga0501047_0143083_795_1601 249
91 3300050514 nmdc:mga08x19_73275_c1 nmdc:mga08x19_73275_c1_97_873 249
92 iso_pu_bacteria 2508501128 2509153269 249
93 iso_pu_bacteria 2791355199 2793082686 249
94 iso_pu_bacteria 2889033259 2889040770 249
95 iso_pu_bacteria 8006984368 8006990556 249
96 3300005434 Ga0070709_10050453 Ga0070709_100504533 250
97 3300005844 Ga0068862_100150171 Ga0068862_1001501712 250
98 3300007788 Ga0099795_10044626 Ga0099795_100446262 250
99 3300025906 Ga0207699_10032420 Ga0207699_100324202 250
100 3300025939 Ga0207665_10331897 Ga0207665_103318972 250
101 3300031616 Ga0307508_10108597 Ga0307508_101085973 250
102 iso_pu_bacteria 2513237101 2513691663 250
103 iso_pu_bacteria 2721755755 2723845918 250
104 iso_pu_bacteria 2874604998 2874609428 250
105 iso_pu_bacteria 2922361189 2922367871 250
106 iso_pu_bacteria 2922386360 2922392239 250
107 iso_pu_bacteria 8006964411 8006968702 250
108 iso_pu_bacteria 8006994254 8006996312 250
109 iso_pu_bacteria 8056673599 8056678110 250
110 3300003323 rootH1_10266576 rootH1_102665762 251
111 3300005327 Ga0070658_10109923 Ga0070658_101099232 251
112 3300005329 Ga0070683_100003061 Ga0070683_1000030617 251
113 3300005336 Ga0070680_100148597 Ga0070680_1001485972 251
114 3300005341 Ga0070691_10029773 Ga0070691_100297732 251
115 3300005344 Ga0070661_100233549 Ga0070661_1002335492 251
116 3300005366 Ga0070659_100086928 Ga0070659_1000869283 251
117 3300005434 Ga0070709_10021654 Ga0070709_100216543 251
118 3300005434 Ga0070709_10230242 Ga0070709_102302422 251
119 3300005435 Ga0070714_100022740 Ga0070714_1000227403 251
120 3300005436 Ga0070713_100001790 Ga0070713_1000017907 251
121 3300005436 Ga0070713_100146135 Ga0070713_1001461352 251
122 3300005436 Ga0070713_100226263 Ga0070713_1002262632 251
123 3300005437 Ga0070710_10246362 Ga0070710_102463621 251
124 3300005458 Ga0070681_10234838 Ga0070681_102348382 251
125 3300005530 Ga0070679_100242574 Ga0070679_1002425742 251
126 3300005530 Ga0070679_100625705 Ga0070679_1006257051 251
127 3300005535 Ga0070684_100199198 Ga0070684_1001991983 251
128 3300005539 Ga0068853_100036396 Ga0068853_1000363962 251
129 3300005539 Ga0068853_100507689 Ga0068853_1005076892 251
130 3300005548 Ga0070665_100207151 Ga0070665_1002071512 251
131 3300005563 Ga0068855_100110749 Ga0068855_1001107492 251
132 3300005577 Ga0068857_100078539 Ga0068857_1000785393 251
133 3300005614 Ga0068856_100188455 Ga0068856_1001884552 251
134 3300005616 Ga0068852_100066059 Ga0068852_1000660592 251
135 3300005616 Ga0068852_100085700 Ga0068852_1000857002 251
136 3300005983 Ga0081540_1000916 Ga0081540_100091624 251
137 3300005983 Ga0081540_1091421 Ga0081540_10914211 251
138 3300006028 Ga0070717_10011832 Ga0070717_100118325 251
139 3300006051 Ga0075364_10191583 Ga0075364_101915831 251
140 3300006175 Ga0070712_100001161 Ga0070712_1000011614 251
141 3300006175 Ga0070712_100121902 Ga0070712_1001219022 251
142 3300006871 Ga0075434_100058499 Ga0075434_1000584992 251
143 3300007265 Ga0099794_10093914 Ga0099794_100939142 251
144 3300009093 Ga0105240_10010935 Ga0105240_100109358 251
145 3300009093 Ga0105240_10086695 Ga0105240_100866953 251
146 3300009093 Ga0105240_10393842 Ga0105240_103938422 251
147 3300009101 Ga0105247_10080814 Ga0105247_100808142 251
148 3300009177 Ga0105248_10126043 Ga0105248_101260434 251
149 3300009545 Ga0105237_10081307 Ga0105237_100813072 251
150 3300009545 Ga0105237_10301210 Ga0105237_103012103 251
151 3300009545 Ga0105237_10552242 Ga0105237_105522422 251
152 3300009551 Ga0105238_10029225 Ga0105238_100292253 251
153 3300009551 Ga0105238_10215461 Ga0105238_102154612 251
154 3300010375 Ga0105239_10051701 Ga0105239_100517013 251
155 3300010375 Ga0105239_10176562 Ga0105239_101765622 251
156 3300010375 Ga0105239_10333746 Ga0105239_103337462 251
157 3300013104 Ga0157370_10033888 Ga0157370_100338883 251
158 3300013104 Ga0157370_10226401 Ga0157370_102264012 251
159 3300013104 Ga0157370_10227914 Ga0157370_102279142 251
160 3300013105 Ga0157369_10020068 Ga0157369_100200688 251
161 3300013105 Ga0157369_10059704 Ga0157369_100597043 251
162 3300013105 Ga0157369_10299154 Ga0157369_102991542 251
163 3300013307 Ga0157372_10141856 Ga0157372_101418563 251
164 3300013308 Ga0157375_10104163 Ga0157375_101041632 251
165 3300014325 Ga0163163_10368519 Ga0163163_103685192 251
166 3300014969 Ga0157376_10222800 Ga0157376_102228002 251
167 3300021361 Ga0213872_10038795 Ga0213872_100387952 251
