F470758
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 629 | 265 | 629 | 336 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_0404975|Ga0436365_0404975_175288_176400 |
| Length | 370 |
| Sequence | MCNRGETGGHGDVDCTPRDNVATLRRPNLTRHESPLNSSSQIVLSGLRPTGRVHLGNYFGAVRNWVELQDRYRCYYFVADWHALTSDYADPSKVRQATFDAVADYLAAGMDPEKATVFLQSDVKEHAELHLLLSMVTPLPWLERVPTFKDQQAQLEDKDLNTYGFLGYPLLQTADIILYRAAYVPVGEDQASHLELSREIVRRFNNFYGPVFPEPQPLFTATPKVPGLDGRKMSKSYGNTIGLTASADEIRALVSTMFTDPNRVRRSDPGNPDICNLFQFHKLFSDDATIARVDHECRTAQIGCVQDKRLLADIIIEKLRPIRERREEIDRNPSIVWDTLREGGKRARERAGETMASVRDAMKIGFPELR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 100 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 101 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 156 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 157 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 158 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 161 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 164 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 168 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 169 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 172 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 173 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 174 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 176 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 177 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 178 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 179 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 180 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 181 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 182 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 185 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 186 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 188 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 189 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 191 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 192 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 193 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 196 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 197 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 198 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 199 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 200 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 201 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 202 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 203 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 204 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 205 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 206 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 215 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 216 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 217 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 218 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 221 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 222 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 223 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 224 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 225 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 226 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 263 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 264 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.2 |
| Rhizosphere | 90.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10090239 | 3300005295 | Bacteria | 4183 |
| 2 | Ga0070658_10017136 | 3300005327 | Bacteria | 5797 |
| 3 | Ga0070683_100000068 | 3300005329 | Bacteria | 72997 |
| 4 | Ga0070683_100133128 | 3300005329 | Bacteria | 2353 |
| 5 | Ga0070683_100208857 | 3300005329 | Bacteria | 1854 |
| 6 | Ga0070690_100000448 | 3300005330 | Bacteria | 20723 |
| 7 | Ga0070690_100031417 | 3300005330 | Bacteria | 3308 |
| 8 | Ga0070670_100004914 | 3300005331 | Bacteria | 11248 |
| 9 | Ga0070670_100005934 | 3300005331 | Bacteria | 10329 |
| 10 | Ga0070670_100022934 | 3300005331 | Bacteria | 5370 |
| 11 | Ga0070670_100056618 | 3300005331 | Bacteria | 3364 |
| 12 | Ga0070677_10013681 | 3300005333 | Bacteria | 2842 |
| 13 | Ga0070677_10029410 | 3300005333 | Bacteria | 2083 |
| 14 | Ga0068869_100026266 | 3300005334 | Bacteria | 4052 |
| 15 | Ga0068869_100058975 | 3300005334 | Bacteria | 2809 |
| 16 | Ga0070666_10000299 | 3300005335 | Bacteria | 32140 |
| 17 | Ga0070666_10024193 | 3300005335 | Bacteria | 3955 |
| 18 | Ga0070680_100013589 | 3300005336 | Bacteria | 6347 |
| 19 | Ga0070682_100000014 | 3300005337 | Bacteria | 249552 |
| 20 | Ga0070682_100038193 | 3300005337 | Bacteria | 2944 |
| 21 | Ga0068868_100000163 | 3300005338 | Bacteria | 43476 |
| 22 | Ga0068868_100001348 | 3300005338 | Bacteria | 16914 |
| 23 | Ga0068868_100026790 | 3300005338 | Bacteria | 4395 |
| 24 | Ga0068868_100148768 | 3300005338 | Bacteria | 1927 |
| 25 | Ga0070689_100001747 | 3300005340 | Bacteria | 13909 |
| 26 | Ga0070689_100003483 | 3300005340 | Bacteria | 10477 |
| 27 | Ga0070689_100004063 | 3300005340 | Bacteria | 9849 |
| 28 | Ga0070687_100000425 | 3300005343 | Bacteria | 14251 |
| 29 | Ga0070661_100033374 | 3300005344 | Bacteria | 3727 |
| 30 | Ga0070661_100092975 | 3300005344 | Bacteria | 2235 |
| 31 | Ga0070692_10000298 | 3300005345 | Bacteria | 14077 |
| 32 | Ga0070692_10000642 | 3300005345 | Bacteria | 11099 |
| 33 | Ga0070692_10001369 | 3300005345 | Bacteria | 8801 |
| 34 | Ga0070669_100217865 | 3300005353 | Bacteria | 1508 |
| 35 | Ga0070675_100000005 | 3300005354 | Bacteria | 295918 |
| 36 | Ga0070675_100051410 | 3300005354 | Bacteria | 3386 |
| 37 | Ga0070674_100003957 | 3300005356 | Bacteria | 8392 |
| 38 | Ga0070674_100038734 | 3300005356 | Bacteria | 3215 |
| 39 | Ga0070673_100114186 | 3300005364 | Bacteria | 2244 |
| 40 | Ga0070673_100180099 | 3300005364 | Bacteria | 1809 |
| 41 | Ga0070688_100010351 | 3300005365 | Bacteria | 5139 |
| 42 | Ga0070659_100001254 | 3300005366 | Bacteria | 18424 |
| 43 | Ga0070667_100001154 | 3300005367 | Bacteria | 23979 |
| 44 | Ga0070667_100070353 | 3300005367 | Bacteria | 2978 |
| 45 | Ga0070713_100014092 | 3300005436 | Bacteria | 5922 |
| 46 | Ga0070701_10000943 | 3300005438 | Bacteria | 10515 |
| 47 | Ga0070701_10001392 | 3300005438 | Bacteria | 8943 |
| 48 | Ga0070705_100059050 | 3300005440 | Bacteria | 2270 |
| 49 | Ga0070700_100000025 | 3300005441 | Bacteria | 126198 |
| 50 | Ga0070700_100001257 | 3300005441 | Bacteria | 12549 |
| 51 | Ga0070700_100013777 | 3300005441 | Bacteria | 4549 |
| 52 | Ga0070700_100186866 | 3300005441 | Bacteria | 1446 |
| 53 | Ga0070694_100038190 | 3300005444 | Bacteria | 3189 |
| 54 | Ga0070708_100005909 | 3300005445 | Bacteria | 9726 |
| 55 | Ga0070708_100010262 | 3300005445 | Bacteria | 7583 |
| 56 | Ga0070708_100066506 | 3300005445 | Bacteria | 3236 |
| 57 | Ga0070708_100316701 | 3300005445 | Bacteria | 1470 |
| 58 | Ga0070663_100004197 | 3300005455 | Bacteria | 8425 |
| 59 | Ga0070663_100028054 | 3300005455 | Bacteria | 3828 |
| 60 | Ga0070663_100144519 | 3300005455 | Bacteria | 1819 |
| 61 | Ga0070678_100003548 | 3300005456 | Bacteria | 8705 |
| 62 | Ga0070678_100006558 | 3300005456 | Bacteria | 6839 |
| 63 | Ga0070662_100005463 | 3300005457 | Bacteria | 8121 |
| 64 | Ga0068867_100008933 | 3300005459 | Bacteria | 7072 |
| 65 | Ga0068867_100072211 | 3300005459 | Bacteria | 2583 |
| 66 | Ga0070685_10006547 | 3300005466 | Bacteria | 5940 |
| 67 | Ga0070706_100001433 | 3300005467 | Bacteria | 25205 |
| 68 | Ga0070706_100001538 | 3300005467 | Bacteria | 24123 |
| 69 | Ga0070706_100002585 | 3300005467 | Bacteria | 18178 |
| 70 | Ga0070706_100007815 | 3300005467 | Bacteria | 9996 |
| 71 | Ga0070706_100022070 | 3300005467 | Bacteria | 5862 |
| 72 | Ga0070706_100030392 | 3300005467 | Bacteria | 4977 |
| 73 | Ga0070706_100059347 | 3300005467 | Bacteria | 3530 |
| 74 | Ga0070706_100086679 | 3300005467 | Bacteria | 2901 |
| 75 | Ga0070706_100090360 | 3300005467 | Bacteria | 2840 |
| 76 | Ga0070706_100458796 | 3300005467 | Bacteria | 1186 |
| 77 | Ga0070707_100001134 | 3300005468 | Bacteria | 26206 |
| 78 | Ga0070707_100007211 | 3300005468 | Bacteria | 10312 |
| 79 | Ga0070707_100007456 | 3300005468 | Bacteria | 10157 |
| 80 | Ga0070707_100062993 | 3300005468 | Bacteria | 3558 |
| 81 | Ga0070707_100119229 | 3300005468 | Bacteria | 2561 |
| 82 | Ga0070707_100197995 | 3300005468 | Bacteria | 1958 |
| 83 | Ga0070707_100413795 | 3300005468 | Unclassified | 1308 |
| 84 | Ga0070698_100016054 | 3300005471 | Bacteria | 7908 |
| 85 | Ga0070698_100016763 | 3300005471 | Bacteria | 7728 |
| 86 | Ga0070698_100039399 | 3300005471 | Bacteria | 4864 |
| 87 | Ga0070698_100050900 | 3300005471 | Bacteria | 4220 |
| 88 | Ga0070698_100057515 | 3300005471 | Bacteria | 3935 |
| 89 | Ga0070698_100074400 | 3300005471 | Bacteria | 3402 |
| 90 | Ga0070698_100090534 | 3300005471 | Bacteria | 3042 |
| 91 | Ga0070699_100015660 | 3300005518 | Bacteria | 6512 |
| 92 | Ga0070699_100022070 | 3300005518 | Bacteria | 5484 |
| 93 | Ga0070699_100026256 | 3300005518 | Bacteria | 5023 |
| 94 | Ga0070699_100140006 | 3300005518 | Bacteria | 2136 |
| 95 | Ga0070699_100195372 | 3300005518 | Bacteria | 1798 |
| 96 | Ga0070699_100228877 | 3300005518 | Bacteria | 1658 |
| 97 | Ga0070699_100327908 | 3300005518 | Bacteria | 1376 |
| 98 | Ga0070679_100199049 | 3300005530 | Bacteria | 1970 |
| 99 | Ga0070684_100001023 | 3300005535 | Bacteria | 19936 |
| 100 | Ga0070684_100175063 | 3300005535 | Bacteria | 1950 |
| 101 | Ga0070684_100201832 | 3300005535 | Bacteria | 1811 |
| 102 | Ga0070684_100348090 | 3300005535 | Bacteria | 1363 |
| 103 | Ga0070697_100024031 | 3300005536 | Bacteria | 4851 |
| 104 | Ga0070697_100036239 | 3300005536 | Bacteria | 3984 |
| 105 | Ga0070697_100051652 | 3300005536 | Bacteria | 3340 |
| 106 | Ga0070697_100054003 | 3300005536 | Bacteria | 3265 |
| 107 | Ga0070697_100071706 | 3300005536 | Bacteria | 2842 |
| 108 | Ga0070697_100179255 | 3300005536 | Bacteria | 1795 |
| 109 | Ga0068853_100188915 | 3300005539 | Bacteria | 1871 |
| 110 | Ga0070672_100000082 | 3300005543 | Bacteria | 44859 |
| 111 | Ga0070672_100019300 | 3300005543 | Bacteria | 4946 |
| 112 | Ga0070672_100047389 | 3300005543 | Bacteria | 3335 |
| 113 | Ga0070672_100055526 | 3300005543 | Bacteria | 3103 |
| 114 | Ga0070672_100119147 | 3300005543 | Bacteria | 2159 |
| 115 | Ga0070686_100003654 | 3300005544 | Bacteria | 8442 |
| 116 | Ga0070695_100009746 | 3300005545 | Bacteria | 5720 |
| 117 | Ga0070695_100040534 | 3300005545 | Bacteria | 2948 |
| 118 | Ga0070696_100003949 | 3300005546 | Bacteria | 9901 |
| 119 | Ga0070696_100020827 | 3300005546 | Bacteria | 4443 |
| 120 | Ga0070696_100028738 | 3300005546 | Bacteria | 3794 |
| 121 | Ga0070696_100047684 | 3300005546 | Bacteria | 2973 |
| 122 | Ga0070696_100049261 | 3300005546 | Bacteria | 2926 |
| 123 | Ga0070696_100079598 | 3300005546 | Bacteria | 2319 |
| 124 | Ga0070696_100184201 | 3300005546 | Unclassified | 1550 |
| 125 | Ga0070696_100228594 | 3300005546 | Bacteria | 1399 |
| 126 | Ga0070665_100053302 | 3300005548 | Bacteria | 4056 |
| 127 | Ga0070665_100143722 | 3300005548 | Bacteria | 2389 |