168 3300021384 Ga0213876_10075853 Ga0213876_100758532 251
169 3300025898 Ga0207692_10006314 Ga0207692_100063141 251
170 3300025898 Ga0207692_10334133 Ga0207692_103341331 251
171 3300025900 Ga0207710_10017955 Ga0207710_100179553 251
172 3300025906 Ga0207699_10109690 Ga0207699_101096902 251
173 3300025912 Ga0207707_10032881 Ga0207707_100328813 251
174 3300025912 Ga0207707_10223247 Ga0207707_102232472 251
175 3300025913 Ga0207695_10080329 Ga0207695_100803293 251
176 3300025913 Ga0207695_10119813 Ga0207695_101198132 251
177 3300025913 Ga0207695_10282252 Ga0207695_102822522 251
178 3300025914 Ga0207671_10220117 Ga0207671_102201172 251
179 3300025914 Ga0207671_10232885 Ga0207671_102328852 251
180 3300025915 Ga0207693_10010627 Ga0207693_100106272 251
181 3300025915 Ga0207693_10098488 Ga0207693_100984882 251
182 3300025917 Ga0207660_10247507 Ga0207660_102475072 251
183 3300025917 Ga0207660_10255958 Ga0207660_102559582 251
184 3300025920 Ga0207649_10154426 Ga0207649_101544262 251
185 3300025921 Ga0207652_10059534 Ga0207652_100595341 251
186 3300025924 Ga0207694_10208588 Ga0207694_102085882 251
187 3300025928 Ga0207700_10001654 Ga0207700_100016547 251
188 3300025929 Ga0207664_10023714 Ga0207664_100237143 251
189 3300025931 Ga0207644_10362503 Ga0207644_103625032 251
190 3300025932 Ga0207690_10195817 Ga0207690_101958172 251
191 3300025932 Ga0207690_10398114 Ga0207690_103981142 251
192 3300025938 Ga0207704_10474287 Ga0207704_104742871 251
193 3300025944 Ga0207661_10001651 Ga0207661_100016519 251
194 3300026023 Ga0207677_10335451 Ga0207677_103354512 251
195 3300026035 Ga0207703_10073383 Ga0207703_100733832 251
196 3300026035 Ga0207703_10660064 Ga0207703_106600641 251
197 3300026041 Ga0207639_10457932 Ga0207639_104579322 251
198 3300026078 Ga0207702_10444428 Ga0207702_104444282 251
199 3300026116 Ga0207674_10091694 Ga0207674_100916942 251
200 3300026121 Ga0207683_10216239 Ga0207683_102162392 251
201 3300028786 Ga0307517_10000369 Ga0307517_1000036918 251
202 3300028794 Ga0307515_10030519 Ga0307515_100305192 251
203 3300028794 Ga0307515_10090921 Ga0307515_100909212 251
204 3300031235 Ga0265330_10007158 Ga0265330_100071589 251
205 3300031730 Ga0307516_10038865 Ga0307516_100388653 251
206 3300033180 Ga0307510_10019012 Ga0307510_100190125 251
207 3300035116 Ga0373945_0107868 Ga0373945_0107868_263_1033 251
208 3300035691 Ga0373931_0008509 Ga0373931_0008509_1872_2642 251
209 3300035695 Ga0373927_0271665 Ga0373927_0271665_16_786 251
210 3300035724 Ga0373933_0000457 Ga0373933_0000457_15310_16089 251
211 3300036401 Ga0373937_0054595 Ga0373937_0054595_862_1647 251
212 3300037418 Ga0395900_0069888 Ga0395900_0069888_489_1271 251
213 3300038443 Ga0395901_0170599 Ga0395901_0170599_873_1655 251
214 3300039437 Ga0436365_0093056 Ga0436365_0093056_300_1079 251
215 3300039437 Ga0436365_0481530 Ga0436365_0481530_1891_2676 251
216 3300039447 Ga0436361_1013230 Ga0436361_1013230_849_1643 251
217 3300046460 Ga0495638_0029482 Ga0495638_0029482_135_929 251
218 3300046460 Ga0495638_0237532 Ga0495638_0237532_15_788 251
219 3300046462 Ga0495651_0118563 Ga0495651_0118563_734_1519 251
220 3300046524 Ga0495648_0000552 Ga0495648_0000552_17551_18333 251
221 3300046524 Ga0495648_0121754 Ga0495648_0121754_422_1207 251
222 3300046543 Ga0495645_0048587 Ga0495645_0048587_1591_2367 251
223 3300046660 Ga0495625_0114741 Ga0495625_0114741_708_1481 251
224 3300046660 Ga0495625_0171506 Ga0495625_0171506_388_1182 251
225 3300046660 Ga0495625_0355898 Ga0495625_0355898_63_836 251
226 3300046665 Ga0495661_0165612 Ga0495661_0165612_136_930 251
227 3300046674 Ga0495588_0054875 Ga0495588_0054875_1173_1967 251
228 3300046678 Ga0495599_0075486 Ga0495599_0075486_1067_1843 251
229 3300046679 Ga0495623_0048172 Ga0495623_0048172_1874_2659 251
230 3300046683 Ga0495658_0107627 Ga0495658_0107627_842_1615 251
231 3300047320 Ga0495672_0006967 Ga0495672_0006967_2319_3092 251
232 3300048903 Ga0496100_0110818 Ga0496100_0110818_459_1229 251
233 3300048904 Ga0496101_0042282 Ga0496101_0042282_1113_1886 251
234 3300048904 Ga0496101_0075487 Ga0496101_0075487_1199_1969 251
235 3300048908 Ga0496105_0090242 Ga0496105_0090242_1084_1854 251
236 3300048909 Ga0496106_0192418 Ga0496106_0192418_516_1286 251
237 3300048913 Ga0496110_0155507 Ga0496110_0155507_159_929 251
238 3300048914 Ga0496111_0029904 Ga0496111_0029904_180_950 251
239 3300048915 Ga0496112_0184912 Ga0496112_0184912_458_1228 251
240 3300048916 Ga0496113_0021547 Ga0496113_0021547_3713_4483 251
241 3300048918 Ga0496115_0015011 Ga0496115_0015011_2180_2950 251
242 3300048918 Ga0496115_0192380 Ga0496115_0192380_731_1498 251
243 3300048919 Ga0496116_0000614 Ga0496116_0000614_22333_23127 251
244 3300048920 Ga0496117_0053851 Ga0496117_0053851_1635_2429 251
245 3300048920 Ga0496117_0094278 Ga0496117_0094278_1039_1833 251
246 3300048920 Ga0496117_0201766 Ga0496117_0201766_188_967 251
247 3300048921 Ga0496118_0022339 Ga0496118_0022339_1816_2595 251
248 3300048921 Ga0496118_0060323 Ga0496118_0060323_578_1372 251
249 3300048921 Ga0496118_0113873 Ga0496118_0113873_830_1624 251
250 3300048922 Ga0496119_0082040 Ga0496119_0082040_224_1018 251
251 3300048924 Ga0496121_0004034 Ga0496121_0004034_7409_8203 251
252 3300048924 Ga0496121_0093988 Ga0496121_0093988_527_1306 251
253 3300048926 Ga0496123_0026472 Ga0496123_0026472_1843_2637 251
254 3300048927 Ga0496124_0165219 Ga0496124_0165219_308_1114 251
255 3300048927 Ga0496124_0450592 Ga0496124_0450592_27_821 251
256 3300048928 Ga0496125_0024640 Ga0496125_0024640_2638_3432 251
257 3300048928 Ga0496125_0045551 Ga0496125_0045551_918_1724 251
258 3300048929 Ga0496126_0014520 Ga0496126_0014520_3787_4572 251
259 3300048929 Ga0496126_0104296 Ga0496126_0104296_1079_1855 251
260 3300048929 Ga0496126_0269117 Ga0496126_0269117_567_1361 251
261 3300049574 Ga0501038_0002212 Ga0501038_0002212_11287_12069 251
262 3300049823 Ga0501044_0143034 Ga0501044_0143034_1556_2338 251
263 3300050491 nmdc:mga00v17_217566_c1 nmdc:mga00v17_217566_c1_108_902 251
264 3300050492 nmdc:mga0yw44_84927_c1 nmdc:mga0yw44_84927_c1_654_1448 251
265 3300050512 nmdc:mga0n895_13512_c1 nmdc:mga0n895_13512_c1_2923_3780 251
266 3300050516 nmdc:mga0sz30_40561_c1 nmdc:mga0sz30_40561_c1_858_1652 251
267 3300053077 Ga0495601_0144267 Ga0495601_0144267_404_1177 251
268 3300053084 Ga0495595_0067281 Ga0495595_0067281_115_888 251
269 3300053088 Ga0500644_0048683 Ga0500644_0048683_73_867 251
270 3300053092 Ga0500583_0136295 Ga0500583_0136295_249_1034 251
271 3300053098 Ga0500650_0003633 Ga0500650_0003633_128_922 251
272 3300053104 Ga0500556_0000030 Ga0500556_0000030_124344_125138 251
273 3300053111 Ga0500572_001228 Ga0500572_001228_5396_6202 251
274 3300053119 Ga0500595_001073 Ga0500595_001073_13609_14391 251
275 3300053119 Ga0500595_027758 Ga0500595_027758_1143_1922 251
276 3300053130 Ga0500642_0000028 Ga0500642_0000028_44389_45183 251
277 3300053131 Ga0500652_000170 Ga0500652_000170_14934_15728 251
278 3300053134 Ga0500658_0035552 Ga0500658_0035552_580_1374 251
279 3300053136 Ga0500559_0000204 Ga0500559_0000204_5094_5879 251
280 3300053136 Ga0500559_0000579 Ga0500559_0000579_11444_12250 251
281 3300053139 Ga0500568_0000772 Ga0500568_0000772_16401_17195 251
282 3300053145 Ga0500586_005334 Ga0500586_005334_400_1194 251
283 3300053151 Ga0500604_0008804 Ga0500604_0008804_1072_1866 251
284 3300053153 Ga0500616_0000413 Ga0500616_0000413_20327_21121 251
285 3300053156 Ga0500622_0011373 Ga0500622_0011373_243_1022 251
286 3300053160 Ga0500633_0079896 Ga0500633_0079896_274_1068 251
287 3300053163 Ga0500639_010198 Ga0500639_010198_3145_3951 251
288 3300053177 Ga0500636_0027080 Ga0500636_0027080_187_966 251
289 3300053735 Ga0500596_001122 Ga0500596_001122_4518_5324 251
290 3300061719 Ga0466962_0083658 Ga0466962_0083658_95_874 251
291 3300005435 Ga0070714_100479050 Ga0070714_1004790502 252
292 3300005436 Ga0070713_100077740 Ga0070713_1000777404 252
293 3300005455 Ga0070663_100033369 Ga0070663_1000333694 252
294 3300005536 Ga0070697_100018930 Ga0070697_1000189306 252
295 3300005563 Ga0068855_100260114 Ga0068855_1002601142 252
296 3300005983 Ga0081540_1010080 Ga0081540_10100803 252
297 3300006028 Ga0070717_10011110 Ga0070717_100111104 252
298 3300013105 Ga0157369_10084240 Ga0157369_100842404 252
299 3300025928 Ga0207700_10057360 Ga0207700_100573602 252
300 3300025929 Ga0207664_10185348 Ga0207664_101853482 252
301 3300025949 Ga0207667_10187767 Ga0207667_101877672 252
302 3300026067 Ga0207678_10099645 Ga0207678_100996454 252
303 3300035086 Ga0373934_0001558 Ga0373934_0001558_2204_2980 252
304 3300035111 Ga0373923_0001683 Ga0373923_0001683_5651_6427 252
305 3300035117 Ga0373953_0000361 Ga0373953_0000361_7690_8466 252
306 3300035118 Ga0373954_0000316 Ga0373954_0000316_11107_11883 252
307 3300035119 Ga0373956_0000552 Ga0373956_0000552_5694_6470 252