| 128 | Ga0070704_100010977 | 3300005549 | Bacteria | 5526 |
| 129 | Ga0070704_100015344 | 3300005549 | Bacteria | 4812 |
| 130 | Ga0070704_100024581 | 3300005549 | Bacteria | 3954 |
| 131 | Ga0070664_100005721 | 3300005564 | Bacteria | 10018 |
| 132 | Ga0070664_100009451 | 3300005564 | Bacteria | 7902 |
| 133 | Ga0068857_100086612 | 3300005577 | Bacteria | 2801 |
| 134 | Ga0068856_100069978 | 3300005614 | Bacteria | 3470 |
| 135 | Ga0070702_100010436 | 3300005615 | Bacteria | 4575 |
| 136 | Ga0070702_100128546 | 3300005615 | Unclassified | 1597 |
| 137 | Ga0068859_100000001 | 3300005617 | Bacteria | 545224 |
| 138 | Ga0068859_100001014 | 3300005617 | Bacteria | 28729 |
| 139 | Ga0068859_100487613 | 3300005617 | Bacteria | 1328 |
| 140 | Ga0068864_100000097 | 3300005618 | Bacteria | 85717 |
| 141 | Ga0068864_100019276 | 3300005618 | Bacteria | 5702 |
| 142 | Ga0068861_100062860 | 3300005719 | Bacteria | 2853 |
| 143 | Ga0068861_100132034 | 3300005719 | Bacteria | 2028 |
| 144 | Ga0068851_10091084 | 3300005834 | Bacteria | 1605 |
| 145 | Ga0068870_10003769 | 3300005840 | Bacteria | 6448 |
| 146 | Ga0068870_10006871 | 3300005840 | Bacteria | 5048 |
| 147 | Ga0068870_10010632 | 3300005840 | Bacteria | 4235 |
| 148 | Ga0068863_100012687 | 3300005841 | Bacteria | 8126 |
| 149 | Ga0068863_100056184 | 3300005841 | Bacteria | 3727 |
| 150 | Ga0068863_100060932 | 3300005841 | Bacteria | 3568 |
| 151 | Ga0068863_100075901 | 3300005841 | Bacteria | 3180 |
| 152 | Ga0068863_100368861 | 3300005841 | Bacteria | 1401 |
| 153 | Ga0068858_100000535 | 3300005842 | Bacteria | 39601 |
| 154 | Ga0068858_100000656 | 3300005842 | Bacteria | 36151 |
| 155 | Ga0068858_100043317 | 3300005842 | Bacteria | 4174 |
| 156 | Ga0068860_100001089 | 3300005843 | Bacteria | 29937 |
| 157 | Ga0068860_100002216 | 3300005843 | Bacteria | 20448 |
| 158 | Ga0068860_100025010 | 3300005843 | Bacteria | 5764 |
| 159 | Ga0068860_100031385 | 3300005843 | Bacteria | 5107 |
| 160 | Ga0068860_100049267 | 3300005843 | Bacteria | 4013 |
| 161 | Ga0068862_100000687 | 3300005844 | Bacteria | 34543 |
| 162 | Ga0081455_10060748 | 3300005937 | Bacteria | 3184 |
| 163 | Ga0081539_10014649 | 3300005985 | Bacteria | 5774 |
| 164 | Ga0070717_10000216 | 3300006028 | Bacteria | 40022 |
| 165 | Ga0070717_10217899 | 3300006028 | Bacteria | 1677 |
| 166 | Ga0070716_100020244 | 3300006173 | Bacteria | 3491 |
| 167 | Ga0097621_100025982 | 3300006237 | Bacteria | 4588 |
| 168 | Ga0097621_100058461 | 3300006237 | Bacteria | 3154 |
| 169 | Ga0068871_100032995 | 3300006358 | Bacteria | 4095 |
| 170 | Ga0068871_100037481 | 3300006358 | Bacteria | 3867 |
| 171 | Ga0068871_100123545 | 3300006358 | Bacteria | 2189 |
| 172 | Ga0075428_100000305 | 3300006844 | Bacteria | 48274 |
| 173 | Ga0075428_100068217 | 3300006844 | Bacteria | 3891 |
| 174 | Ga0075431_100057851 | 3300006847 | Bacteria | 3999 |
| 175 | Ga0075433_10000923 | 3300006852 | Bacteria | 20691 |
| 176 | Ga0075433_10054854 | 3300006852 | Bacteria | 3477 |
| 177 | Ga0075434_100000559 | 3300006871 | Bacteria | 28566 |
| 178 | Ga0075434_100164026 | 3300006871 | Bacteria | 2242 |
| 179 | Ga0068865_100020445 | 3300006881 | Bacteria | 4292 |
| 180 | Ga0068865_100054895 | 3300006881 | Bacteria | 2771 |
| 181 | Ga0068865_100056372 | 3300006881 | Bacteria | 2737 |
| 182 | Ga0097620_100000001 | 3300006931 | Bacteria | 545224 |
| 183 | Ga0097620_100001014 | 3300006931 | Bacteria | 28729 |
| 184 | Ga0097620_100487612 | 3300006931 | Bacteria | 1328 |
| 185 | Ga0075435_100001424 | 3300007076 | Bacteria | 15421 |
| 186 | Ga0075435_100001706 | 3300007076 | Bacteria | 14260 |
| 187 | Ga0075435_100203903 | 3300007076 | Bacteria | 1676 |
| 188 | Ga0105240_10023431 | 3300009093 | Bacteria | 8162 |
| 189 | Ga0105240_10084935 | 3300009093 | Bacteria | 3880 |
| 190 | Ga0111539_10000052 | 3300009094 | Bacteria | 116307 |
| 191 | Ga0105245_10000004 | 3300009098 | Bacteria | 470684 |
| 192 | Ga0105245_10003029 | 3300009098 | Bacteria | 15071 |
| 193 | Ga0105245_10009835 | 3300009098 | Bacteria | 8333 |
| 194 | Ga0105245_10040895 | 3300009098 | Bacteria | 4131 |
| 195 | Ga0105245_10270836 | 3300009098 | Bacteria | 1656 |
| 196 | Ga0105245_10429944 | 3300009098 | Bacteria | 1325 |
| 197 | Ga0105247_10084965 | 3300009101 | Bacteria | 2000 |
| 198 | Ga0114129_10013672 | 3300009147 | Bacteria | 11566 |
| 199 | Ga0114129_10020258 | 3300009147 | Bacteria | 9465 |
| 200 | Ga0114129_10023250 | 3300009147 | Bacteria | 8792 |
| 201 | Ga0114129_10029580 | 3300009147 | Bacteria | 7757 |
| 202 | Ga0114129_10105876 | 3300009147 | Bacteria | 3886 |
| 203 | Ga0114129_10456577 | 3300009147 | Bacteria | 1675 |
| 204 | Ga0105243_10010790 | 3300009148 | Bacteria | 6915 |
| 205 | Ga0105243_10161137 | 3300009148 | Bacteria | 1934 |
| 206 | Ga0105242_10004999 | 3300009176 | Bacteria | 10254 |
| 207 | Ga0105248_10003323 | 3300009177 | Bacteria | 17856 |
| 208 | Ga0105248_10036494 | 3300009177 | Bacteria | 5498 |
| 209 | Ga0105248_10062791 | 3300009177 | Bacteria | 4171 |
| 210 | Ga0105237_10137917 | 3300009545 | Bacteria | 2433 |
| 211 | Ga0105238_10000001 | 3300009551 | Bacteria | 2036163 |
| 212 | Ga0105249_10001464 | 3300009553 | Bacteria | 20697 |
| 213 | Ga0105249_10003565 | 3300009553 | Bacteria | 13470 |
| 214 | Ga0105239_10006639 | 3300010375 | Bacteria | 13389 |
| 215 | Ga0105239_10042465 | 3300010375 | Bacteria | 4983 |
| 216 | Ga0105239_10052818 | 3300010375 | Bacteria | 4457 |
| 217 | Ga0105239_10118468 | 3300010375 | Bacteria | 2938 |
| 218 | Ga0105246_10120563 | 3300011119 | Bacteria | 1943 |
| 219 | Ga0105246_10203192 | 3300011119 | Bacteria | 1542 |
| 220 | Ga0157369_10001042 | 3300013105 | Bacteria | 35030 |
| 221 | Ga0157374_10000012 | 3300013296 | Bacteria | 462353 |
| 222 | Ga0157374_10074412 | 3300013296 | Bacteria | 3207 |
| 223 | Ga0157374_10158718 | 3300013296 | Bacteria | 2202 |
| 224 | Ga0157378_10007473 | 3300013297 | Bacteria | 9545 |
| 225 | Ga0157378_10007767 | 3300013297 | Bacteria | 9364 |
| 226 | Ga0157378_10018512 | 3300013297 | Bacteria | 6121 |
| 227 | Ga0157378_10109694 | 3300013297 | Bacteria | 2528 |
| 228 | Ga0157378_10139357 | 3300013297 | Bacteria | 2251 |
| 229 | Ga0163162_10022779 | 3300013306 | Bacteria | 6175 |
| 230 | Ga0163162_10104939 | 3300013306 | Bacteria | 2920 |
| 231 | Ga0163162_10230828 | 3300013306 | Unclassified | 1981 |
| 232 | Ga0163162_10296533 | 3300013306 | Bacteria | 1749 |
| 233 | Ga0163162_10572919 | 3300013306 | Bacteria | 1256 |
| 234 | Ga0157375_10000001 | 3300013308 | Bacteria | 696576 |
| 235 | Ga0157375_10000008 | 3300013308 | Bacteria | 373560 |
| 236 | Ga0157375_10000201 | 3300013308 | Bacteria | 55923 |
| 237 | Ga0157375_10007623 | 3300013308 | Bacteria | 9466 |
| 238 | Ga0157375_10009868 | 3300013308 | Bacteria | 8397 |
| 239 | Ga0163163_10007890 | 3300014325 | Bacteria | 9410 |
| 240 | Ga0163163_10013898 | 3300014325 | Bacteria | 7384 |
| 241 | Ga0163163_10049408 | 3300014325 | Bacteria | 4139 |
| 242 | Ga0163163_10097183 | 3300014325 | Bacteria | 2965 |
| 243 | Ga0163163_10281206 | 3300014325 | Unclassified | 1715 |
| 244 | Ga0163163_10381291 | 3300014325 | Bacteria | 1467 |
| 245 | Ga0157380_10010378 | 3300014326 | Bacteria | 6699 |
| 246 | Ga0157380_10045368 | 3300014326 | Bacteria | 3449 |
| 247 | Ga0157380_10056357 | 3300014326 | Bacteria | 3125 |
| 248 | Ga0157380_10115373 | 3300014326 | Bacteria | 2265 |
| 249 | Ga0157380_10115861 | 3300014326 | Bacteria | 2260 |
| 250 | Ga0157380_10458216 | 3300014326 | Bacteria | 1227 |
| 251 | Ga0182008_10102961 | 3300014497 | Bacteria | 1412 |
| 252 | Ga0157377_10000002 | 3300014745 | Bacteria | 473827 |
| 253 | Ga0157377_10000024 | 3300014745 | Bacteria | 142391 |
| 254 | Ga0157379_10058393 | 3300014968 | Bacteria | 3449 |
| 255 | Ga0157379_10240933 | 3300014968 | Bacteria | 1640 |
| 256 | Ga0157376_10000025 | 3300014969 | Bacteria | 214212 |
| 257 | Ga0157376_10021530 | 3300014969 | Bacteria | 5009 |
| 258 | Ga0157376_10108873 | 3300014969 | Bacteria | 2435 |
| 259 | Ga0163161_10092835 | 3300017792 | Bacteria | 2235 |
| 260 | Ga0163161_10230297 | 3300017792 | Bacteria | 1438 |
| 261 | Ga0213873_10000002 | 3300021358 | Bacteria | 1164195 |
| 262 | Ga0213876_10000001 | 3300021384 | Bacteria | 1186326 |
| 263 | Ga0213876_10000080 | 3300021384 | Bacteria | 109125 |
| 264 | Ga0213876_10013522 | 3300021384 | Bacteria | 4332 |
| 265 | Ga0213876_10179989 | 3300021384 | Bacteria | 1124 |
| 266 | Ga0207682_10002222 | 3300025893 | Bacteria | 8758 |
| 267 | Ga0207682_10040379 | 3300025893 | Bacteria | 1901 |
| 268 | Ga0207642_10117392 | 3300025899 | Bacteria | 1366 |
| 269 | Ga0207680_10000719 | 3300025903 | Bacteria | 15539 |
| 270 | Ga0207645_10152435 | 3300025907 | Bacteria | 1509 |
| 271 | Ga0207643_10002858 | 3300025908 | Bacteria | 9322 |
| 272 | Ga0207643_10003770 | 3300025908 | Bacteria | 8146 |
| 273 | Ga0207643_10007413 | 3300025908 | Bacteria | 5885 |
| 274 | Ga0207705_10031207 | 3300025909 | Bacteria | 3802 |
| 275 | Ga0207684_10000354 | 3300025910 | Bacteria | 62819 |
| 276 | Ga0207684_10001478 | 3300025910 | Bacteria | 25294 |
| 277 | Ga0207684_10006428 | 3300025910 | Bacteria | 10711 |
| 278 | Ga0207684_10035728 | 3300025910 | Bacteria | 4219 |
| 279 | Ga0207684_10064756 | 3300025910 | Bacteria | 3103 |
| 280 | Ga0207684_10069336 | 3300025910 | Bacteria | 2997 |
| 281 | Ga0207684_10072020 | 3300025910 | Bacteria | 2936 |
| 282 | Ga0207684_10093552 | 3300025910 | Bacteria | 2563 |
| 283 | Ga0207684_10126347 | 3300025910 | Bacteria | 2194 |
| 284 | Ga0207684_10127555 | 3300025910 | Bacteria | 2184 |
| 285 | Ga0207684_10150767 | 3300025910 | Bacteria | 2000 |
| 286 | Ga0207684_10293599 | 3300025910 | Bacteria | 1402 |
| 287 | Ga0207707_10010264 | 3300025912 | Bacteria | 8127 |
| 288 | Ga0207660_10000002 | 3300025917 | Bacteria | 883566 |
| 289 | Ga0207660_10009336 | 3300025917 | Bacteria | 6347 |
| 290 | Ga0207662_10000761 | 3300025918 | Bacteria | 14779 |
| 291 | Ga0207662_10002117 | 3300025918 | Bacteria | 9866 |
| 292 | Ga0207662_10010636 | 3300025918 | Bacteria | 5087 |
| 293 | Ga0207652_10256545 | 3300025921 | Unclassified | 1577 |
| 294 | Ga0207646_10000242 | 3300025922 | Bacteria | 74986 |
| 295 | Ga0207646_10014779 | 3300025922 | Bacteria | 7396 |
| 296 | Ga0207646_10029056 | 3300025922 | Bacteria | 5026 |
| 297 | Ga0207646_10062181 | 3300025922 | Bacteria | 3333 |
| 298 | Ga0207646_10249496 | 3300025922 | Bacteria | 1603 |
| 299 | Ga0207646_10265255 | 3300025922 | Bacteria | 1552 |
| 300 | Ga0207681_10050786 | 3300025923 | Bacteria | 2807 |
| 301 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 302 | Ga0207650_10000262 | 3300025925 | Bacteria | 56131 |
| 303 | Ga0207650_10006075 | 3300025925 | Bacteria | 8238 |
| 304 | Ga0207650_10156871 | 3300025925 | Bacteria | 1800 |
| 305 | Ga0207659_10000067 | 3300025926 | Bacteria | 66315 |
| 306 | Ga0207659_10003166 | 3300025926 | Bacteria | 9840 |
| 307 | Ga0207659_10091745 | 3300025926 | Bacteria | 2270 |
| 308 | Ga0207659_10234322 | 3300025926 | Bacteria | 1482 |
| 309 | Ga0207687_10000003 | 3300025927 | Bacteria | 875159 |
| 310 | Ga0207687_10000874 | 3300025927 | Bacteria | 20395 |
| 311 | Ga0207687_10001356 | 3300025927 | Bacteria | 16754 |
| 312 | Ga0207687_10026795 | 3300025927 | Bacteria | 3862 |
| 313 | Ga0207687_10057430 | 3300025927 | Bacteria | 2734 |
| 314 | Ga0207687_10060532 | 3300025927 | Bacteria | 2671 |
| 315 | Ga0207644_10139847 | 3300025931 | Bacteria | 1863 |
| 316 | Ga0207690_10007375 | 3300025932 | Bacteria | 6528 |
| 317 | Ga0207706_10005264 | 3300025933 | Bacteria | 12066 |
| 318 | Ga0207706_10040135 | 3300025933 | Bacteria | 4148 |
| 319 | Ga0207706_10096548 | 3300025933 | Bacteria | 2599 |
| 320 | Ga0207706_10234844 | 3300025933 | Bacteria | 1603 |
| 321 | Ga0207686_10052556 | 3300025934 | Bacteria | 2543 |
| 322 | Ga0207709_10238262 | 3300025935 | Unclassified | 1322 |
| 323 | Ga0207670_10002583 | 3300025936 | Bacteria | 9524 |
| 324 | Ga0207670_10004911 | 3300025936 | Bacteria | 7273 |
| 325 | Ga0207669_10013257 | 3300025937 | Bacteria | 4087 |
| 326 | Ga0207665_10033205 | 3300025939 | Bacteria | 3419 |
| 327 | Ga0207691_10001623 | 3300025940 | Bacteria | 22338 |
| 328 | Ga0207691_10002139 | 3300025940 | Bacteria | 19338 |
| 329 | Ga0207691_10031463 | 3300025940 | Bacteria | 4952 |
| 330 | Ga0207691_10034695 | 3300025940 | Bacteria | 4690 |
| 331 | Ga0207691_10064519 | 3300025940 | Bacteria | 3318 |
| 332 | Ga0207711_10003854 | 3300025941 | Bacteria | 12908 |
| 333 | Ga0207711_10052073 | 3300025941 | Bacteria | 3507 |
| 334 | Ga0207689_10008031 | 3300025942 | Bacteria | 9209 |
| 335 | Ga0207689_10017106 | 3300025942 | Bacteria | 6137 |
| 336 | Ga0207689_10023505 | 3300025942 | Bacteria | 5172 |
| 337 | Ga0207661_10000001 | 3300025944 | Bacteria | 937688 |
| 338 | Ga0207661_10110717 | 3300025944 | Bacteria | 2322 |
| 339 | Ga0207661_10203204 | 3300025944 | Bacteria | 1743 |
| 340 | Ga0207661_10311028 | 3300025944 | Bacteria | 1414 |
| 341 | Ga0207679_10021058 | 3300025945 | Bacteria | 4411 |
| 342 | Ga0207679_10213625 | 3300025945 | Bacteria | 1619 |
| 343 | Ga0207651_10016931 | 3300025960 | Bacteria | 4290 |
| 344 | Ga0207712_10096479 | 3300025961 | Bacteria | 2188 |
| 345 | Ga0207640_10048547 | 3300025981 | Bacteria | 2745 |
| 346 | Ga0207640_10111554 | 3300025981 | Bacteria | 1940 |
| 347 | Ga0207658_10003795 | 3300025986 | Bacteria | 10636 |
| 348 | Ga0207677_10000035 | 3300026023 | Bacteria | 117469 |
| 349 | Ga0207677_10000249 | 3300026023 | Bacteria | 41568 |
| 350 | Ga0207677_10049379 | 3300026023 | Bacteria | 2839 |
| 351 | Ga0207677_10123489 | 3300026023 | Bacteria | 1952 |
| 352 | Ga0207703_10000046 | 3300026035 | Bacteria | 154474 |
| 353 | Ga0207703_10001102 | 3300026035 | Bacteria | 25601 |
| 354 | Ga0207703_10315273 | 3300026035 | Bacteria | 1430 |
| 355 | Ga0207639_10000051 | 3300026041 | Bacteria | 113927 |
| 356 | Ga0207678_10009561 | 3300026067 | Bacteria | 8527 |
| 357 | Ga0207678_10017619 | 3300026067 | Bacteria | 6269 |
| 358 | Ga0207708_10000034 | 3300026075 | Bacteria | 144931 |
| 359 | Ga0207708_10001539 | 3300026075 | Bacteria | 17190 |
| 360 | Ga0207702_10027375 | 3300026078 | Bacteria | 4734 |
| 361 | Ga0207641_10013141 | 3300026088 | Bacteria | 6788 |
| 362 | Ga0207641_10146499 | 3300026088 | Bacteria | 2135 |
| 363 | Ga0207641_10319120 | 3300026088 | Bacteria | 1473 |
| 364 | Ga0207648_10011285 | 3300026089 | Bacteria | 8425 |
| 365 | Ga0207648_10182439 | 3300026089 | Bacteria | 1858 |
| 366 | Ga0207648_10351439 | 3300026089 | Bacteria | 1329 |
| 367 | Ga0207676_10000013 | 3300026095 | Bacteria | 343067 |
| 368 | Ga0207676_10142424 | 3300026095 | Bacteria | 2054 |
| 369 | Ga0207674_10059045 | 3300026116 | Bacteria | 3884 |
| 370 | Ga0207675_100105611 | 3300026118 | Bacteria | 2655 |
| 371 | Ga0207675_100111357 | 3300026118 | Bacteria | 2583 |
| 372 | Ga0207675_100153728 | 3300026118 | Bacteria | 2192 |
| 373 | Ga0207683_10001081 | 3300026121 | Bacteria | 24825 |
| 374 | Ga0207683_10009630 | 3300026121 | Bacteria | 8234 |
| 375 | Ga0209996_1002487 | 3300027395 | Bacteria | 2281 |
| 376 | Ga0209970_1000831 | 3300027614 | Bacteria | 5408 |
| 377 | Ga0209983_1001136 | 3300027665 | Bacteria | 5877 |
| 378 | Ga0209974_10015913 | 3300027876 | Bacteria | 2497 |
| 379 | Ga0209974_10022459 | 3300027876 | Bacteria | 2090 |
| 380 | Ga0207428_10000003 | 3300027907 | Bacteria | 799783 |
| 381 | Ga0207428_10060251 | 3300027907 | Bacteria | 3007 |
| 382 | Ga0268266_10048281 | 3300028379 | Bacteria | 3648 |
| 383 | Ga0268266_10412137 | 3300028379 | Bacteria | 1279 |
| 384 | Ga0268265_10002608 | 3300028380 | Bacteria | 13414 |
| 385 | Ga0268264_10001715 | 3300028381 | Bacteria | 20197 |
| 386 | Ga0268264_10002673 | 3300028381 | Bacteria | 15564 |
| 387 | Ga0268264_10395477 | 3300028381 | Bacteria | 1327 |
| 388 | Ga0265337_1003707 | 3300028556 | Bacteria | 6534 |
| 389 | Ga0265326_10004762 | 3300028558 | Bacteria | 4313 |
| 390 | Ga0265319_1004203 | 3300028563 | Bacteria | 7201 |
| 391 | Ga0265319_1013527 | 3300028563 | Bacteria | 3240 |
| 392 | Ga0265334_10005117 | 3300028573 | Bacteria | 5744 |
| 393 | Ga0265318_10011166 | 3300028577 | Bacteria | 3880 |
| 394 | Ga0265323_10035789 | 3300028653 | Unclassified | 1829 |
| 395 | Ga0265322_10005011 | 3300028654 | Bacteria | 3929 |
| 396 | Ga0265322_10009152 | 3300028654 | Bacteria | 2878 |
| 397 | Ga0265322_10023369 | 3300028654 | Bacteria | 1768 |
| 398 | Ga0265338_10052337 | 3300028800 | Bacteria | 3664 |
| 399 | Ga0265338_10059121 | 3300028800 | Bacteria | 3378 |
| 400 | Ga0307511_10020180 | 3300030521 | Bacteria | 6320 |
| 401 | Ga0265330_10012480 | 3300031235 | Bacteria | 3974 |
| 402 | Ga0265330_10050088 | 3300031235 | Bacteria | 1832 |
| 403 | Ga0265332_10102180 | 3300031238 | Bacteria | 1209 |
| 404 | Ga0265320_10006971 | 3300031240 | Bacteria | 7049 |
| 405 | Ga0265320_10010665 | 3300031240 | Bacteria | 5452 |
| 406 | Ga0265325_10010933 | 3300031241 | Bacteria | 5228 |
| 407 | Ga0265325_10039889 | 3300031241 | Bacteria | 2469 |
| 408 | Ga0265329_10029070 | 3300031242 | Bacteria | 1809 |
| 409 | Ga0265329_10031940 | 3300031242 | Bacteria | 1708 |
| 410 | Ga0265339_10068558 | 3300031249 | Bacteria | 1895 |
| 411 | Ga0265339_10078440 | 3300031249 | Bacteria | 1748 |
| 412 | Ga0265331_10047581 | 3300031250 | Bacteria | 2064 |
| 413 | Ga0265316_10024348 | 3300031344 | Bacteria | 5075 |
| 414 | Ga0265316_10249588 | 3300031344 | Bacteria | 1303 |
| 415 | Ga0316575_10005760 | 3300031665 | Bacteria | 4422 |
| 416 | Ga0316575_10010773 | 3300031665 | Bacteria | 3368 |
| 417 | Ga0316579_10013828 | 3300031691 | Bacteria | 3479 |
| 418 | Ga0316579_10059664 | 3300031691 | Bacteria | 1793 |
| 419 | Ga0265314_10008942 | 3300031711 | Bacteria | 8531 |
| 420 | Ga0265314_10073004 | 3300031711 | Unclassified | 2289 |
| 421 | Ga0316576_10010653 | 3300031727 | Bacteria | 5987 |
| 422 | Ga0316576_10013703 | 3300031727 | Bacteria | 5399 |
| 423 | Ga0316576_10039189 | 3300031727 | Bacteria | 3401 |
| 424 | Ga0316578_10005092 | 3300031728 | Bacteria | 6325 |
| 425 | Ga0307405_10102976 | 3300031731 | Bacteria | 1919 |
| 426 | Ga0307415_100022053 | 3300032126 | Bacteria | 3925 |
| 427 | Ga0307415_100091175 | 3300032126 | Bacteria | 2207 |
| 428 | Ga0316583_10005222 | 3300032133 | Bacteria | 4655 |
| 429 | Ga0316583_10005503 | 3300032133 | Bacteria | 4546 |
| 430 | Ga0316583_10008129 | 3300032133 | Bacteria | 3781 |
| 431 | Ga0316583_10073822 | 3300032133 | Unclassified | 1193 |
| 432 | Ga0316585_10003454 | 3300032137 | Bacteria | 4341 |
| 433 | Ga0316580_10012162 | 3300032139 | Bacteria | 2620 |
| 434 | Ga0373950_0000016 | 3300034818 | Bacteria | 277879 |
| 435 | Ga0373932_0000024 | 3300035112 | Bacteria | 45717 |
| 436 | Ga0316574_0015320 | 3300035398 | Bacteria | 4446 |
| 437 | Ga0316574_0035974 | 3300035398 | Bacteria | 3029 |
| 438 | Ga0316574_0090258 | 3300035398 | Unclassified | 1953 |
| 439 | Ga0316574_0131511 | 3300035398 | Bacteria | 1610 |
| 440 | Ga0373947_0081969 | 3300035725 | Bacteria | 1999 |
| 441 | Ga0373937_0397596 | 3300036401 | Bacteria | 1307 |
| 442 | Ga0316582_0009004 | 3300036647 | Bacteria | 5394 |
| 443 | Ga0316582_0010088 | 3300036647 | Bacteria | 5158 |
| 444 | Ga0316582_0029245 | 3300036647 | Bacteria | 3346 |
| 445 | Ga0316582_0035450 | 3300036647 | Bacteria | 3081 |
| 446 | Ga0316582_0048907 | 3300036647 | Unclassified | 2675 |
| 447 | Ga0316584_0080762 | 3300036712 | Bacteria | 2436 |
| 448 | Ga0316584_0139367 | 3300036712 | Bacteria | 1810 |
| 449 | Ga0316584_0178458 | 3300036712 | Bacteria | 1573 |
| 450 | Ga0373925_0218113 | 3300037068 | Bacteria | 1522 |
| 451 | Ga0395899_0039592 | 3300037312 | Bacteria | 3527 |
| 452 | Ga0395900_0056534 | 3300037418 | Bacteria | 4038 |
| 453 | Ga0395898_0071382 | 3300037466 | Bacteria | 3355 |
| 454 | Ga0316581_0016940 | 3300037588 | Bacteria | 2098 |
| 455 | Ga0316581_0021242 | 3300037588 | Bacteria | 1905 |
| 456 | Ga0395901_0042863 | 3300038443 | Bacteria | 4693 |
| 457 | Ga0400491_01175 | 3300038727 | Bacteria | 3499 |
| 458 | Ga0400485_12823 | 3300038735 | Bacteria | 26460 |
| 459 | Ga0400485_12905 | 3300038735 | Bacteria | 17083 |
| 460 | Ga0400486_16900 | 3300038742 | Bacteria | 50943 |
| 461 | Ga0400486_27903 | 3300038742 | Bacteria | 26140 |
| 462 | Ga0400489_56403 | 3300039093 | Bacteria | 38528 |
| 463 | Ga0400489_80261 | 3300039093 | Bacteria | 10535 |
| 464 | Ga0400487_38723 | 3300039110 | Bacteria | 4178 |
| 465 | Ga0400487_44648 | 3300039110 | Bacteria | 8074 |
| 466 | Ga0436365_0138728 | 3300039437 | Bacteria | 44994 |
| 467 | Ga0436365_0319611 | 3300039437 | Bacteria | 2764 |
| 468 | Ga0436365_0404975 | 3300039437 | Bacteria | 180420 |
| 469 | Ga0436365_0786638 | 3300039437 | Bacteria | 13785 |
| 470 | Ga0436365_1530999 | 3300039437 | Bacteria | 2544 |
| 471 | Ga0436362_0660519 | 3300039453 | Bacteria | 832172 |
| 472 | Ga0436362_1042072 | 3300039453 | Bacteria | 9931 |
| 473 | Ga0451577_0000018 | 3300042876 | Bacteria | 516495 |
| 474 | Ga0451577_0001914 | 3300042876 | Bacteria | 26387 |
| 475 | Ga0451577_0223915 | 3300042876 | Bacteria | 1700 |
| 476 | Ga0453683_0020166 | 3300044673 | Bacteria | 4262 |
| 477 | Ga0453684_0000166 | 3300044712 | Bacteria | 294291 |
| 478 | Ga0453684_0000481 | 3300044712 | Bacteria | 158570 |
| 479 | Ga0453684_0023645 | 3300044712 | Bacteria | 9032 |
| 480 | Ga0453684_0037013 | 3300044712 | Bacteria | 6707 |
| 481 | Ga0453684_0054690 | 3300044712 | Bacteria | 5197 |
| 482 | Ga0466967_0050007 | 3300045976 | Bacteria | 3659 |
| 483 | Ga0495629_0015900 | 3300046459 | Bacteria | 5406 |
| 484 | Ga0495620_0000796 | 3300046515 | Bacteria | 19356 |
| 485 | Ga0495640_0175120 | 3300046533 | Bacteria | 1370 |
| 486 | Ga0495676_0160056 | 3300047321 | Bacteria | 1594 |
| 487 | Ga0495680_0217410 | 3300047322 | Bacteria | 1366 |
| 488 | Ga0495684_0086904 | 3300047471 | Bacteria | 2370 |
| 489 | Ga0496100_0214806 | 3300048903 | Bacteria | 1409 |
| 490 | Ga0496101_0002707 | 3300048904 | Bacteria | 10874 |
| 491 | Ga0496101_0002712 | 3300048904 | Bacteria | 10864 |
| 492 | Ga0496101_0167618 | 3300048904 | Bacteria | 1687 |
| 493 | Ga0496102_0001300 | 3300048905 | Bacteria | 22454 |
| 494 | Ga0496102_0022615 | 3300048905 | Bacteria | 5572 |
| 495 | Ga0496102_0129288 | 3300048905 | Bacteria | 2363 |
| 496 | Ga0496102_0238545 | 3300048905 | Bacteria | 1715 |
| 497 | Ga0496102_0259029 | 3300048905 | Unclassified | 1640 |
| 498 | Ga0496102_0357407 | 3300048905 | Bacteria | 1375 |