308 3300035120 Ga0373957_0001213 Ga0373957_0001213_5653_6429 252
309 3300035172 Ga0373955_0000487 Ga0373955_0000487_7118_7894 252
310 3300035724 Ga0373933_0002519 Ga0373933_0002519_9183_9959 252
311 3300036401 Ga0373937_0009000 Ga0373937_0009000_332_1108 252
312 3300046454 Ga0495592_0003091 Ga0495592_0003091_3532_4308 252
313 3300046459 Ga0495629_0000398 Ga0495629_0000398_25192_25968 252
314 3300046462 Ga0495651_0236674 Ga0495651_0236674_460_1236 252
315 3300046463 Ga0495653_0000598 Ga0495653_0000598_7560_8336 252
316 3300046511 Ga0495608_0003605 Ga0495608_0003605_2825_3601 252
317 3300046514 Ga0495618_0031249 Ga0495618_0031249_2096_2872 252
318 3300046516 Ga0495628_0020320 Ga0495628_0020320_2132_2908 252
319 3300046529 Ga0495652_0009837 Ga0495652_0009837_332_1108 252
320 3300046533 Ga0495640_0018303 Ga0495640_0018303_3331_4107 252
321 3300046536 Ga0495587_0001477 Ga0495587_0001477_5955_6731 252
322 3300046543 Ga0495645_0013443 Ga0495645_0013443_2880_3656 252
323 3300046559 Ga0495667_0001371 Ga0495667_0001371_7865_8641 252
324 3300046663 Ga0495635_0000102 Ga0495635_0000102_9189_9965 252
325 3300046675 Ga0495657_0000677 Ga0495657_0000677_10539_11315 252
326 3300046678 Ga0495599_0001270 Ga0495599_0001270_5955_6731 252
327 3300046679 Ga0495623_0000625 Ga0495623_0000625_14350_15126 252
328 3300046680 Ga0495646_0003261 Ga0495646_0003261_2698_3474 252
329 3300046809 Ga0495600_0004238 Ga0495600_0004238_460_1236 252
330 3300047317 Ga0495604_0002400 Ga0495604_0002400_6851_7627 252
331 3300047319 Ga0495674_0028322 Ga0495674_0028322_855_1631 252
332 3300047322 Ga0495680_0003276 Ga0495680_0003276_7769_8545 252
333 3300047444 Ga0495675_0000456 Ga0495675_0000456_15678_16454 252
334 3300047471 Ga0495684_0000088 Ga0495684_0000088_7701_8477 252
335 3300047673 Ga0495593_0001738 Ga0495593_0001738_8964_9740 252
336 3300048088 Ga0495602_0023364 Ga0495602_0023364_2825_3601 252
337 3300048918 Ga0496115_0013657 Ga0496115_0013657_709_1485 252
338 3300048929 Ga0496126_0021086 Ga0496126_0021086_352_1125 252
339 3300053077 Ga0495601_0013055 Ga0495601_0013055_3328_4104 252
340 3300053084 Ga0495595_0010622 Ga0495595_0010622_829_1605 252
341 3300053085 Ga0495619_0021169 Ga0495619_0021169_2914_3690 252
342 3300053102 Ga0500554_014121 Ga0500554_014121_954_1733 252
343 3300053119 Ga0500595_000159 Ga0500595_000159_15940_16719 252
344 3300053162 Ga0500638_016399 Ga0500638_016399_1539_2318 252
345 3300053178 Ga0500637_0000349 Ga0500637_0000349_10998_11777 252
346 3300005334 Ga0068869_100060565 Ga0068869_1000605653 253
347 3300005337 Ga0070682_100199466 Ga0070682_1001994662 253
348 3300005355 Ga0070671_100490271 Ga0070671_1004902711 253
349 3300005455 Ga0070663_100024377 Ga0070663_1000243774 253
350 3300005455 Ga0070663_100030738 Ga0070663_1000307385 253
351 3300005455 Ga0070663_100058380 Ga0070663_1000583803 253
352 3300005457 Ga0070662_100394145 Ga0070662_1003941452 253
353 3300005518 Ga0070699_100060567 Ga0070699_1000605673 253
354 3300005547 Ga0070693_100116921 Ga0070693_1001169211 253
355 3300005548 Ga0070665_100064873 Ga0070665_1000648733 253
356 3300005548 Ga0070665_100104462 Ga0070665_1001044623 253
357 3300005563 Ga0068855_100093598 Ga0068855_1000935983 253
358 3300006038 Ga0075365_10009018 Ga0075365_100090182 253
359 3300006048 Ga0075363_100004318 Ga0075363_1000043187 253
360 3300006051 Ga0075364_10096502 Ga0075364_100965022 253
361 3300006177 Ga0075362_10031729 Ga0075362_100317292 253
362 3300006178 Ga0075367_10004932 Ga0075367_100049323 253
363 3300006237 Ga0097621_100179502 Ga0097621_1001795022 253
364 3300006353 Ga0075370_10005485 Ga0075370_100054851 253
365 3300009147 Ga0114129_10089261 Ga0114129_100892612 253
366 3300013296 Ga0157374_10433744 Ga0157374_104337442 253
367 3300013306 Ga0163162_10697794 Ga0163162_106977942 253
368 3300013308 Ga0157375_10307999 Ga0157375_103079992 253
369 3300014969 Ga0157376_10680951 Ga0157376_106809511 253
370 3300025900 Ga0207710_10058250 Ga0207710_100582502 253
371 3300025901 Ga0207688_10072741 Ga0207688_100727412 253
372 3300025908 Ga0207643_10207891 Ga0207643_102078911 253
373 3300025931 Ga0207644_10148517 Ga0207644_101485172 253
374 3300025940 Ga0207691_10136105 Ga0207691_101361052 253
375 3300025949 Ga0207667_10069936 Ga0207667_100699362 253
376 3300025961 Ga0207712_10086004 Ga0207712_100860042 253
377 3300026041 Ga0207639_10329279 Ga0207639_103292792 253
378 3300026067 Ga0207678_10122781 Ga0207678_101227812 253
379 3300026067 Ga0207678_10162232 Ga0207678_101622322 253
380 3300026067 Ga0207678_10273604 Ga0207678_102736042 253
381 3300027512 Ga0209179_1030046 Ga0209179_10300462 253
382 3300027866 Ga0209813_10024321 Ga0209813_100243212 253
383 3300028379 Ga0268266_10002460 Ga0268266_1000246019 253
384 3300028379 Ga0268266_10015920 Ga0268266_100159202 253
385 3300028380 Ga0268265_10099590 Ga0268265_100995902 253
386 3300033180 Ga0307510_10000998 Ga0307510_1000099819 253
387 3300037471 Ga0395905_0247717 Ga0395905_0247717_349_1197 253
388 3300046500 Ga0495596_0051846 Ga0495596_0051846_132_974 253
389 3300046519 Ga0495632_0023495 Ga0495632_0023495_802_1650 253
390 3300046522 Ga0495643_0051248 Ga0495643_0051248_982_1830 253
391 3300046684 Ga0495669_0143892 Ga0495669_0143892_241_1083 253
392 3300046692 Ga0495671_0088814 Ga0495671_0088814_498_1346 253
393 3300046809 Ga0495600_0276929 Ga0495600_0276929_140_967 253
394 3300048905 Ga0496102_0091895 Ga0496102_0091895_1363_2136 253
395 3300048907 Ga0496104_0271820 Ga0496104_0271820_576_1349 253
396 3300048909 Ga0496106_0130805 Ga0496106_0130805_458_1231 253
397 3300048922 Ga0496119_0070945 Ga0496119_0070945_128_904 253
398 3300048924 Ga0496121_0267178 Ga0496121_0267178_12_785 253
399 3300048924 Ga0496121_0345145 Ga0496121_0345145_88_864 253
400 3300048927 Ga0496124_0084507 Ga0496124_0084507_1188_1964 253
401 3300048929 Ga0496126_0132457 Ga0496126_0132457_892_1665 253
402 3300048929 Ga0496126_0224218 Ga0496126_0224218_190_969 253
403 3300050489 nmdc:mga03683_29970_c1 nmdc:mga03683_29970_c1_932_1711 253
404 3300050490 nmdc:mga03n38_4403_c1 nmdc:mga03n38_4403_c1_1648_2421 253
405 3300050491 nmdc:mga00v17_40947_c1 nmdc:mga00v17_40947_c1_299_1072 253
406 3300050492 nmdc:mga0yw44_2168_c1 nmdc:mga0yw44_2168_c1_1856_2704 253
407 3300050492 nmdc:mga0yw44_23552_c1 nmdc:mga0yw44_23552_c1_2136_2909 253
408 3300050494 nmdc:mga06z11_28787_c1 nmdc:mga06z11_28787_c1_516_1289 253
409 3300050495 nmdc:mga04h51_111832_c1 nmdc:mga04h51_111832_c1_196_969 253
410 3300050507 nmdc:mga05p37_450826_c1 nmdc:mga05p37_450826_c1_278_1126 253
411 3300053087 Ga0500643_065857 Ga0500643_065857_207_986 253
412 3300053096 Ga0500641_0000746 Ga0500641_0000746_7891_8670 253
413 3300053108 Ga0500562_059472 Ga0500562_059472_116_964 253
414 3300053119 Ga0500595_001169 Ga0500595_001169_8534_9382 253
415 3300053130 Ga0500642_0073725 Ga0500642_0073725_495_1343 253
416 3300053133 Ga0500655_033405 Ga0500655_033405_29_877 253
417 3300053148 Ga0500590_065914 Ga0500590_065914_789_1568 253
418 3300053178 Ga0500637_0032667 Ga0500637_0032667_1642_2421 253
419 3300053730 Ga0500645_016868 Ga0500645_016868_10_858 253
420 3300053732 Ga0500656_012338 Ga0500656_012338_49_897 253
421 3300003203 JGI25406J46586_10000853 JGI25406J46586_1000085313 254
422 3300003215 JGI25153J46596_10000691 JGI25153J46596_1000069116 254
423 3300003659 JGI25404J52841_10013261 JGI25404J52841_100132612 254
424 3300005331 Ga0070670_100123979 Ga0070670_1001239791 254
425 3300005334 Ga0068869_100052116 Ga0068869_1000521162 254
426 3300005340 Ga0070689_100312718 Ga0070689_1003127182 254
427 3300005345 Ga0070692_10194924 Ga0070692_101949242 254
428 3300005347 Ga0070668_100172559 Ga0070668_1001725592 254
429 3300005347 Ga0070668_100276841 Ga0070668_1002768412 254
430 3300005356 Ga0070674_100004144 Ga0070674_1000041447 254
431 3300005455 Ga0070663_100235031 Ga0070663_1002350311 254
432 3300005456 Ga0070678_100367255 Ga0070678_1003672551 254
433 3300005459 Ga0068867_100344603 Ga0068867_1003446032 254
434 3300005467 Ga0070706_100373428 Ga0070706_1003734282 254
435 3300005467 Ga0070706_100561204 Ga0070706_1005612041 254
436 3300005471 Ga0070698_100377167 Ga0070698_1003771672 254
437 3300005536 Ga0070697_100537122 Ga0070697_1005371222 254
438 3300005539 Ga0068853_100228228 Ga0068853_1002282281 254
439 3300005563 Ga0068855_100169449 Ga0068855_1001694492 254
440 3300005616 Ga0068852_100149890 Ga0068852_1001498902 254
441 3300005719 Ga0068861_100083970 Ga0068861_1000839702 254
442 3300005719 Ga0068861_100114747 Ga0068861_1001147472 254
443 3300005719 Ga0068861_100516443 Ga0068861_1005164432 254
444 3300005840 Ga0068870_10254690 Ga0068870_102546902 254
445 3300005841 Ga0068863_100195680 Ga0068863_1001956802 254
446 3300005842 Ga0068858_100260996 Ga0068858_1002609961 254
447 3300005843 Ga0068860_100175408 Ga0068860_1001754082 254