| 499 | Ga0496104_0081501 | 3300048907 | Bacteria | 3086 |
| 500 | Ga0496104_0142634 | 3300048907 | Bacteria | 2301 |
| 501 | Ga0496104_0351071 | 3300048907 | Bacteria | 1388 |
| 502 | Ga0496106_0000994 | 3300048909 | Bacteria | 20706 |
| 503 | Ga0496106_0159315 | 3300048909 | Bacteria | 1784 |
| 504 | Ga0496107_0001103 | 3300048910 | Bacteria | 16250 |
| 505 | Ga0496108_0005830 | 3300048911 | Bacteria | 9986 |
| 506 | Ga0496108_0013192 | 3300048911 | Bacteria | 6735 |
| 507 | Ga0496108_0013250 | 3300048911 | Bacteria | 6719 |
| 508 | Ga0496109_0012030 | 3300048912 | Bacteria | 7453 |
| 509 | Ga0496109_0015410 | 3300048912 | Bacteria | 6661 |
| 510 | Ga0496109_0021093 | 3300048912 | Bacteria | 5760 |
| 511 | Ga0496109_0209138 | 3300048912 | Bacteria | 1835 |
| 512 | Ga0496110_0008330 | 3300048913 | Bacteria | 8341 |
| 513 | Ga0496110_0013989 | 3300048913 | Bacteria | 6649 |
| 514 | Ga0496110_0046574 | 3300048913 | Bacteria | 3794 |
| 515 | Ga0496110_0144756 | 3300048913 | Bacteria | 2149 |
| 516 | Ga0496111_0007125 | 3300048914 | Bacteria | 7307 |
| 517 | Ga0496111_0013535 | 3300048914 | Bacteria | 5556 |
| 518 | Ga0496111_0031474 | 3300048914 | Bacteria | 3779 |
| 519 | Ga0496111_0031774 | 3300048914 | Bacteria | 3762 |
| 520 | Ga0496112_0000001 | 3300048915 | Bacteria | 1346031 |
| 521 | Ga0496112_0123321 | 3300048915 | Bacteria | 2562 |
| 522 | Ga0496113_0039907 | 3300048916 | Bacteria | 3457 |
| 523 | Ga0496113_0114662 | 3300048916 | Bacteria | 2101 |
| 524 | Ga0496113_0161139 | 3300048916 | Bacteria | 1773 |
| 525 | Ga0496113_0161790 | 3300048916 | Bacteria | 1770 |
| 526 | Ga0496114_0182505 | 3300048917 | Bacteria | 1833 |
| 527 | Ga0496115_0133683 | 3300048918 | Bacteria | 2045 |
| 528 | Ga0501031_0135315 | 3300049568 | Bacteria | 1610 |
| 529 | Ga0501036_0080350 | 3300049572 | Unclassified | 2756 |
| 530 | Ga0501036_0091353 | 3300049572 | Bacteria | 2572 |
| 531 | Ga0501036_0290871 | 3300049572 | Bacteria | 1367 |
| 532 | Ga0501040_0011760 | 3300049576 | Bacteria | 5726 |
| 533 | Ga0501040_0056926 | 3300049576 | Unclassified | 2683 |
| 534 | Ga0501040_0125183 | 3300049576 | Bacteria | 1805 |
| 535 | Ga0501041_0034180 | 3300049577 | Unclassified | 3077 |
| 536 | Ga0501041_0109957 | 3300049577 | Bacteria | 1710 |
| 537 | Ga0501042_0088074 | 3300049578 | Unclassified | 2227 |
| 538 | Ga0501042_0102098 | 3300049578 | Bacteria | 2063 |
| 539 | Ga0501042_0130025 | 3300049578 | Bacteria | 1815 |
| 540 | Ga0501042_0184328 | 3300049578 | Bacteria | 1506 |
| 541 | Ga0501043_0099421 | 3300049579 | Unclassified | 2287 |
| 542 | Ga0501046_0153379 | 3300049580 | Unclassified | 1737 |
| 543 | Ga0501046_0259535 | 3300049580 | Bacteria | 1277 |
| 544 | Ga0501048_0088831 | 3300049582 | Bacteria | 2180 |
| 545 | Ga0501067_0010951 | 3300049583 | Bacteria | 5021 |
| 546 | Ga0501067_0048720 | 3300049583 | Bacteria | 2349 |
| 547 | Ga0501068_0015713 | 3300049584 | Bacteria | 4353 |
| 548 | Ga0501069_0017652 | 3300049585 | Bacteria | 3845 |
| 549 | Ga0501069_0044503 | 3300049585 | Unclassified | 2457 |
| 550 | Ga0501070_0074587 | 3300049586 | Bacteria | 2808 |
| 551 | Ga0501071_0016434 | 3300049587 | Bacteria | 5088 |
| 552 | Ga0501071_0245409 | 3300049587 | Bacteria | 1351 |
| 553 | Ga0501071_0301848 | 3300049587 | Bacteria | 1214 |
| 554 | Ga0501072_0254331 | 3300049588 | Bacteria | 1399 |
| 555 | Ga0501073_0000332 | 3300049589 | Bacteria | 31762 |
| 556 | Ga0501073_0007235 | 3300049589 | Bacteria | 8264 |
| 557 | Ga0501074_0023856 | 3300049590 | Bacteria | 4446 |
| 558 | Ga0501075_0005186 | 3300049591 | Bacteria | 8911 |
| 559 | Ga0501075_0012600 | 3300049591 | Bacteria | 6014 |
| 560 | Ga0501075_0047794 | 3300049591 | Bacteria | 3215 |
| 561 | Ga0501075_0103642 | 3300049591 | Bacteria | 2162 |
| 562 | Ga0501075_0238754 | 3300049591 | Bacteria | 1385 |
| 563 | Ga0501076_0059444 | 3300049592 | Bacteria | 3040 |
| 564 | Ga0501076_0060791 | 3300049592 | Bacteria | 3006 |
| 565 | Ga0501076_0100650 | 3300049592 | Bacteria | 2329 |
| 566 | Ga0501076_0133880 | 3300049592 | Bacteria | 2011 |
| 567 | Ga0501076_0196587 | 3300049592 | Bacteria | 1646 |
| 568 | Ga0501077_0014692 | 3300049593 | Bacteria | 4920 |
| 569 | Ga0501077_0015873 | 3300049593 | Bacteria | 4744 |
| 570 | Ga0501079_0102757 | 3300049741 | Bacteria | 2216 |
| 571 | Ga0501079_0154260 | 3300049741 | Bacteria | 1790 |
| 572 | Ga0501079_0262383 | 3300049741 | Bacteria | 1350 |
| 573 | Ga0501080_0009178 | 3300049742 | Bacteria | 9008 |
| 574 | Ga0501080_0030371 | 3300049742 | Bacteria | 5034 |
| 575 | Ga0501080_0067057 | 3300049742 | Bacteria | 3338 |
| 576 | Ga0501080_0328344 | 3300049742 | Bacteria | 1384 |
| 577 | Ga0501081_0074794 | 3300049743 | Bacteria | 2363 |
| 578 | Ga0501081_0080164 | 3300049743 | Bacteria | 2284 |
| 579 | Ga0501081_0276691 | 3300049743 | Bacteria | 1228 |
| 580 | Ga0501083_0053471 | 3300049744 | Bacteria | 2711 |
| 581 | Ga0501044_0397533 | 3300049823 | Bacteria | 1291 |
| 582 | Ga0501045_0019377 | 3300049824 | Bacteria | 4849 |
| 583 | Ga0501045_0057360 | 3300049824 | Unclassified | 2849 |
| 584 | Ga0501045_0172971 | 3300049824 | Bacteria | 1609 |
| 585 | Ga0501045_0178723 | 3300049824 | Bacteria | 1581 |
| 586 | nmdc:mga05p37_138046_c1 | 3300050507 | Bacteria | 2988 |
| 587 | nmdc:mga05p37_17992_c1 | 3300050507 | Bacteria | 8534 |
| 588 | nmdc:mga05p37_1824_c1 | 3300050507 | Bacteria | 24835 |
| 589 | nmdc:mga05p37_437763_c1 | 3300050507 | Bacteria | 1517 |
| 590 | nmdc:mga05p37_569042_c1 | 3300050507 | Bacteria | 1286 |
| 591 | nmdc:mga05p37_684009_c1 | 3300050507 | Bacteria | 1143 |
| 592 | nmdc:mga05p37_744175_c1 | 3300050507 | Bacteria | 1082 |
| 593 | nmdc:mga06r32_2010_c1 | 3300050510 | Bacteria | 15629 |
| 594 | nmdc:mga08y16_199917_c1 | 3300050511 | Bacteria | 2071 |
| 595 | nmdc:mga08y16_248110_c1 | 3300050511 | Bacteria | 1840 |
| 596 | nmdc:mga08y16_4_c1 | 3300050511 | Bacteria | 916963 |
| 597 | nmdc:mga0n895_1402_c1 | 3300050512 | Bacteria | 17974 |
| 598 | nmdc:mga0n895_162198_c1 | 3300050512 | Bacteria | 2267 |
| 599 | nmdc:mga0n895_162357_c1 | 3300050512 | Bacteria | 2266 |
| 600 | nmdc:mga0n895_259536_c1 | 3300050512 | Bacteria | 1763 |
| 601 | nmdc:mga0n895_453912_c1 | 3300050512 | Bacteria | 1294 |
| 602 | nmdc:mga0rr50_118222_c1 | 3300050513 | Bacteria | 2106 |
| 603 | nmdc:mga0rr50_368_c1 | 3300050513 | Bacteria | 24581 |
| 604 | nmdc:mga0rr50_37_c1 | 3300050513 | Bacteria | 87211 |
| 605 | nmdc:mga08x19_262210_c1 | 3300050514 | Bacteria | 1195 |
| 606 | nmdc:mga08x19_5540_c1 | 3300050514 | Bacteria | 7464 |
| 607 | nmdc:mga08x19_76552_c1 | 3300050514 | Bacteria | 2189 |
| 608 | nmdc:mga08x19_81471_c1 | 3300050514 | Bacteria | 2125 |
| 609 | nmdc:mga0a205_16901_c1 | 3300050515 | Bacteria | 6830 |
| 610 | nmdc:mga0a205_226_c1 | 3300050515 | Bacteria | 31030 |
| 611 | nmdc:mga0a205_385558_c1 | 3300050515 | Bacteria | 1266 |
| 612 | nmdc:mga0a205_63668_c1 | 3300050515 | Bacteria | 3562 |
| 613 | nmdc:mga0a205_87204_c1 | 3300050515 | Bacteria | 3015 |
| 614 | nmdc:mga0a205_88607_c1 | 3300050515 | Bacteria | 2991 |
| 615 | Ga0495601_0056655 | 3300053077 | Bacteria | 2482 |
| 616 | Ga0495601_0128076 | 3300053077 | Bacteria | 1652 |
| 617 | Ga0495655_0000162 | 3300053083 | Bacteria | 12713 |
| 618 | Ga0495619_0021276 | 3300053085 | Bacteria | 4138 |
| 619 | Ga0501084_0038173 | 3300054114 | Bacteria | 4015 |
| 620 | Ga0501084_0065515 | 3300054114 | Bacteria | 3040 |
| 621 | Ga0501084_0073668 | 3300054114 | Unclassified | 2859 |
| 622 | Ga0590071_011322 | 3300059421 | Bacteria | 2087 |
| 623 | Ga0590074_001032 | 3300059423 | Bacteria | 4379 |
| 624 | Ga0501082_0052663 | 3300060353 | Bacteria | 3508 |
| 625 | Ga0501082_0094724 | 3300060353 | Bacteria | 2580 |
| 626 | Ga0501082_0114307 | 3300060353 | Bacteria | 2337 |
| 627 | Ga0501082_0341790 | 3300060353 | Bacteria | 1304 |
| 628 | Ga0530510_0003157 | 3300061734 | Bacteria | 11316 |
| 629 | Ga0530510_0095172 | 3300061734 | Bacteria | 2175 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037588 | Ga0316581_0016940 | Ga0316581_0016940_44_886 | 279 |
| 2 | 3300049741 | Ga0501079_0262383 | Ga0501079_0262383_458_1336 | 291 |
| 3 | 3300049742 | Ga0501080_0328344 | Ga0501080_0328344_27_926 | 298 |
| 4 | 3300025918 | Ga0207662_10010636 | Ga0207662_100106367 | 306 |
| 5 | 3300013306 | Ga0163162_10572919 | Ga0163162_105729191 | 308 |
| 6 | 3300049589 | Ga0501073_0007235 | Ga0501073_0007235_5287_6219 | 310 |
| 7 | 3300049742 | Ga0501080_0009178 | Ga0501080_0009178_7511_8443 | 310 |
| 8 | 3300048905 | Ga0496102_0357407 | Ga0496102_0357407_353_1339 | 312 |
| 9 | 3300009093 | Ga0105240_10023431 | Ga0105240_100234317 | 313 |
| 10 | 3300014325 | Ga0163163_10007890 | Ga0163163_100078908 | 313 |
| 11 | 3300048905 | Ga0496102_0238545 | Ga0496102_0238545_173_1192 | 313 |
| 12 | 3300048912 | Ga0496109_0021093 | Ga0496109_0021093_2902_3921 | 313 |
| 13 | 3300048913 | Ga0496110_0144756 | Ga0496110_0144756_150_1169 | 313 |
| 14 | 3300048914 | Ga0496111_0031474 | Ga0496111_0031474_437_1456 | 313 |
| 15 | 3300047322 | Ga0495680_0217410 | Ga0495680_0217410_112_1137 | 314 |
| 16 | 3300053077 | Ga0495601_0128076 | Ga0495601_0128076_413_1438 | 314 |
| 17 | 3300050512 | nmdc:mga0n895_453912_c1 | nmdc:mga0n895_453912_c1_120_1268 | 315 |
| 18 | 3300050514 | nmdc:mga08x19_81471_c1 | nmdc:mga08x19_81471_c1_69_1217 | 315 |
| 19 | 3300034818 | Ga0373950_0000016 | Ga0373950_0000016_239375_240391 | 317 |
| 20 | 3300049589 | Ga0501073_0000332 | Ga0501073_0000332_27801_28817 | 317 |
| 21 | 3300005354 | Ga0070675_100000005 | Ga0070675_10000000546 | 318 |
| 22 | 3300006871 | Ga0075434_100164026 | Ga0075434_1001640263 | 318 |
| 23 | 3300025926 | Ga0207659_10000067 | Ga0207659_1000006719 | 318 |
| 24 | 3300031665 | Ga0316575_10010773 | Ga0316575_100107732 | 318 |
| 25 | 3300031691 | Ga0316579_10059664 | Ga0316579_100596642 | 318 |
| 26 | 3300031727 | Ga0316576_10010653 | Ga0316576_100106532 | 318 |
| 27 | 3300031728 | Ga0316578_10005092 | Ga0316578_100050922 | 318 |
| 28 | 3300032133 | Ga0316583_10005222 | Ga0316583_100052223 | 318 |
| 29 | 3300032139 | Ga0316580_10012162 | Ga0316580_100121622 | 318 |
| 30 | 3300050512 | nmdc:mga0n895_162198_c1 | nmdc:mga0n895_162198_c1_60_1016 | 318 |
| 31 | 3300005330 | Ga0070690_100031417 | Ga0070690_1000314175 | 319 |
| 32 | 3300005445 | Ga0070708_100010262 | Ga0070708_1000102624 | 319 |
| 33 | 3300035398 | Ga0316574_0035974 | Ga0316574_0035974_1810_2808 | 319 |
| 34 | 3300036647 | Ga0316582_0009004 | Ga0316582_0009004_2470_3468 | 319 |
| 35 | 3300050510 | nmdc:mga06r32_2010_c1 | nmdc:mga06r32_2010_c1_11905_12864 | 319 |
| 36 | 3300036647 | Ga0316582_0029245 | Ga0316582_0029245_2246_3211 | 320 |
| 37 | 3300005445 | Ga0070708_100066506 | Ga0070708_1000665062 | 321 |
| 38 | 3300005536 | Ga0070697_100071706 | Ga0070697_1000717062 | 321 |
| 39 | 3300005546 | Ga0070696_100079598 | Ga0070696_1000795982 | 321 |
| 40 | 3300005841 | Ga0068863_100368861 | Ga0068863_1003688612 | 321 |
| 41 | 3300009093 | Ga0105240_10084935 | Ga0105240_100849352 | 321 |
| 42 | 3300014325 | Ga0163163_10049408 | Ga0163163_100494081 | 321 |
| 43 | 3300025922 | Ga0207646_10062181 | Ga0207646_100621813 | 321 |
| 44 | 3300026088 | Ga0207641_10319120 | Ga0207641_103191202 | 321 |