448 3300005844 Ga0068862_100112782 Ga0068862_1001127822 254
449 3300005937 Ga0081455_10004176 Ga0081455_100041766 254
450 3300005937 Ga0081455_10010174 Ga0081455_100101747 254
451 3300005937 Ga0081455_10082583 Ga0081455_100825832 254
452 3300005983 Ga0081540_1002076 Ga0081540_10020763 254
453 3300005983 Ga0081540_1007867 Ga0081540_10078673 254
454 3300005983 Ga0081540_1009948 Ga0081540_10099484 254
455 3300005983 Ga0081540_1013183 Ga0081540_10131834 254
456 3300005983 Ga0081540_1023779 Ga0081540_10237796 254
457 3300005983 Ga0081540_1033556 Ga0081540_10335562 254
458 3300005983 Ga0081540_1038342 Ga0081540_10383423 254
459 3300005985 Ga0081539_10000231 Ga0081539_10000231106 254
460 3300005985 Ga0081539_10020813 Ga0081539_100208132 254
461 3300006038 Ga0075365_10008505 Ga0075365_100085054 254
462 3300006042 Ga0075368_10038622 Ga0075368_100386222 254
463 3300006051 Ga0075364_10106705 Ga0075364_101067052 254
464 3300006178 Ga0075367_10086371 Ga0075367_100863712 254
465 3300006358 Ga0068871_100227010 Ga0068871_1002270102 254
466 3300006871 Ga0075434_100255361 Ga0075434_1002553612 254
467 3300007265 Ga0099794_10037474 Ga0099794_100374743 254
468 3300007788 Ga0099795_10043655 Ga0099795_100436552 254
469 3300009093 Ga0105240_10380741 Ga0105240_103807412 254
470 3300009094 Ga0111539_10107307 Ga0111539_101073072 254
471 3300009148 Ga0105243_10021839 Ga0105243_100218392 254
472 3300009148 Ga0105243_10122579 Ga0105243_101225793 254
473 3300009174 Ga0105241_10004891 Ga0105241_100048919 254
474 3300009177 Ga0105248_10234871 Ga0105248_102348712 254
475 3300009545 Ga0105237_10103828 Ga0105237_101038282 254
476 3300009553 Ga0105249_10177450 Ga0105249_101774502 254
477 3300010159 Ga0099796_10006618 Ga0099796_100066181 254
478 3300010375 Ga0105239_10152234 Ga0105239_101522342 254
479 3300010375 Ga0105239_10562033 Ga0105239_105620332 254
480 3300011119 Ga0105246_10326456 Ga0105246_103264562 254
481 3300013297 Ga0157378_10312619 Ga0157378_103126191 254
482 3300013306 Ga0163162_10174038 Ga0163162_101740383 254
483 3300014326 Ga0157380_10086780 Ga0157380_100867804 254
484 3300014326 Ga0157380_10236593 Ga0157380_102365932 254
485 3300014745 Ga0157377_10094537 Ga0157377_100945372 254
486 3300014969 Ga0157376_10276499 Ga0157376_102764992 254
487 3300017792 Ga0163161_10041961 Ga0163161_100419614 254
488 3300025885 Ga0207653_10013839 Ga0207653_100138392 254
489 3300025899 Ga0207642_10066243 Ga0207642_100662431 254
490 3300025904 Ga0207647_10142011 Ga0207647_101420112 254
491 3300025907 Ga0207645_10076652 Ga0207645_100766522 254
492 3300025908 Ga0207643_10070736 Ga0207643_100707362 254
493 3300025919 Ga0207657_10128699 Ga0207657_101286992 254
494 3300025919 Ga0207657_10238841 Ga0207657_102388412 254
495 3300025924 Ga0207694_10151031 Ga0207694_101510312 254
496 3300025925 Ga0207650_10163541 Ga0207650_101635412 254
497 3300025927 Ga0207687_10515325 Ga0207687_105153251 254
498 3300025933 Ga0207706_10206067 Ga0207706_102060672 254
499 3300025935 Ga0207709_10080150 Ga0207709_100801502 254
500 3300025937 Ga0207669_10002996 Ga0207669_100029962 254
501 3300025939 Ga0207665_10125910 Ga0207665_101259102 254
502 3300025941 Ga0207711_10059809 Ga0207711_100598092 254
503 3300025942 Ga0207689_10006687 Ga0207689_100066872 254
504 3300025945 Ga0207679_10153634 Ga0207679_101536342 254
505 3300025949 Ga0207667_10127208 Ga0207667_101272082 254
506 3300025972 Ga0207668_10013209 Ga0207668_100132094 254
507 3300025972 Ga0207668_10229939 Ga0207668_102299392 254
508 3300026041 Ga0207639_10008087 Ga0207639_100080872 254
509 3300026067 Ga0207678_10143838 Ga0207678_101438382 254
510 3300026088 Ga0207641_10520009 Ga0207641_105200092 254
511 3300026089 Ga0207648_10081718 Ga0207648_100817182 254
512 3300026089 Ga0207648_10133732 Ga0207648_101337322 254
513 3300026095 Ga0207676_10632015 Ga0207676_106320152 254
514 3300026116 Ga0207674_10315174 Ga0207674_103151742 254
515 3300027671 Ga0209588_1028195 Ga0209588_10281952 254
516 3300028379 Ga0268266_10004661 Ga0268266_1000466115 254
517 3300028380 Ga0268265_10133879 Ga0268265_101338792 254
518 3300028381 Ga0268264_10349515 Ga0268264_103495152 254
519 3300031238 Ga0265332_10084409 Ga0265332_100844092 254
520 3300031239 Ga0265328_10089627 Ga0265328_100896271 254
521 3300031239 Ga0265328_10108623 Ga0265328_101086232 254
522 3300031241 Ga0265325_10080950 Ga0265325_100809501 254
523 3300031247 Ga0265340_10000672 Ga0265340_1000067213 254
524 3300031249 Ga0265339_10079649 Ga0265339_100796492 254
525 3300031344 Ga0265316_10367121 Ga0265316_103671211 254
526 3300031711 Ga0265314_10123764 Ga0265314_101237641 254
527 3300031712 Ga0265342_10075248 Ga0265342_100752481 254
528 3300031730 Ga0307516_10186034 Ga0307516_101860342 254
529 3300031995 Ga0307409_100299265 Ga0307409_1002992652 254
530 3300035116 Ga0373945_0035194 Ga0373945_0035194_191_970 254
531 3300035118 Ga0373954_0007882 Ga0373954_0007882_3422_4216 254
532 3300035119 Ga0373956_0099565 Ga0373956_0099565_172_966 254
533 3300035120 Ga0373957_0013764 Ga0373957_0013764_493_1287 254
534 3300035170 Ga0373943_0018493 Ga0373943_0018493_1210_1989 254
535 3300035171 Ga0373946_0023704 Ga0373946_0023704_227_1006 254
536 3300035172 Ga0373955_0121564 Ga0373955_0121564_538_1332 254
537 3300035695 Ga0373927_0000689 Ga0373927_0000689_19944_20723 254
538 3300035695 Ga0373927_0018091 Ga0373927_0018091_2931_3716 254
539 3300035724 Ga0373933_0123293 Ga0373933_0123293_129_923 254
540 3300035725 Ga0373947_0175808 Ga0373947_0175808_292_1077 254
541 3300036401 Ga0373937_0106364 Ga0373937_0106364_325_1107 254
542 3300036401 Ga0373937_0277395 Ga0373937_0277395_154_948 254
543 3300036401 Ga0373937_0473322 Ga0373937_0473322_178_957 254
544 3300037068 Ga0373925_0012575 Ga0373925_0012575_3930_4715 254
545 3300037068 Ga0373925_0310041 Ga0373925_0310041_393_1172 254
546 3300046454 Ga0495592_0023120 Ga0495592_0023120_934_1728 254
547 3300046455 Ga0495603_0000177 Ga0495603_0000177_6549_7328 254
548 3300046455 Ga0495603_0009078 Ga0495603_0009078_1392_2174 254
549 3300046455 Ga0495603_0034092 Ga0495603_0034092_1093_1869 254
550 3300046459 Ga0495629_0076861 Ga0495629_0076861_397_1176 254
551 3300046460 Ga0495638_0095492 Ga0495638_0095492_204_986 254
552 3300046472 Ga0495580_0000787 Ga0495580_0000787_5978_6757 254
553 3300046473 Ga0495582_0000270 Ga0495582_0000270_3000_3779 254
554 3300046475 Ga0495639_0000934 Ga0495639_0000934_2556_3335 254
555 3300046475 Ga0495639_0132649 Ga0495639_0132649_308_1093 254
556 3300046476 Ga0495662_0000993 Ga0495662_0000993_10378_11157 254
557 3300046476 Ga0495662_0072779 Ga0495662_0072779_626_1420 254
558 3300046477 Ga0495664_0010266 Ga0495664_0010266_1815_2594 254
559 3300046499 Ga0495594_0020026 Ga0495594_0020026_227_1006 254
560 3300046511 Ga0495608_0048171 Ga0495608_0048171_417_1211 254
561 3300046516 Ga0495628_0059387 Ga0495628_0059387_190_984 254
562 3300046516 Ga0495628_0173347 Ga0495628_0173347_679_1458 254
563 3300046523 Ga0495644_0063134 Ga0495644_0063134_126_911 254
564 3300046529 Ga0495652_0053793 Ga0495652_0053793_80_874 254
565 3300046531 Ga0495665_0003851 Ga0495665_0003851_3001_3780 254
566 3300046533 Ga0495640_0180467 Ga0495640_0180467_501_1280 254
567 3300046536 Ga0495587_0018599 Ga0495587_0018599_2066_2860 254
568 3300046536 Ga0495587_0240779 Ga0495587_0240779_25_807 254
569 3300046537 Ga0495598_0016764 Ga0495598_0016764_816_1598 254
570 3300046543 Ga0495645_0026867 Ga0495645_0026867_938_1732 254
571 3300046557 Ga0495622_0187537 Ga0495622_0187537_94_873 254
572 3300046558 Ga0495633_0039699 Ga0495633_0039699_517_1299 254
573 3300046615 Ga0495656_0044632 Ga0495656_0044632_877_1659 254
574 3300046642 Ga0495634_0001270 Ga0495634_0001270_441_1220 254
575 3300046642 Ga0495634_0021114 Ga0495634_0021114_1345_2139 254
576 3300046663 Ga0495635_0000463 Ga0495635_0000463_177_956 254
577 3300046664 Ga0495659_0030017 Ga0495659_0030017_431_1216 254
578 3300046674 Ga0495588_0007900 Ga0495588_0007900_1812_2594 254
579 3300046675 Ga0495657_0242038 Ga0495657_0242038_59_853 254
580 3300046678 Ga0495599_0053286 Ga0495599_0053286_1663_2457 254
581 3300046679 Ga0495623_0004014 Ga0495623_0004014_8628_9422 254
582 3300046680 Ga0495646_0016166 Ga0495646_0016166_3138_3932 254
583 3300046680 Ga0495646_0026066 Ga0495646_0026066_21_800 254
584 3300046681 Ga0495647_0001462 Ga0495647_0001462_3127_3906 254
585 3300046681 Ga0495647_0095922 Ga0495647_0095922_215_997 254
586 3300046683 Ga0495658_0000636 Ga0495658_0000636_5738_6517 254
587 3300046684 Ga0495669_0004639 Ga0495669_0004639_531_1316 254
588 3300046684 Ga0495669_0052783 Ga0495669_0052783_59_841 254
589 3300046689 Ga0495613_0015258 Ga0495613_0015258_4309_5088 254
590 3300046689 Ga0495613_0282693 Ga0495613_0282693_11_805 254
591 3300046690 Ga0495624_0000635 Ga0495624_0000635_6096_6875 254
592 3300046690 Ga0495624_0047924 Ga0495624_0047924_841_1626 254