| 45 | 3300031731 | Ga0307405_10102976 | Ga0307405_101029762 | 321 |
| 46 | 3300035398 | Ga0316574_0131511 | Ga0316574_0131511_381_1385 | 321 |
| 47 | 3300036647 | Ga0316582_0035450 | Ga0316582_0035450_2064_3068 | 321 |
| 48 | 3300049578 | Ga0501042_0130025 | Ga0501042_0130025_38_1009 | 321 |
| 49 | 3300005337 | Ga0070682_100038193 | Ga0070682_1000381933 | 322 |
| 50 | 3300009177 | Ga0105248_10062791 | Ga0105248_100627912 | 322 |
| 51 | 3300025981 | Ga0207640_10048547 | Ga0207640_100485472 | 322 |
| 52 | 3300032126 | Ga0307415_100022053 | Ga0307415_1000220532 | 322 |
| 53 | 3300035725 | Ga0373947_0081969 | Ga0373947_0081969_453_1490 | 322 |
| 54 | 3300042876 | Ga0451577_0000018 | Ga0451577_0000018_373375_374346 | 322 |
| 55 | 3300044712 | Ga0453684_0000166 | Ga0453684_0000166_142154_143125 | 322 |
| 56 | 3300046533 | Ga0495640_0175120 | Ga0495640_0175120_83_1120 | 322 |
| 57 | 3300048905 | Ga0496102_0022615 | Ga0496102_0022615_189_1208 | 322 |
| 58 | 3300048915 | Ga0496112_0123321 | Ga0496112_0123321_779_1798 | 322 |
| 59 | 3300049568 | Ga0501031_0135315 | Ga0501031_0135315_506_1525 | 322 |
| 60 | 3300049572 | Ga0501036_0091353 | Ga0501036_0091353_765_1784 | 322 |
| 61 | 3300049572 | Ga0501036_0290871 | Ga0501036_0290871_199_1218 | 322 |
| 62 | 3300049576 | Ga0501040_0011760 | Ga0501040_0011760_2912_3931 | 322 |
| 63 | 3300049576 | Ga0501040_0125183 | Ga0501040_0125183_666_1685 | 322 |
| 64 | 3300049577 | Ga0501041_0109957 | Ga0501041_0109957_463_1482 | 322 |
| 65 | 3300049578 | Ga0501042_0102098 | Ga0501042_0102098_874_1893 | 322 |
| 66 | 3300049580 | Ga0501046_0259535 | Ga0501046_0259535_143_1162 | 322 |
| 67 | 3300049582 | Ga0501048_0088831 | Ga0501048_0088831_1095_2114 | 322 |
| 68 | 3300049591 | Ga0501075_0005186 | Ga0501075_0005186_4534_5553 | 322 |
| 69 | 3300049591 | Ga0501075_0012600 | Ga0501075_0012600_4425_5444 | 322 |
| 70 | 3300049591 | Ga0501075_0103642 | Ga0501075_0103642_353_1372 | 322 |
| 71 | 3300049591 | Ga0501075_0238754 | Ga0501075_0238754_198_1217 | 322 |
| 72 | 3300049592 | Ga0501076_0060791 | Ga0501076_0060791_534_1553 | 322 |
| 73 | 3300049592 | Ga0501076_0133880 | Ga0501076_0133880_966_1985 | 322 |
| 74 | 3300049592 | Ga0501076_0196587 | Ga0501076_0196587_39_1058 | 322 |
| 75 | 3300049593 | Ga0501077_0015873 | Ga0501077_0015873_1799_2818 | 322 |
| 76 | 3300049741 | Ga0501079_0102757 | Ga0501079_0102757_132_1151 | 322 |
| 77 | 3300049741 | Ga0501079_0154260 | Ga0501079_0154260_748_1767 | 322 |
| 78 | 3300049743 | Ga0501081_0074794 | Ga0501081_0074794_110_1129 | 322 |
| 79 | 3300049743 | Ga0501081_0276691 | Ga0501081_0276691_20_1039 | 322 |
| 80 | 3300049824 | Ga0501045_0019377 | Ga0501045_0019377_3456_4475 | 322 |
| 81 | 3300049824 | Ga0501045_0172971 | Ga0501045_0172971_169_1188 | 322 |
| 82 | 3300049824 | Ga0501045_0178723 | Ga0501045_0178723_325_1344 | 322 |
| 83 | 3300050507 | nmdc:mga05p37_437763_c1 | nmdc:mga05p37_437763_c1_41_1060 | 322 |
| 84 | 3300054114 | Ga0501084_0038173 | Ga0501084_0038173_971_1990 | 322 |
| 85 | 3300054114 | Ga0501084_0065515 | Ga0501084_0065515_1009_2028 | 322 |
| 86 | 3300060353 | Ga0501082_0094724 | Ga0501082_0094724_108_1127 | 322 |
| 87 | 3300061734 | Ga0530510_0003157 | Ga0530510_0003157_7891_8910 | 322 |
| 88 | 3300005467 | Ga0070706_100458796 | Ga0070706_1004587961 | 323 |
| 89 | 3300005535 | Ga0070684_100175063 | Ga0070684_1001750632 | 323 |
| 90 | 3300005546 | Ga0070696_100003949 | Ga0070696_1000039498 | 323 |
| 91 | 3300005546 | Ga0070696_100184201 | Ga0070696_1001842011 | 323 |
| 92 | 3300005840 | Ga0068870_10010632 | Ga0068870_100106323 | 323 |
| 93 | 3300005843 | Ga0068860_100031385 | Ga0068860_1000313854 | 323 |
| 94 | 3300006881 | Ga0068865_100020445 | Ga0068865_1000204452 | 323 |
| 95 | 3300025899 | Ga0207642_10117392 | Ga0207642_101173922 | 323 |
| 96 | 3300025908 | Ga0207643_10007413 | Ga0207643_100074134 | 323 |
| 97 | 3300025910 | Ga0207684_10293599 | Ga0207684_102935991 | 323 |
| 98 | 3300025918 | Ga0207662_10000761 | Ga0207662_100007615 | 323 |
| 99 | 3300025925 | Ga0207650_10006075 | Ga0207650_100060756 | 323 |
| 100 | 3300025926 | Ga0207659_10003166 | Ga0207659_100031665 | 323 |
| 101 | 3300025927 | Ga0207687_10026795 | Ga0207687_100267952 | 323 |
| 102 | 3300025932 | Ga0207690_10007375 | Ga0207690_100073753 | 323 |
| 103 | 3300025933 | Ga0207706_10005264 | Ga0207706_100052647 | 323 |
| 104 | 3300025936 | Ga0207670_10004911 | Ga0207670_100049112 | 323 |
| 105 | 3300025944 | Ga0207661_10203204 | Ga0207661_102032042 | 323 |
| 106 | 3300025960 | Ga0207651_10016931 | Ga0207651_100169312 | 323 |
| 107 | 3300026067 | Ga0207678_10017619 | Ga0207678_100176194 | 323 |
| 108 | 3300026075 | Ga0207708_10001539 | Ga0207708_1000153911 | 323 |
| 109 | 3300026089 | Ga0207648_10011285 | Ga0207648_100112858 | 323 |
| 110 | 3300026118 | Ga0207675_100105611 | Ga0207675_1001056112 | 323 |
| 111 | 3300032126 | Ga0307415_100091175 | Ga0307415_1000911752 | 323 |
| 112 | 3300035112 | Ga0373932_0000024 | Ga0373932_0000024_14040_15041 | 323 |
| 113 | 3300036401 | Ga0373937_0397596 | Ga0373937_0397596_287_1270 | 323 |
| 114 | 3300039093 | Ga0400489_56403 | Ga0400489_56403_36737_37720 | 323 |
| 115 | 3300044673 | Ga0453683_0020166 | Ga0453683_0020166_155_1129 | 323 |
| 116 | 3300048915 | Ga0496112_0000001 | Ga0496112_0000001_236564_237547 | 323 |
| 117 | 3300005467 | Ga0070706_100059347 | Ga0070706_1000593472 | 324 |
| 118 | 3300005471 | Ga0070698_100057515 | Ga0070698_1000575153 | 324 |
| 119 | 3300005518 | Ga0070699_100026256 | Ga0070699_1000262563 | 324 |
| 120 | 3300025910 | Ga0207684_10035728 | Ga0207684_100357282 | 324 |
| 121 | 3300045976 | Ga0466967_0050007 | Ga0466967_0050007_1653_2636 | 324 |
| 122 | 3300005329 | Ga0070683_100133128 | Ga0070683_1001331282 | 325 |
| 123 | 3300005329 | Ga0070683_100208857 | Ga0070683_1002088572 | 325 |
| 124 | 3300005331 | Ga0070670_100004914 | Ga0070670_1000049146 | 325 |
| 125 | 3300005334 | Ga0068869_100026266 | Ga0068869_1000262662 | 325 |
| 126 | 3300005338 | Ga0068868_100148768 | Ga0068868_1001487682 | 325 |
| 127 | 3300005340 | Ga0070689_100004063 | Ga0070689_10000406312 | 325 |
| 128 | 3300005343 | Ga0070687_100000425 | Ga0070687_10000042513 | 325 |
| 129 | 3300005344 | Ga0070661_100033374 | Ga0070661_1000333744 | 325 |
| 130 | 3300005345 | Ga0070692_10000642 | Ga0070692_1000064210 | 325 |
| 131 | 3300005354 | Ga0070675_100051410 | Ga0070675_1000514103 | 325 |
| 132 | 3300005356 | Ga0070674_100003957 | Ga0070674_1000039575 | 325 |
| 133 | 3300005356 | Ga0070674_100038734 | Ga0070674_1000387343 | 325 |
| 134 | 3300005364 | Ga0070673_100180099 | Ga0070673_1001800992 | 325 |
| 135 | 3300005365 | Ga0070688_100010351 | Ga0070688_1000103513 | 325 |
| 136 | 3300005366 | Ga0070659_100001254 | Ga0070659_1000012544 | 325 |
| 137 | 3300005438 | Ga0070701_10001392 | Ga0070701_100013923 | 325 |
| 138 | 3300005440 | Ga0070705_100059050 | Ga0070705_1000590502 | 325 |
| 139 | 3300005441 | Ga0070700_100001257 | Ga0070700_1000012576 | 325 |
| 140 | 3300005441 | Ga0070700_100186866 | Ga0070700_1001868662 | 325 |
| 141 | 3300005455 | Ga0070663_100028054 | Ga0070663_1000280542 | 325 |
| 142 | 3300005456 | Ga0070678_100003548 | Ga0070678_1000035483 | 325 |
| 143 | 3300005457 | Ga0070662_100005463 | Ga0070662_1000054637 | 325 |
| 144 | 3300005466 | Ga0070685_10006547 | Ga0070685_100065473 | 325 |
| 145 | 3300005467 | Ga0070706_100030392 | Ga0070706_1000303925 | 325 |
| 146 | 3300005467 | Ga0070706_100086679 | Ga0070706_1000866792 | 325 |
| 147 | 3300005467 | Ga0070706_100090360 | Ga0070706_1000903603 | 325 |
| 148 | 3300005468 | Ga0070707_100001134 | Ga0070707_10000113425 | 325 |
| 149 | 3300005468 | Ga0070707_100062993 | Ga0070707_1000629931 | 325 |
| 150 | 3300005468 | Ga0070707_100197995 | Ga0070707_1001979951 | 325 |
| 151 | 3300005468 | Ga0070707_100413795 | Ga0070707_1004137951 | 325 |
| 152 | 3300005471 | Ga0070698_100016054 | Ga0070698_1000160543 | 325 |
| 153 | 3300005471 | Ga0070698_100039399 | Ga0070698_1000393993 | 325 |
| 154 | 3300005518 | Ga0070699_100022070 | Ga0070699_1000220702 | 325 |
| 155 | 3300005518 | Ga0070699_100140006 | Ga0070699_1001400062 | 325 |
| 156 | 3300005518 | Ga0070699_100195372 | Ga0070699_1001953722 | 325 |
| 157 | 3300005530 | Ga0070679_100199049 | Ga0070679_1001990492 | 325 |
| 158 | 3300005535 | Ga0070684_100201832 | Ga0070684_1002018322 | 325 |
| 159 | 3300005536 | Ga0070697_100051652 | Ga0070697_1000516522 | 325 |
| 160 | 3300005536 | Ga0070697_100054003 | Ga0070697_1000540032 | 325 |
| 161 | 3300005543 | Ga0070672_100047389 | Ga0070672_1000473892 | 325 |
| 162 | 3300005544 | Ga0070686_100003654 | Ga0070686_1000036542 | 325 |
| 163 | 3300005545 | Ga0070695_100040534 | Ga0070695_1000405342 | 325 |
| 164 | 3300005546 | Ga0070696_100028738 | Ga0070696_1000287383 | 325 |
| 165 | 3300005546 | Ga0070696_100049261 | Ga0070696_1000492613 | 325 |
| 166 | 3300005546 | Ga0070696_100228594 | Ga0070696_1002285941 | 325 |
| 167 | 3300005549 | Ga0070704_100010977 | Ga0070704_1000109774 | 325 |
| 168 | 3300005564 | Ga0070664_100009451 | Ga0070664_1000094516 | 325 |
| 169 | 3300005577 | Ga0068857_100086612 | Ga0068857_1000866122 | 325 |
| 170 | 3300005615 | Ga0070702_100010436 | Ga0070702_1000104365 | 325 |
| 171 | 3300005615 | Ga0070702_100128546 | Ga0070702_1001285461 | 325 |
| 172 | 3300005719 | Ga0068861_100132034 | Ga0068861_1001320342 | 325 |
| 173 | 3300005834 | Ga0068851_10091084 | Ga0068851_100910842 | 325 |
| 174 | 3300005842 | Ga0068858_100043317 | Ga0068858_1000433173 | 325 |
| 175 | 3300005937 | Ga0081455_10060748 | Ga0081455_100607482 | 325 |
| 176 | 3300005985 | Ga0081539_10014649 | Ga0081539_100146495 | 325 |
| 177 | 3300006844 | Ga0075428_100000305 | Ga0075428_10000030534 | 325 |
| 178 | 3300006852 | Ga0075433_10054854 | Ga0075433_100548543 | 325 |
| 179 | 3300009098 | Ga0105245_10009835 | Ga0105245_100098358 | 325 |
| 180 | 3300009098 | Ga0105245_10040895 | Ga0105245_100408953 | 325 |
| 181 | 3300009098 | Ga0105245_10429944 | Ga0105245_104299441 | 325 |
| 182 | 3300009147 | Ga0114129_10020258 | Ga0114129_100202582 | 325 |
| 183 | 3300009147 | Ga0114129_10023250 | Ga0114129_100232508 | 325 |
| 184 | 3300009147 | Ga0114129_10105876 | Ga0114129_101058763 | 325 |
| 185 | 3300009148 | Ga0105243_10010790 | Ga0105243_100107903 | 325 |
| 186 | 3300009148 | Ga0105243_10161137 | Ga0105243_101611371 | 325 |
| 187 | 3300009545 | Ga0105237_10137917 | Ga0105237_101379172 | 325 |
| 188 | 3300009553 | Ga0105249_10003565 | Ga0105249_1000356510 | 325 |
| 189 | 3300010375 | Ga0105239_10006639 | Ga0105239_100066399 | 325 |
| 190 | 3300010375 | Ga0105239_10042465 | Ga0105239_100424654 | 325 |
| 191 | 3300010375 | Ga0105239_10118468 | Ga0105239_101184682 | 325 |
| 192 | 3300011119 | Ga0105246_10120563 | Ga0105246_101205632 | 325 |
| 193 | 3300013297 | Ga0157378_10007473 | Ga0157378_100074734 | 325 |
| 194 | 3300013306 | Ga0163162_10230828 | Ga0163162_102308282 | 325 |
| 195 | 3300013306 | Ga0163162_10296533 | Ga0163162_102965332 | 325 |
| 196 | 3300013308 | Ga0157375_10009868 | Ga0157375_100098683 | 325 |
| 197 | 3300014325 | Ga0163163_10097183 | Ga0163163_100971832 | 325 |
| 198 | 3300014325 | Ga0163163_10281206 | Ga0163163_102812062 | 325 |