593 3300046691 Ga0495670_0030185 Ga0495670_0030185_1685_2470 254
594 3300047315 Ga0495581_0000666 Ga0495581_0000666_10570_11349 254
595 3300047317 Ga0495604_0057108 Ga0495604_0057108_302_1096 254
596 3300047319 Ga0495674_0001332 Ga0495674_0001332_574_1353 254
597 3300047321 Ga0495676_0026159 Ga0495676_0026159_3437_4216 254
598 3300047321 Ga0495676_0289656 Ga0495676_0289656_100_894 254
599 3300047322 Ga0495680_0030065 Ga0495680_0030065_80_874 254
600 3300047322 Ga0495680_0405393 Ga0495680_0405393_118_897 254
601 3300047471 Ga0495684_0018537 Ga0495684_0018537_4557_5351 254
602 3300047673 Ga0495593_0003108 Ga0495593_0003108_1242_2021 254
603 3300048088 Ga0495602_0095292 Ga0495602_0095292_589_1383 254
604 3300048089 Ga0495614_0017326 Ga0495614_0017326_1864_2643 254
605 3300048905 Ga0496102_0075575 Ga0496102_0075575_753_1535 254
606 3300048906 Ga0496103_0285117 Ga0496103_0285117_210_992 254
607 3300048909 Ga0496106_0387529 Ga0496106_0387529_234_1016 254
608 3300048910 Ga0496107_0275090 Ga0496107_0275090_36_818 254
609 3300048912 Ga0496109_0686808 Ga0496109_0686808_111_887 254
610 3300048913 Ga0496110_0059716 Ga0496110_0059716_157_1014 254
611 3300048914 Ga0496111_0050002 Ga0496111_0050002_1272_2129 254
612 3300048915 Ga0496112_0128228 Ga0496112_0128228_1140_1922 254
613 3300048915 Ga0496112_0378119 Ga0496112_0378119_471_1328 254
614 3300048916 Ga0496113_0031385 Ga0496113_0031385_1736_2593 254
615 3300048916 Ga0496113_0264527 Ga0496113_0264527_313_1095 254
616 3300048924 Ga0496121_0247436 Ga0496121_0247436_13_795 254
617 3300050491 nmdc:mga00v17_5942_c1 nmdc:mga00v17_5942_c1_832_1614 254
618 3300050514 nmdc:mga08x19_347232_c1 nmdc:mga08x19_347232_c1_211_987 254
619 3300053077 Ga0495601_0043899 Ga0495601_0043899_1693_2487 254
620 3300053084 Ga0495595_0081213 Ga0495595_0081213_279_1073 254
621 3300053085 Ga0495619_0104382 Ga0495619_0104382_638_1432 254
622 3300053085 Ga0495619_0114567 Ga0495619_0114567_461_1240 254
623 3300053090 Ga0500646_0027375 Ga0500646_0027375_295_1077 254
624 3300053092 Ga0500583_0055684 Ga0500583_0055684_612_1394 254
625 3300053130 Ga0500642_0115160 Ga0500642_0115160_415_1197 254
626 3300053150 Ga0500603_000967 Ga0500603_000967_5387_6163 254
627 3300053161 Ga0500634_0099648 Ga0500634_0099648_573_1355 254
628 3300053178 Ga0500637_0029118 Ga0500637_0029118_1755_2531 254
629 3300053730 Ga0500645_025154 Ga0500645_025154_167_943 254
630 3300053731 Ga0500609_012676 Ga0500609_012676_229_1011 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02517

Rce1-like

Type II CAAX prenyl endopeptidase Rce1-like

186

279

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fn3-assembly1.cif.gz_C cryo-em structure of gamma secretase in class 1 of the apo- state ensemble 0.3007 25 253
6idf-assembly1.cif.gz_C cryo-em structure of gamma secretase in complex with a notch fragment 0.2914 25 253
1zb1-assembly2.cif.gz_B structure basis for endosomal targeting by the bro1 domain 0.2605 33 253
7wmn-assembly1.cif.gz_A a novel chemical derivative(89) of thrb agonist 0.2587 22 248
5hjp-assembly1.cif.gz_B identification of lxrbeta selective agonists for the treatment of alzheimer's disease 0.2585 20 251
ID Description Score Start End Superfamily
af_Q9ZZX1_1_342_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.2564 26 251 1.20.210.10
af_I1MZT7_156_506_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2552 33 253 1.20.1250.20
af_Q55DY8_111_308_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.2532 25 252 1.50.40.10
4onrA00 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Decorin-binding protein 0.2492 103 253 1.20.1420.40
af_Q7XGH1_28_225_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2457 24 246 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A496V419-F1-model_v4 CPBP family intramembrane metalloprotease 0.9952 158 252 GO:0004222
GO:0016020
GO:0071586
AF-A0A1W9WEP6-F1-model_v4 CPBP family intramembrane metalloprotease 0.9946 158 252 GO:0004222
GO:0016020
GO:0071586
AF-A0A1I5FWA8-F1-model_v4 CAAX protease self-immunity 0.9807 155 247 GO:0004222
GO:0016020
GO:0071586
AF-A0A5A7W8G0-F1-model_v4 CPBP family intramembrane metalloprotease 0.976 38 253 GO:0004222
GO:0016020
GO:0071586
AF-A0A538PJC5-F1-model_v4 CPBP family intramembrane metalloprotease 0.9738 84 250 GO:0004222
GO:0016020
GO:0071586

Feature Viewer

pLDDT pTM Quality
90.99 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map