| 199 | 3300014325 | Ga0163163_10381291 | Ga0163163_103812912 | 325 |
| 200 | 3300014326 | Ga0157380_10010378 | Ga0157380_100103784 | 325 |
| 201 | 3300014326 | Ga0157380_10458216 | Ga0157380_104582162 | 325 |
| 202 | 3300014497 | Ga0182008_10102961 | Ga0182008_101029612 | 325 |
| 203 | 3300014968 | Ga0157379_10058393 | Ga0157379_100583932 | 325 |
| 204 | 3300014968 | Ga0157379_10240933 | Ga0157379_102409332 | 325 |
| 205 | 3300017792 | Ga0163161_10092835 | Ga0163161_100928352 | 325 |
| 206 | 3300025910 | Ga0207684_10006428 | Ga0207684_100064288 | 325 |
| 207 | 3300025910 | Ga0207684_10064756 | Ga0207684_100647563 | 325 |
| 208 | 3300025910 | Ga0207684_10150767 | Ga0207684_101507672 | 325 |
| 209 | 3300025912 | Ga0207707_10010264 | Ga0207707_100102649 | 325 |
| 210 | 3300025917 | Ga0207660_10000002 | Ga0207660_10000002687 | 325 |
| 211 | 3300025918 | Ga0207662_10002117 | Ga0207662_100021175 | 325 |
| 212 | 3300025921 | Ga0207652_10256545 | Ga0207652_102565452 | 325 |
| 213 | 3300025922 | Ga0207646_10000242 | Ga0207646_1000024223 | 325 |
| 214 | 3300025922 | Ga0207646_10249496 | Ga0207646_102494962 | 325 |
| 215 | 3300025922 | Ga0207646_10265255 | Ga0207646_102652552 | 325 |
| 216 | 3300025927 | Ga0207687_10060532 | Ga0207687_100605322 | 325 |
| 217 | 3300025933 | Ga0207706_10234844 | Ga0207706_102348441 | 325 |
| 218 | 3300025935 | Ga0207709_10238262 | Ga0207709_102382621 | 325 |
| 219 | 3300025940 | Ga0207691_10064519 | Ga0207691_100645193 | 325 |
| 220 | 3300025944 | Ga0207661_10110717 | Ga0207661_101107172 | 325 |
| 221 | 3300025945 | Ga0207679_10213625 | Ga0207679_102136252 | 325 |
| 222 | 3300025961 | Ga0207712_10096479 | Ga0207712_100964791 | 325 |
| 223 | 3300025981 | Ga0207640_10111554 | Ga0207640_101115542 | 325 |
| 224 | 3300026023 | Ga0207677_10049379 | Ga0207677_100493792 | 325 |
| 225 | 3300026023 | Ga0207677_10123489 | Ga0207677_101234892 | 325 |
| 226 | 3300026118 | Ga0207675_100111357 | Ga0207675_1001113572 | 325 |
| 227 | 3300026121 | Ga0207683_10009630 | Ga0207683_100096304 | 325 |
| 228 | 3300027876 | Ga0209974_10015913 | Ga0209974_100159132 | 325 |
| 229 | 3300027907 | Ga0207428_10060251 | Ga0207428_100602512 | 325 |
| 230 | 3300028556 | Ga0265337_1003707 | Ga0265337_10037072 | 325 |
| 231 | 3300028558 | Ga0265326_10004762 | Ga0265326_100047623 | 325 |
| 232 | 3300028563 | Ga0265319_1004203 | Ga0265319_10042034 | 325 |
| 233 | 3300028563 | Ga0265319_1013527 | Ga0265319_10135271 | 325 |
| 234 | 3300028573 | Ga0265334_10005117 | Ga0265334_100051173 | 325 |
| 235 | 3300028577 | Ga0265318_10011166 | Ga0265318_100111662 | 325 |
| 236 | 3300028653 | Ga0265323_10035789 | Ga0265323_100357892 | 325 |
| 237 | 3300028654 | Ga0265322_10005011 | Ga0265322_100050113 | 325 |
| 238 | 3300028654 | Ga0265322_10009152 | Ga0265322_100091522 | 325 |
| 239 | 3300028800 | Ga0265338_10052337 | Ga0265338_100523373 | 325 |
| 240 | 3300031235 | Ga0265330_10012480 | Ga0265330_100124801 | 325 |
| 241 | 3300031235 | Ga0265330_10050088 | Ga0265330_100500882 | 325 |
| 242 | 3300031240 | Ga0265320_10006971 | Ga0265320_100069712 | 325 |
| 243 | 3300031241 | Ga0265325_10039889 | Ga0265325_100398892 | 325 |
| 244 | 3300031242 | Ga0265329_10029070 | Ga0265329_100290702 | 325 |
| 245 | 3300031249 | Ga0265339_10068558 | Ga0265339_100685582 | 325 |
| 246 | 3300031344 | Ga0265316_10024348 | Ga0265316_100243485 | 325 |
| 247 | 3300031711 | Ga0265314_10073004 | Ga0265314_100730042 | 325 |
| 248 | 3300031727 | Ga0316576_10013703 | Ga0316576_100137034 | 325 |
| 249 | 3300032133 | Ga0316583_10008129 | Ga0316583_100081292 | 325 |
| 250 | 3300037588 | Ga0316581_0021242 | Ga0316581_0021242_598_1632 | 325 |
| 251 | 3300047321 | Ga0495676_0160056 | Ga0495676_0160056_320_1357 | 325 |
| 252 | 3300048903 | Ga0496100_0214806 | Ga0496100_0214806_181_1206 | 325 |
| 253 | 3300048904 | Ga0496101_0002712 | Ga0496101_0002712_2632_3657 | 325 |
| 254 | 3300048904 | Ga0496101_0167618 | Ga0496101_0167618_334_1353 | 325 |
| 255 | 3300048905 | Ga0496102_0129288 | Ga0496102_0129288_1135_2154 | 325 |
| 256 | 3300048905 | Ga0496102_0259029 | Ga0496102_0259029_487_1467 | 325 |
| 257 | 3300048907 | Ga0496104_0142634 | Ga0496104_0142634_1189_2214 | 325 |
| 258 | 3300048907 | Ga0496104_0351071 | Ga0496104_0351071_59_1078 | 325 |
| 259 | 3300048909 | Ga0496106_0159315 | Ga0496106_0159315_478_1497 | 325 |
| 260 | 3300048911 | Ga0496108_0005830 | Ga0496108_0005830_2404_3423 | 325 |
| 261 | 3300048911 | Ga0496108_0013192 | Ga0496108_0013192_5260_6285 | 325 |
| 262 | 3300048911 | Ga0496108_0013250 | Ga0496108_0013250_628_1653 | 325 |
| 263 | 3300048912 | Ga0496109_0012030 | Ga0496109_0012030_2035_3060 | 325 |
| 264 | 3300048912 | Ga0496109_0015410 | Ga0496109_0015410_3238_4257 | 325 |
| 265 | 3300048912 | Ga0496109_0209138 | Ga0496109_0209138_51_1070 | 325 |
| 266 | 3300048913 | Ga0496110_0008330 | Ga0496110_0008330_6978_8003 | 325 |
| 267 | 3300048913 | Ga0496110_0013989 | Ga0496110_0013989_3178_4197 | 325 |
| 268 | 3300048914 | Ga0496111_0013535 | Ga0496111_0013535_1024_2043 | 325 |
| 269 | 3300048914 | Ga0496111_0031774 | Ga0496111_0031774_2048_3073 | 325 |
| 270 | 3300048916 | Ga0496113_0039907 | Ga0496113_0039907_93_1118 | 325 |
| 271 | 3300048916 | Ga0496113_0161139 | Ga0496113_0161139_442_1461 | 325 |
| 272 | 3300048916 | Ga0496113_0161790 | Ga0496113_0161790_104_1123 | 325 |
| 273 | 3300048917 | Ga0496114_0182505 | Ga0496114_0182505_402_1421 | 325 |
| 274 | 3300049572 | Ga0501036_0080350 | Ga0501036_0080350_1464_2483 | 325 |
| 275 | 3300049576 | Ga0501040_0056926 | Ga0501040_0056926_315_1334 | 325 |
| 276 | 3300049577 | Ga0501041_0034180 | Ga0501041_0034180_525_1544 | 325 |
| 277 | 3300049578 | Ga0501042_0088074 | Ga0501042_0088074_288_1307 | 325 |
| 278 | 3300049579 | Ga0501043_0099421 | Ga0501043_0099421_768_1787 | 325 |
| 279 | 3300049580 | Ga0501046_0153379 | Ga0501046_0153379_185_1204 | 325 |
| 280 | 3300049583 | Ga0501067_0010951 | Ga0501067_0010951_2803_3822 | 325 |
| 281 | 3300049583 | Ga0501067_0048720 | Ga0501067_0048720_1009_2034 | 325 |
| 282 | 3300049584 | Ga0501068_0015713 | Ga0501068_0015713_1176_2195 | 325 |
| 283 | 3300049585 | Ga0501069_0017652 | Ga0501069_0017652_1324_2349 | 325 |
| 284 | 3300049585 | Ga0501069_0044503 | Ga0501069_0044503_267_1286 | 325 |
| 285 | 3300049586 | Ga0501070_0074587 | Ga0501070_0074587_614_1633 | 325 |
| 286 | 3300049587 | Ga0501071_0016434 | Ga0501071_0016434_633_1652 | 325 |
| 287 | 3300049587 | Ga0501071_0245409 | Ga0501071_0245409_321_1337 | 325 |
| 288 | 3300049587 | Ga0501071_0301848 | Ga0501071_0301848_99_1118 | 325 |
| 289 | 3300049588 | Ga0501072_0254331 | Ga0501072_0254331_336_1355 | 325 |
| 290 | 3300049590 | Ga0501074_0023856 | Ga0501074_0023856_1596_2615 | 325 |
| 291 | 3300049591 | Ga0501075_0047794 | Ga0501075_0047794_1967_2986 | 325 |
| 292 | 3300049592 | Ga0501076_0059444 | Ga0501076_0059444_1350_2369 | 325 |
| 293 | 3300049592 | Ga0501076_0100650 | Ga0501076_0100650_248_1264 | 325 |
| 294 | 3300049593 | Ga0501077_0014692 | Ga0501077_0014692_3161_4180 | 325 |
| 295 | 3300049742 | Ga0501080_0030371 | Ga0501080_0030371_1223_2242 | 325 |
| 296 | 3300049742 | Ga0501080_0067057 | Ga0501080_0067057_1832_2851 | 325 |
| 297 | 3300049743 | Ga0501081_0080164 | Ga0501081_0080164_647_1666 | 325 |
| 298 | 3300049744 | Ga0501083_0053471 | Ga0501083_0053471_696_1715 | 325 |
| 299 | 3300049823 | Ga0501044_0397533 | Ga0501044_0397533_212_1231 | 325 |
| 300 | 3300049824 | Ga0501045_0057360 | Ga0501045_0057360_1641_2660 | 325 |
| 301 | 3300050507 | nmdc:mga05p37_138046_c1 | nmdc:mga05p37_138046_c1_875_1894 | 325 |
| 302 | 3300050507 | nmdc:mga05p37_1824_c1 | nmdc:mga05p37_1824_c1_18754_19770 | 325 |
| 303 | 3300050507 | nmdc:mga05p37_744175_c1 | nmdc:mga05p37_744175_c1_23_1042 | 325 |
| 304 | 3300050511 | nmdc:mga08y16_199917_c1 | nmdc:mga08y16_199917_c1_884_1903 | 325 |
| 305 | 3300050511 | nmdc:mga08y16_248110_c1 | nmdc:mga08y16_248110_c1_206_1225 | 325 |
| 306 | 3300050512 | nmdc:mga0n895_162357_c1 | nmdc:mga0n895_162357_c1_471_1490 | 325 |
| 307 | 3300050512 | nmdc:mga0n895_259536_c1 | nmdc:mga0n895_259536_c1_673_1653 | 325 |
| 308 | 3300050514 | nmdc:mga08x19_76552_c1 | nmdc:mga08x19_76552_c1_687_1706 | 325 |
| 309 | 3300050515 | nmdc:mga0a205_385558_c1 | nmdc:mga0a205_385558_c1_16_1032 | 325 |
| 310 | 3300050515 | nmdc:mga0a205_63668_c1 | nmdc:mga0a205_63668_c1_1172_2191 | 325 |
| 311 | 3300050515 | nmdc:mga0a205_87204_c1 | nmdc:mga0a205_87204_c1_687_1706 | 325 |
| 312 | 3300050515 | nmdc:mga0a205_88607_c1 | nmdc:mga0a205_88607_c1_1787_2803 | 325 |
| 313 | 3300054114 | Ga0501084_0073668 | Ga0501084_0073668_211_1230 | 325 |
| 314 | 3300059421 | Ga0590071_011322 | Ga0590071_011322_812_1798 | 325 |
| 315 | 3300059423 | Ga0590074_001032 | Ga0590074_001032_1514_2500 | 325 |
| 316 | 3300060353 | Ga0501082_0114307 | Ga0501082_0114307_1089_2108 | 325 |
| 317 | 3300061734 | Ga0530510_0095172 | Ga0530510_0095172_495_1514 | 325 |
| 318 | 3300005467 | Ga0070706_100001433 | Ga0070706_1000014338 | 326 |
| 319 | 3300006358 | Ga0068871_100123545 | Ga0068871_1001235453 | 326 |
| 320 | 3300013296 | Ga0157374_10074412 | Ga0157374_100744124 | 326 |
| 321 | 3300025910 | Ga0207684_10000354 | Ga0207684_1000035421 | 326 |
| 322 | 3300025937 | Ga0207669_10013257 | Ga0207669_100132574 | 326 |
| 323 | 3300026121 | Ga0207683_10001081 | Ga0207683_1000108118 | 326 |
| 324 | 3300028800 | Ga0265338_10059121 | Ga0265338_100591213 | 326 |
| 325 | 3300036647 | Ga0316582_0048907 | Ga0316582_0048907_869_1849 | 326 |
| 326 | 3300036712 | Ga0316584_0178458 | Ga0316584_0178458_381_1445 | 326 |
| 327 | 3300037312 | Ga0395899_0039592 | Ga0395899_0039592_726_1715 | 326 |
| 328 | 3300037418 | Ga0395900_0056534 | Ga0395900_0056534_865_1854 | 326 |
| 329 | 3300037466 | Ga0395898_0071382 | Ga0395898_0071382_2094_3083 | 326 |
| 330 | 3300038443 | Ga0395901_0042863 | Ga0395901_0042863_811_1800 | 326 |
| 331 | 3300039437 | Ga0436365_0319611 | Ga0436365_0319611_1431_2420 | 326 |
| 332 | 3300039437 | Ga0436365_1530999 | Ga0436365_1530999_420_1409 | 326 |
| 333 | 3300044712 | Ga0453684_0023645 | Ga0453684_0023645_2509_3498 | 326 |
| 334 | 3300028654 | Ga0265322_10023369 | Ga0265322_100233692 | 327 |
| 335 | 3300031238 | Ga0265332_10102180 | Ga0265332_101021801 | 327 |
| 336 | 3300031240 | Ga0265320_10010665 | Ga0265320_100106652 | 327 |
| 337 | 3300031241 | Ga0265325_10010933 | Ga0265325_100109332 | 327 |
| 338 | 3300031249 | Ga0265339_10078440 | Ga0265339_100784402 | 327 |
| 339 | 3300031250 | Ga0265331_10047581 | Ga0265331_100475812 | 327 |
| 340 | 3300031665 | Ga0316575_10005760 | Ga0316575_100057602 | 327 |
| 341 | 3300031711 | Ga0265314_10008942 | Ga0265314_100089422 | 327 |
| 342 | 3300032133 | Ga0316583_10005503 | Ga0316583_100055036 | 327 |
| 343 | 3300032137 | Ga0316585_10003454 | Ga0316585_100034542 | 327 |
| 344 | 3300035398 | Ga0316574_0015320 | Ga0316574_0015320_1987_2970 | 327 |
| 345 | 3300036647 | Ga0316582_0010088 | Ga0316582_0010088_658_1641 | 327 |
| 346 | 3300005436 | Ga0070713_100014092 | Ga0070713_1000140924 | 328 |
| 347 | 3300005549 | Ga0070704_100024581 | Ga0070704_1000245814 | 328 |
| 348 | 3300005617 | Ga0068859_100000001 | Ga0068859_100000001357 | 328 |
| 349 | 3300006028 | Ga0070717_10000216 | Ga0070717_100002164 | 328 |
| 350 | 3300006028 | Ga0070717_10217899 | Ga0070717_102178992 | 328 |
| 351 | 3300006931 | Ga0097620_100000001 | Ga0097620_100000001357 | 328 |
| 352 | 3300007076 | Ga0075435_100001706 | Ga0075435_1000017064 | 328 |
| 353 | 3300009147 | Ga0114129_10456577 | Ga0114129_104565772 | 328 |
| 354 | 3300036712 | Ga0316584_0139367 | Ga0316584_0139367_515_1501 | 328 |
| 355 | 3300050507 | nmdc:mga05p37_569042_c1 | nmdc:mga05p37_569042_c1_245_1234 | 328 |
| 356 | 3300050513 | nmdc:mga0rr50_37_c1 | nmdc:mga0rr50_37_c1_46066_47052 | 328 |
| 357 | 3300050514 | nmdc:mga08x19_5540_c1 | nmdc:mga08x19_5540_c1_4732_5718 | 328 |
| 358 | 3300005331 | Ga0070670_100056618 | Ga0070670_1000566183 | 329 |
| 359 | 3300005335 | Ga0070666_10024193 | Ga0070666_100241934 | 329 |
| 360 | 3300005338 | Ga0068868_100026790 | Ga0068868_1000267904 | 329 |
| 361 | 3300005364 | Ga0070673_100114186 | Ga0070673_1001141862 | 329 |
| 362 | 3300005367 | Ga0070667_100070353 | Ga0070667_1000703533 | 329 |
| 363 | 3300005456 | Ga0070678_100006558 | Ga0070678_1000065585 | 329 |
| 364 | 3300005543 | Ga0070672_100119147 | Ga0070672_1001191473 | 329 |
| 365 | 3300005548 | Ga0070665_100053302 | Ga0070665_1000533023 | 329 |
| 366 | 3300005841 | Ga0068863_100012687 | Ga0068863_1000126872 | 329 |
| 367 | 3300006237 | Ga0097621_100058461 | Ga0097621_1000584613 | 329 |
| 368 | 3300006358 | Ga0068871_100037481 | Ga0068871_1000374813 | 329 |
| 369 | 3300006844 | Ga0075428_100068217 | Ga0075428_1000682174 | 329 |
| 370 | 3300009177 | Ga0105248_10036494 | Ga0105248_100364943 | 329 |
| 371 | 3300013296 | Ga0157374_10158718 | Ga0157374_101587182 | 329 |
| 372 | 3300014325 | Ga0163163_10013898 | Ga0163163_100138984 | 329 |
| 373 | 3300014969 | Ga0157376_10021530 | Ga0157376_100215302 | 329 |
| 374 | 3300025910 | Ga0207684_10127555 | Ga0207684_101275552 | 329 |
| 375 | 3300025926 | Ga0207659_10091745 | Ga0207659_100917452 | 329 |
| 376 | 3300025931 | Ga0207644_10139847 | Ga0207644_101398472 | 329 |
| 377 | 3300025933 | Ga0207706_10096548 | Ga0207706_100965482 | 329 |
| 378 | 3300025941 | Ga0207711_10052073 | Ga0207711_100520734 | 329 |
| 379 | 3300026041 | Ga0207639_10000051 | Ga0207639_1000005150 | 329 |
| 380 | 3300026118 | Ga0207675_100153728 | Ga0207675_1001537282 | 329 |
| 381 | 3300028379 | Ga0268266_10048281 | Ga0268266_100482813 | 329 |
| 382 | 3300031691 | Ga0316579_10013828 | Ga0316579_100138282 | 329 |
| 383 | 3300031727 | Ga0316576_10039189 | Ga0316576_100391893 | 329 |
| 384 | 3300032133 | Ga0316583_10073822 | Ga0316583_100738221 | 329 |
| 385 | 3300035398 | Ga0316574_0090258 | Ga0316574_0090258_667_1701 | 329 |
| 386 | 3300036712 | Ga0316584_0080762 | Ga0316584_0080762_198_1187 | 329 |
| 387 | 3300037068 | Ga0373925_0218113 | Ga0373925_0218113_189_1184 | 329 |
| 388 | 3300038727 | Ga0400491_01175 | Ga0400491_01175_884_1873 | 329 |
| 389 | 3300038735 | Ga0400485_12823 | Ga0400485_12823_2986_3975 | 329 |
| 390 | 3300038735 | Ga0400485_12905 | Ga0400485_12905_2979_3968 | 329 |
| 391 | 3300038742 | Ga0400486_16900 | Ga0400486_16900_45039_46028 | 329 |
| 392 | 3300038742 | Ga0400486_27903 | Ga0400486_27903_17412_18401 | 329 |
| 393 | 3300039093 | Ga0400489_80261 | Ga0400489_80261_403_1392 | 329 |
| 394 | 3300039110 | Ga0400487_44648 | Ga0400487_44648_4050_5039 | 329 |
| 395 | 3300049578 | Ga0501042_0184328 | Ga0501042_0184328_418_1407 | 329 |
| 396 | 3300005330 | Ga0070690_100000448 | Ga0070690_10000044817 | 330 |
| 397 | 3300005333 | Ga0070677_10013681 | Ga0070677_100136813 | 330 |
| 398 | 3300005335 | Ga0070666_10000299 | Ga0070666_100002993 | 330 |
| 399 | 3300005340 | Ga0070689_100003483 | Ga0070689_1000034835 | 330 |
| 400 | 3300005344 | Ga0070661_100092975 | Ga0070661_1000929752 | 330 |
| 401 | 3300005353 | Ga0070669_100217865 | Ga0070669_1002178652 | 330 |
| 402 | 3300005367 | Ga0070667_100001154 | Ga0070667_10000115412 | 330 |
| 403 | 3300005441 | Ga0070700_100013777 | Ga0070700_1000137775 | 330 |
| 404 | 3300005445 | Ga0070708_100316701 | Ga0070708_1003167011 | 330 |
| 405 | 3300005455 | Ga0070663_100004197 | Ga0070663_1000041976 | 330 |
| 406 | 3300005459 | Ga0068867_100008933 | Ga0068867_1000089333 | 330 |
| 407 | 3300005468 | Ga0070707_100007211 | Ga0070707_10000721110 | 330 |
| 408 | 3300005543 | Ga0070672_100019300 | Ga0070672_1000193006 | 330 |
| 409 | 3300005546 | Ga0070696_100047684 | Ga0070696_1000476843 | 330 |
| 410 | 3300005548 | Ga0070665_100143722 | Ga0070665_1001437222 | 330 |
| 411 | 3300005549 | Ga0070704_100015344 | Ga0070704_1000153442 | 330 |
| 412 | 3300005564 | Ga0070664_100005721 | Ga0070664_10000572111 | 330 |
| 413 | 3300005614 | Ga0068856_100069978 | Ga0068856_1000699783 | 330 |
| 414 | 3300005617 | Ga0068859_100001014 | Ga0068859_10000101418 | 330 |
| 415 | 3300005617 | Ga0068859_100487613 | Ga0068859_1004876132 | 330 |
| 416 | 3300005618 | Ga0068864_100019276 | Ga0068864_1000192766 | 330 |
| 417 | 3300005719 | Ga0068861_100062860 | Ga0068861_1000628604 | 330 |
| 418 | 3300005840 | Ga0068870_10003769 | Ga0068870_100037696 | 330 |
| 419 | 3300005841 | Ga0068863_100060932 | Ga0068863_1000609324 | 330 |
| 420 | 3300005841 | Ga0068863_100075901 | Ga0068863_1000759012 | 330 |
| 421 | 3300005842 | Ga0068858_100000656 | Ga0068858_1000006565 | 330 |
| 422 | 3300005843 | Ga0068860_100001089 | Ga0068860_10000108914 | 330 |
| 423 | 3300005843 | Ga0068860_100049267 | Ga0068860_1000492674 | 330 |
| 424 | 3300006237 | Ga0097621_100025982 | Ga0097621_1000259822 | 330 |
| 425 | 3300006881 | Ga0068865_100056372 | Ga0068865_1000563722 | 330 |
| 426 | 3300006931 | Ga0097620_100001014 | Ga0097620_10000101414 | 330 |
| 427 | 3300006931 | Ga0097620_100487612 | Ga0097620_1004876122 | 330 |
| 428 | 3300009101 | Ga0105247_10084965 | Ga0105247_100849653 | 330 |
| 429 | 3300009177 | Ga0105248_10003323 | Ga0105248_1000332314 | 330 |
| 430 | 3300013306 | Ga0163162_10104939 | Ga0163162_101049393 | 330 |
| 431 | 3300013308 | Ga0157375_10000201 | Ga0157375_1000020129 | 330 |
| 432 | 3300014326 | Ga0157380_10056357 | Ga0157380_100563572 | 330 |
| 433 | 3300014969 | Ga0157376_10108873 | Ga0157376_101088732 | 330 |
| 434 | 3300017792 | Ga0163161_10230297 | Ga0163161_102302972 | 330 |
| 435 | 3300025893 | Ga0207682_10002222 | Ga0207682_100022225 | 330 |
| 436 | 3300025903 | Ga0207680_10000719 | Ga0207680_1000071914 | 330 |
| 437 | 3300025907 | Ga0207645_10152435 | Ga0207645_101524352 | 330 |
| 438 | 3300025908 | Ga0207643_10002858 | Ga0207643_100028586 | 330 |
| 439 | 3300025922 | Ga0207646_10029056 | Ga0207646_100290564 | 330 |
| 440 | 3300025925 | Ga0207650_10156871 | Ga0207650_101568712 | 330 |
| 441 | 3300025926 | Ga0207659_10234322 | Ga0207659_102343222 | 330 |
| 442 | 3300025933 | Ga0207706_10040135 | Ga0207706_100401352 | 330 |
| 443 | 3300025940 | Ga0207691_10002139 | Ga0207691_100021393 | 330 |
| 444 | 3300025940 | Ga0207691_10031463 | Ga0207691_100314632 | 330 |
| 445 | 3300025941 | Ga0207711_10003854 | Ga0207711_1000385410 | 330 |
| 446 | 3300025942 | Ga0207689_10008031 | Ga0207689_100080316 | 330 |
| 447 | 3300025945 | Ga0207679_10021058 | Ga0207679_100210583 | 330 |
| 448 | 3300025986 | Ga0207658_10003795 | Ga0207658_1000379510 | 330 |
| 449 | 3300026035 | Ga0207703_10001102 | Ga0207703_1000110211 | 330 |
| 450 | 3300026067 | Ga0207678_10009561 | Ga0207678_100095615 | 330 |
| 451 | 3300026078 | Ga0207702_10027375 | Ga0207702_100273753 | 330 |
| 452 | 3300026088 | Ga0207641_10013141 | Ga0207641_100131414 | 330 |
| 453 | 3300026095 | Ga0207676_10142424 | Ga0207676_101424242 | 330 |
| 454 | 3300028379 | Ga0268266_10412137 | Ga0268266_104121371 | 330 |
| 455 | 3300028381 | Ga0268264_10001715 | Ga0268264_1000171520 | 330 |
| 456 | 3300028381 | Ga0268264_10395477 | Ga0268264_103954772 | 330 |
| 457 | 3300031242 | Ga0265329_10031940 | Ga0265329_100319402 | 330 |
| 458 | 3300031344 | Ga0265316_10249588 | Ga0265316_102495882 | 330 |
| 459 | 3300039110 | Ga0400487_38723 | Ga0400487_38723_1216_2217 | 330 |
| 460 | 3300044712 | Ga0453684_0037013 | Ga0453684_0037013_5141_6136 | 330 |
| 461 | 3300048904 | Ga0496101_0002707 | Ga0496101_0002707_6661_7662 | 330 |
| 462 | 3300048905 | Ga0496102_0001300 | Ga0496102_0001300_11491_12492 | 330 |
| 463 | 3300048907 | Ga0496104_0081501 | Ga0496104_0081501_325_1326 | 330 |
| 464 | 3300048909 | Ga0496106_0000994 | Ga0496106_0000994_13242_14243 | 330 |
| 465 | 3300048910 | Ga0496107_0001103 | Ga0496107_0001103_8954_9955 | 330 |
| 466 | 3300048913 | Ga0496110_0046574 | Ga0496110_0046574_919_1920 | 330 |
| 467 | 3300048914 | Ga0496111_0007125 | Ga0496111_0007125_4420_5421 | 330 |
| 468 | 3300048916 | Ga0496113_0114662 | Ga0496113_0114662_816_1817 | 330 |
| 469 | 3300048918 | Ga0496115_0133683 | Ga0496115_0133683_631_1632 | 330 |
| 470 | 3300005334 | Ga0068869_100058975 | Ga0068869_1000589753 | 331 |
| 471 | 3300005345 | Ga0070692_10001369 | Ga0070692_100013696 | 331 |
| 472 | 3300005444 | Ga0070694_100038190 | Ga0070694_1000381902 | 331 |
| 473 | 3300005455 | Ga0070663_100144519 | Ga0070663_1001445192 | 331 |
| 474 | 3300005518 | Ga0070699_100228877 | Ga0070699_1002288771 | 331 |
| 475 | 3300005543 | Ga0070672_100055526 | Ga0070672_1000555262 | 331 |
| 476 | 3300005545 | Ga0070695_100009746 | Ga0070695_1000097466 | 331 |
| 477 | 3300005546 | Ga0070696_100020827 | Ga0070696_1000208274 | 331 |
| 478 | 3300005843 | Ga0068860_100025010 | Ga0068860_1000250105 | 331 |
| 479 | 3300006852 | Ga0075433_10000923 | Ga0075433_100009233 | 331 |
| 480 | 3300006871 | Ga0075434_100000559 | Ga0075434_10000055920 | 331 |
| 481 | 3300007076 | Ga0075435_100001424 | Ga0075435_1000014245 | 331 |
| 482 | 3300009147 | Ga0114129_10013672 | Ga0114129_100136725 | 331 |
| 483 | 3300009553 | Ga0105249_10001464 | Ga0105249_1000146416 | 331 |
| 484 | 3300013297 | Ga0157378_10109694 | Ga0157378_101096942 | 331 |
| 485 | 3300013306 | Ga0163162_10022779 | Ga0163162_100227794 | 331 |
| 486 | 3300014326 | Ga0157380_10115861 | Ga0157380_101158612 | 331 |
| 487 | 3300025923 | Ga0207681_10050786 | Ga0207681_100507862 | 331 |
| 488 | 3300025940 | Ga0207691_10034695 | Ga0207691_100346954 | 331 |
| 489 | 3300025942 | Ga0207689_10023505 | Ga0207689_100235055 | 331 |
| 490 | 3300026089 | Ga0207648_10351439 | Ga0207648_103514392 | 331 |
| 491 | 3300027395 | Ga0209996_1002487 | Ga0209996_10024873 | 331 |
| 492 | 3300027614 | Ga0209970_1000831 | Ga0209970_10008315 | 331 |
| 493 | 3300027665 | Ga0209983_1001136 | Ga0209983_10011365 | 331 |
| 494 | 3300027876 | Ga0209974_10022459 | Ga0209974_100224593 | 331 |
| 495 | 3300046459 | Ga0495629_0015900 | Ga0495629_0015900_2073_3077 | 331 |
| 496 | 3300047471 | Ga0495684_0086904 | Ga0495684_0086904_30_1034 | 331 |
| 497 | 3300050507 | nmdc:mga05p37_684009_c1 | nmdc:mga05p37_684009_c1_14_1018 | 331 |
| 498 | 3300050512 | nmdc:mga0n895_1402_c1 | nmdc:mga0n895_1402_c1_16696_17703 | 331 |
| 499 | 3300050513 | nmdc:mga0rr50_368_c1 | nmdc:mga0rr50_368_c1_12395_13402 | 331 |
| 500 | 3300050515 | nmdc:mga0a205_226_c1 | nmdc:mga0a205_226_c1_27669_28676 | 331 |
| 501 | 3300053077 | Ga0495601_0056655 | Ga0495601_0056655_1215_2219 | 331 |
| 502 | 3300053085 | Ga0495619_0021276 | Ga0495619_0021276_121_1125 | 331 |
| 503 | 3300060353 | Ga0501082_0052663 | Ga0501082_0052663_1462_2466 | 331 |
| 504 | 3300005459 | Ga0068867_100072211 | Ga0068867_1000722113 | 332 |
| 505 | 3300026089 | Ga0207648_10182439 | Ga0207648_101824391 | 332 |
| 506 | 3300005338 | Ga0068868_100001348 | Ga0068868_10000134813 | 333 |
| 507 | 3300005445 | Ga0070708_100005909 | Ga0070708_1000059093 | 333 |
| 508 | 3300005467 | Ga0070706_100002585 | Ga0070706_10000258510 | 333 |
| 509 | 3300005467 | Ga0070706_100007815 | Ga0070706_1000078154 | 333 |
| 510 | 3300005468 | Ga0070707_100119229 | Ga0070707_1001192293 | 333 |
| 511 | 3300005471 | Ga0070698_100016763 | Ga0070698_1000167635 | 333 |
| 512 | 3300005518 | Ga0070699_100327908 | Ga0070699_1003279082 | 333 |
| 513 | 3300005536 | Ga0070697_100024031 | Ga0070697_1000240311 | 333 |
| 514 | 3300005841 | Ga0068863_100056184 | Ga0068863_1000561844 | 333 |
| 515 | 3300005844 | Ga0068862_100000687 | Ga0068862_10000068728 | 333 |
| 516 | 3300006358 | Ga0068871_100032995 | Ga0068871_1000329953 | 333 |
| 517 | 3300009098 | Ga0105245_10003029 | Ga0105245_1000302913 | 333 |
| 518 | 3300009098 | Ga0105245_10270836 | Ga0105245_102708362 | 333 |
| 519 | 3300009147 | Ga0114129_10029580 | Ga0114129_100295805 | 333 |
| 520 | 3300010375 | Ga0105239_10052818 | Ga0105239_100528185 | 333 |
| 521 | 3300014326 | Ga0157380_10115373 | Ga0157380_101153732 | 333 |
| 522 | 3300025910 | Ga0207684_10001478 | Ga0207684_1000147811 | 333 |
| 523 | 3300025910 | Ga0207684_10072020 | Ga0207684_100720202 | 333 |
| 524 | 3300025910 | Ga0207684_10126347 | Ga0207684_101263472 | 333 |
| 525 | 3300025927 | Ga0207687_10000874 | Ga0207687_100008744 | 333 |
| 526 | 3300025927 | Ga0207687_10001356 | Ga0207687_100013561 | 333 |
| 527 | 3300025927 | Ga0207687_10057430 | Ga0207687_100574302 | 333 |
| 528 | 3300026023 | Ga0207677_10000035 | Ga0207677_1000003535 | 333 |
| 529 | 3300026035 | Ga0207703_10315273 | Ga0207703_103152731 | 333 |
| 530 | 3300026088 | Ga0207641_10146499 | Ga0207641_101464993 | 333 |
| 531 | 3300028380 | Ga0268265_10002608 | Ga0268265_1000260812 | 333 |
| 532 | 3300050507 | nmdc:mga05p37_17992_c1 | nmdc:mga05p37_17992_c1_3478_4491 | 333 |
| 533 | 3300050514 | nmdc:mga08x19_262210_c1 | nmdc:mga08x19_262210_c1_27_1040 | 333 |
| 534 | 3300050515 | nmdc:mga0a205_16901_c1 | nmdc:mga0a205_16901_c1_452_1465 | 333 |
| 535 | 3300060353 | Ga0501082_0341790 | Ga0501082_0341790_137_1138 | 333 |
| 536 | 3300005331 | Ga0070670_100022934 | Ga0070670_1000229342 | 334 |
| 537 | 3300005345 | Ga0070692_10000298 | Ga0070692_100002982 | 334 |
| 538 | 3300005468 | Ga0070707_100007456 | Ga0070707_10000745610 | 334 |
| 539 | 3300009098 | Ga0105245_10000004 | Ga0105245_1000000453 | 334 |
| 540 | 3300025922 | Ga0207646_10014779 | Ga0207646_100147794 | 334 |
| 541 | 3300025927 | Ga0207687_10000003 | Ga0207687_10000003270 | 334 |
| 542 | 3300025944 | Ga0207661_10311028 | Ga0207661_103110281 | 334 |
| 543 | 3300026116 | Ga0207674_10059045 | Ga0207674_100590455 | 334 |
| 544 | 3300042876 | Ga0451577_0223915 | Ga0451577_0223915_273_1277 | 334 |
| 545 | 3300044712 | Ga0453684_0054690 | Ga0453684_0054690_1471_2475 | 334 |
| 546 | 3300005327 | Ga0070658_10017136 | Ga0070658_100171364 | 335 |
| 547 | 3300005329 | Ga0070683_100000068 | Ga0070683_1000000686 | 335 |
| 548 | 3300005331 | Ga0070670_100005934 | Ga0070670_1000059342 | 335 |
| 549 | 3300005333 | Ga0070677_10029410 | Ga0070677_100294102 | 335 |
| 550 | 3300005336 | Ga0070680_100013589 | Ga0070680_1000135894 | 335 |
| 551 | 3300005337 | Ga0070682_100000014 | Ga0070682_10000001413 | 335 |
| 552 | 3300005338 | Ga0068868_100000163 | Ga0068868_10000016314 | 335 |
| 553 | 3300005340 | Ga0070689_100001747 | Ga0070689_1000017473 | 335 |
| 554 | 3300005438 | Ga0070701_10000943 | Ga0070701_100009439 | 335 |
| 555 | 3300005441 | Ga0070700_100000025 | Ga0070700_10000002518 | 335 |
| 556 | 3300005467 | Ga0070706_100001538 | Ga0070706_10000153827 | 335 |
| 557 | 3300005467 | Ga0070706_100022070 | Ga0070706_1000220703 | 335 |
| 558 | 3300005471 | Ga0070698_100050900 | Ga0070698_1000509003 | 335 |
| 559 | 3300005471 | Ga0070698_100074400 | Ga0070698_1000744002 | 335 |
| 560 | 3300005471 | Ga0070698_100090534 | Ga0070698_1000905342 | 335 |
| 561 | 3300005518 | Ga0070699_100015660 | Ga0070699_1000156602 | 335 |
| 562 | 3300005535 | Ga0070684_100001023 | Ga0070684_10000102312 | 335 |
| 563 | 3300005535 | Ga0070684_100348090 | Ga0070684_1003480902 | 335 |
| 564 | 3300005536 | Ga0070697_100036239 | Ga0070697_1000362392 | 335 |
| 565 | 3300005536 | Ga0070697_100179255 | Ga0070697_1001792551 | 335 |
| 566 | 3300005539 | Ga0068853_100188915 | Ga0068853_1001889151 | 335 |
| 567 | 3300005543 | Ga0070672_100000082 | Ga0070672_10000008235 | 335 |
| 568 | 3300005618 | Ga0068864_100000097 | Ga0068864_10000009727 | 335 |
| 569 | 3300005840 | Ga0068870_10006871 | Ga0068870_100068712 | 335 |
| 570 | 3300005842 | Ga0068858_100000535 | Ga0068858_10000053512 | 335 |
| 571 | 3300005843 | Ga0068860_100002216 | Ga0068860_1000022164 | 335 |
| 572 | 3300006173 | Ga0070716_100020244 | Ga0070716_1000202442 | 335 |
| 573 | 3300006881 | Ga0068865_100054895 | Ga0068865_1000548954 | 335 |
| 574 | 3300009176 | Ga0105242_10004999 | Ga0105242_100049996 | 335 |
| 575 | 3300009551 | Ga0105238_10000001 | Ga0105238_10000001538 | 335 |
| 576 | 3300011119 | Ga0105246_10203192 | Ga0105246_102031922 | 335 |
| 577 | 3300013105 | Ga0157369_10001042 | Ga0157369_1000104213 | 335 |
| 578 | 3300013296 | Ga0157374_10000012 | Ga0157374_10000012103 | 335 |
| 579 | 3300013297 | Ga0157378_10007767 | Ga0157378_100077675 | 335 |
| 580 | 3300013297 | Ga0157378_10018512 | Ga0157378_100185123 | 335 |
| 581 | 3300013297 | Ga0157378_10139357 | Ga0157378_101393571 | 335 |
| 582 | 3300013308 | Ga0157375_10000001 | Ga0157375_1000000133 | 335 |
| 583 | 3300013308 | Ga0157375_10000008 | Ga0157375_10000008194 | 335 |
| 584 | 3300013308 | Ga0157375_10007623 | Ga0157375_100076233 | 335 |
| 585 | 3300014326 | Ga0157380_10045368 | Ga0157380_100453684 | 335 |
| 586 | 3300014745 | Ga0157377_10000002 | Ga0157377_10000002337 | 335 |
| 587 | 3300014745 | Ga0157377_10000024 | Ga0157377_10000024149 | 335 |
| 588 | 3300014969 | Ga0157376_10000025 | Ga0157376_1000002523 | 335 |
| 589 | 3300021358 | Ga0213873_10000002 | Ga0213873_10000002833 | 335 |
| 590 | 3300021384 | Ga0213876_10000001 | Ga0213876_10000001916 | 335 |
| 591 | 3300021384 | Ga0213876_10000080 | Ga0213876_100000802 | 335 |
| 592 | 3300021384 | Ga0213876_10013522 | Ga0213876_100135224 | 335 |
| 593 | 3300021384 | Ga0213876_10179989 | Ga0213876_101799892 | 335 |
| 594 | 3300025893 | Ga0207682_10040379 | Ga0207682_100403792 | 335 |
| 595 | 3300025908 | Ga0207643_10003770 | Ga0207643_100037707 | 335 |
| 596 | 3300025909 | Ga0207705_10031207 | Ga0207705_100312072 | 335 |
| 597 | 3300025910 | Ga0207684_10069336 | Ga0207684_100693362 | 335 |
| 598 | 3300025910 | Ga0207684_10093552 | Ga0207684_100935523 | 335 |
| 599 | 3300025917 | Ga0207660_10009336 | Ga0207660_100093364 | 335 |
| 600 | 3300025924 | Ga0207694_10000001 | Ga0207694_100000011579 | 335 |
| 601 | 3300025925 | Ga0207650_10000262 | Ga0207650_100002622 | 335 |
| 602 | 3300025934 | Ga0207686_10052556 | Ga0207686_100525563 | 335 |
| 603 | 3300025936 | Ga0207670_10002583 | Ga0207670_100025837 | 335 |
| 604 | 3300025939 | Ga0207665_10033205 | Ga0207665_100332052 | 335 |
| 605 | 3300025940 | Ga0207691_10001623 | Ga0207691_100016233 | 335 |
| 606 | 3300025942 | Ga0207689_10017106 | Ga0207689_100171064 | 335 |
| 607 | 3300025944 | Ga0207661_10000001 | Ga0207661_10000001150 | 335 |
| 608 | 3300026023 | Ga0207677_10000249 | Ga0207677_100002496 | 335 |
| 609 | 3300026035 | Ga0207703_10000046 | Ga0207703_10000046114 | 335 |
| 610 | 3300026075 | Ga0207708_10000034 | Ga0207708_10000034125 | 335 |
| 611 | 3300026095 | Ga0207676_10000013 | Ga0207676_10000013250 | 335 |
| 612 | 3300028381 | Ga0268264_10002673 | Ga0268264_1000267315 | 335 |
| 613 | 3300030521 | Ga0307511_10020180 | Ga0307511_100201804 | 335 |
| 614 | 3300039437 | Ga0436365_0138728 | Ga0436365_0138728_21221_22228 | 335 |
| 615 | 3300039437 | Ga0436365_0404975 | Ga0436365_0404975_175288_176400 | 335 |
| 616 | 3300039437 | Ga0436365_0786638 | Ga0436365_0786638_2593_3606 | 335 |
| 617 | 3300039453 | Ga0436362_0660519 | Ga0436362_0660519_88625_89737 | 335 |
| 618 | 3300039453 | Ga0436362_1042072 | Ga0436362_1042072_8598_9605 | 335 |
| 619 | 3300053083 | Ga0495655_0000162 | Ga0495655_0000162_8528_9535 | 335 |
| 620 | 3300005295 | Ga0065707_10090239 | Ga0065707_100902392 | 336 |
| 621 | 3300006847 | Ga0075431_100057851 | Ga0075431_1000578512 | 336 |
| 622 | 3300007076 | Ga0075435_100203903 | Ga0075435_1002039032 | 336 |
| 623 | 3300009094 | Ga0111539_10000052 | Ga0111539_1000005288 | 336 |
| 624 | 3300027907 | Ga0207428_10000003 | Ga0207428_1000000388 | 336 |
| 625 | 3300042876 | Ga0451577_0001914 | Ga0451577_0001914_4403_5449 | 336 |
| 626 | 3300044712 | Ga0453684_0000481 | Ga0453684_0000481_147630_148676 | 336 |
| 627 | 3300046515 | Ga0495620_0000796 | Ga0495620_0000796_113_1123 | 336 |
| 628 | 3300050511 | nmdc:mga08y16_4_c1 | nmdc:mga08y16_4_c1_836107_837117 | 336 |
| 629 | 3300050513 | nmdc:mga0rr50_118222_c1 | nmdc:mga0rr50_118222_c1_774_1784 | 336 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2g36-assembly1.cif.gz_A-2 | crystal structure of tryptophanyl-trna synthetase (ec 6.1.1.2) (tryptophan-trna ligase)(trprs) (tm0492) from thermotoga maritima at 2.50 a resolution | 0.9579 | 6 | 331 |
| 2g36-assembly1.cif.gz_A-2 | crystal structure of tryptophanyl-trna synthetase (ec 6.1.1.2) (tryptophan-trna ligase)(trprs) (tm0492) from thermotoga maritima at 2.50 a resolution | 0.9521 | 6 | 331 |
| 6ncr-assembly3.cif.gz_A | crystal structure of tryptophan-trna ligase from chlamydia trachomatis with bound l-tryptophan | 0.9517 | 6 | 328 |
| 3tzl-assembly1.cif.gz_A | crystal structure of tryptophanyl-trna synthetase from campylobacter jejuni complexed with adp and tryptophane | 0.9421 | 6 | 328 |
| 3m5w-assembly1.cif.gz_A | crystal structure of tryptophanyl-trna synthetase from campylobacter jejuni | 0.9379 | 6 | 328 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1yiaC02 | Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase | 0.9567 | 192 | 297 | 1.10.240.10 |
| 1yi8C02 | Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase | 0.9513 | 203 | 297 | 1.10.240.10 |
| 2g36A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9507 | 6 | 331 | 3.40.50.620 |
| 5ekdB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.947 | 3 | 185 | 3.40.50.620 |
| 2g36A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.942 | 6 | 331 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534IQW5-F1-model_v4 | tryptophan--tRNA ligase (EC 6.1.1.2) | 0.9958 | 12 | 174 |
GO:0004830
GO:0005524 GO:0005829 GO:0006436 |
| AF-A0A7X9HV82-F1-model_v4 | tryptophan--tRNA ligase (EC 6.1.1.2) | 0.9916 | 12 | 149 |
GO:0004830
GO:0005524 GO:0006436 |
| AF-A0A3N5N3V4-F1-model_v4 | Tryptophan--tRNA ligase (EC 6.1.1.2) | 0.9913 | 3 | 174 |
GO:0004830
GO:0005524 GO:0005829 GO:0006436 |
| AF-A0A6L9KRB4-F1-model_v4 | Tryptophan--tRNA ligase (EC 6.1.1.2) | 0.9909 | 5 | 174 |
GO:0004830
GO:0005524 GO:0005829 GO:0006436 |
| AF-A0A7X7UA31-F1-model_v4 | deleted | 0.9894 | 6 | 329 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar