F470758

General Info

Members Datasets Scaffolds Average Seq Length
629 265 629 336

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0404975|Ga0436365_0404975_175288_176400
Length 370
Sequence MCNRGETGGHGDVDCTPRDNVATLRRPNLTRHESPLNSSSQIVLSGLRPTGRVHLGNYFGAVRNWVELQDRYRCYYFVADWHALTSDYADPSKVRQATFDAVADYLAAGMDPEKATVFLQSDVKEHAELHLLLSMVTPLPWLERVPTFKDQQAQLEDKDLNTYGFLGYPLLQTADIILYRAAYVPVGEDQASHLELSREIVRRFNNFYGPVFPEPQPLFTATPKVPGLDGRKMSKSYGNTIGLTASADEIRALVSTMFTDPNRVRRSDPGNPDICNLFQFHKLFSDDATIARVDHECRTAQIGCVQDKRLLADIIIEKLRPIRERREEIDRNPSIVWDTLREGGKRARERAGETMASVRDAMKIGFPELR

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
156 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
157 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
158 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
161 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
164 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
165 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
166 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
168 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
173 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
176 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
180 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
181 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
182 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
183 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
184 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
188 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
196 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
197 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
198 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
199 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
263 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
264 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
265 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.2
Rhizosphere 90.78
Stem 0
Stem Tuber 0
Unclassified 3.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10090239 3300005295 Bacteria 4183
2 Ga0070658_10017136 3300005327 Bacteria 5797
3 Ga0070683_100000068 3300005329 Bacteria 72997
4 Ga0070683_100133128 3300005329 Bacteria 2353
5 Ga0070683_100208857 3300005329 Bacteria 1854
6 Ga0070690_100000448 3300005330 Bacteria 20723
7 Ga0070690_100031417 3300005330 Bacteria 3308
8 Ga0070670_100004914 3300005331 Bacteria 11248
9 Ga0070670_100005934 3300005331 Bacteria 10329
10 Ga0070670_100022934 3300005331 Bacteria 5370
11 Ga0070670_100056618 3300005331 Bacteria 3364
12 Ga0070677_10013681 3300005333 Bacteria 2842
13 Ga0070677_10029410 3300005333 Bacteria 2083
14 Ga0068869_100026266 3300005334 Bacteria 4052
15 Ga0068869_100058975 3300005334 Bacteria 2809
16 Ga0070666_10000299 3300005335 Bacteria 32140
17 Ga0070666_10024193 3300005335 Bacteria 3955
18 Ga0070680_100013589 3300005336 Bacteria 6347
19 Ga0070682_100000014 3300005337 Bacteria 249552
20 Ga0070682_100038193 3300005337 Bacteria 2944
21 Ga0068868_100000163 3300005338 Bacteria 43476
22 Ga0068868_100001348 3300005338 Bacteria 16914
23 Ga0068868_100026790 3300005338 Bacteria 4395
24 Ga0068868_100148768 3300005338 Bacteria 1927
25 Ga0070689_100001747 3300005340 Bacteria 13909
26 Ga0070689_100003483 3300005340 Bacteria 10477
27 Ga0070689_100004063 3300005340 Bacteria 9849
28 Ga0070687_100000425 3300005343 Bacteria 14251
29 Ga0070661_100033374 3300005344 Bacteria 3727
30 Ga0070661_100092975 3300005344 Bacteria 2235
31 Ga0070692_10000298 3300005345 Bacteria 14077
32 Ga0070692_10000642 3300005345 Bacteria 11099
33 Ga0070692_10001369 3300005345 Bacteria 8801
34 Ga0070669_100217865 3300005353 Bacteria 1508
35 Ga0070675_100000005 3300005354 Bacteria 295918
36 Ga0070675_100051410 3300005354 Bacteria 3386
37 Ga0070674_100003957 3300005356 Bacteria 8392
38 Ga0070674_100038734 3300005356 Bacteria 3215
39 Ga0070673_100114186 3300005364 Bacteria 2244
40 Ga0070673_100180099 3300005364 Bacteria 1809
41 Ga0070688_100010351 3300005365 Bacteria 5139
42 Ga0070659_100001254 3300005366 Bacteria 18424
43 Ga0070667_100001154 3300005367 Bacteria 23979
44 Ga0070667_100070353 3300005367 Bacteria 2978
45 Ga0070713_100014092 3300005436 Bacteria 5922
46 Ga0070701_10000943 3300005438 Bacteria 10515
47 Ga0070701_10001392 3300005438 Bacteria 8943
48 Ga0070705_100059050 3300005440 Bacteria 2270
49 Ga0070700_100000025 3300005441 Bacteria 126198
50 Ga0070700_100001257 3300005441 Bacteria 12549
51 Ga0070700_100013777 3300005441 Bacteria 4549
52 Ga0070700_100186866 3300005441 Bacteria 1446
53 Ga0070694_100038190 3300005444 Bacteria 3189
54 Ga0070708_100005909 3300005445 Bacteria 9726
55 Ga0070708_100010262 3300005445 Bacteria 7583
56 Ga0070708_100066506 3300005445 Bacteria 3236
57 Ga0070708_100316701 3300005445 Bacteria 1470
58 Ga0070663_100004197 3300005455 Bacteria 8425
59 Ga0070663_100028054 3300005455 Bacteria 3828
60 Ga0070663_100144519 3300005455 Bacteria 1819
61 Ga0070678_100003548 3300005456 Bacteria 8705
62 Ga0070678_100006558 3300005456 Bacteria 6839
63 Ga0070662_100005463 3300005457 Bacteria 8121
64 Ga0068867_100008933 3300005459 Bacteria 7072
65 Ga0068867_100072211 3300005459 Bacteria 2583
66 Ga0070685_10006547 3300005466 Bacteria 5940
67 Ga0070706_100001433 3300005467 Bacteria 25205
68 Ga0070706_100001538 3300005467 Bacteria 24123
69 Ga0070706_100002585 3300005467 Bacteria 18178
70 Ga0070706_100007815 3300005467 Bacteria 9996
71 Ga0070706_100022070 3300005467 Bacteria 5862
72 Ga0070706_100030392 3300005467 Bacteria 4977
73 Ga0070706_100059347 3300005467 Bacteria 3530
74 Ga0070706_100086679 3300005467 Bacteria 2901
75 Ga0070706_100090360 3300005467 Bacteria 2840
76 Ga0070706_100458796 3300005467 Bacteria 1186
77 Ga0070707_100001134 3300005468 Bacteria 26206
78 Ga0070707_100007211 3300005468 Bacteria 10312
79 Ga0070707_100007456 3300005468 Bacteria 10157
80 Ga0070707_100062993 3300005468 Bacteria 3558
81 Ga0070707_100119229 3300005468 Bacteria 2561
82 Ga0070707_100197995 3300005468 Bacteria 1958
83 Ga0070707_100413795 3300005468 Unclassified 1308
84 Ga0070698_100016054 3300005471 Bacteria 7908
85 Ga0070698_100016763 3300005471 Bacteria 7728
86 Ga0070698_100039399 3300005471 Bacteria 4864
87 Ga0070698_100050900 3300005471 Bacteria 4220
88 Ga0070698_100057515 3300005471 Bacteria 3935
89 Ga0070698_100074400 3300005471 Bacteria 3402
90 Ga0070698_100090534 3300005471 Bacteria 3042
91 Ga0070699_100015660 3300005518 Bacteria 6512
92 Ga0070699_100022070 3300005518 Bacteria 5484
93 Ga0070699_100026256 3300005518 Bacteria 5023
94 Ga0070699_100140006 3300005518 Bacteria 2136
95 Ga0070699_100195372 3300005518 Bacteria 1798
96 Ga0070699_100228877 3300005518 Bacteria 1658
97 Ga0070699_100327908 3300005518 Bacteria 1376
98 Ga0070679_100199049 3300005530 Bacteria 1970
99 Ga0070684_100001023 3300005535 Bacteria 19936
100 Ga0070684_100175063 3300005535 Bacteria 1950
101 Ga0070684_100201832 3300005535 Bacteria 1811
102 Ga0070684_100348090 3300005535 Bacteria 1363
103 Ga0070697_100024031 3300005536 Bacteria 4851
104 Ga0070697_100036239 3300005536 Bacteria 3984
105 Ga0070697_100051652 3300005536 Bacteria 3340
106 Ga0070697_100054003 3300005536 Bacteria 3265
107 Ga0070697_100071706 3300005536 Bacteria 2842
108 Ga0070697_100179255 3300005536 Bacteria 1795
109 Ga0068853_100188915 3300005539 Bacteria 1871
110 Ga0070672_100000082 3300005543 Bacteria 44859
111 Ga0070672_100019300 3300005543 Bacteria 4946
112 Ga0070672_100047389 3300005543 Bacteria 3335
113 Ga0070672_100055526 3300005543 Bacteria 3103
114 Ga0070672_100119147 3300005543 Bacteria 2159
115 Ga0070686_100003654 3300005544 Bacteria 8442
116 Ga0070695_100009746 3300005545 Bacteria 5720
117 Ga0070695_100040534 3300005545 Bacteria 2948
118 Ga0070696_100003949 3300005546 Bacteria 9901
119 Ga0070696_100020827 3300005546 Bacteria 4443
120 Ga0070696_100028738 3300005546 Bacteria 3794
121 Ga0070696_100047684 3300005546 Bacteria 2973
122 Ga0070696_100049261 3300005546 Bacteria 2926
123 Ga0070696_100079598 3300005546 Bacteria 2319
124 Ga0070696_100184201 3300005546 Unclassified 1550
125 Ga0070696_100228594 3300005546 Bacteria 1399
126 Ga0070665_100053302 3300005548 Bacteria 4056
127 Ga0070665_100143722 3300005548 Bacteria 2389
128 Ga0070704_100010977 3300005549 Bacteria 5526
129 Ga0070704_100015344 3300005549 Bacteria 4812
130 Ga0070704_100024581 3300005549 Bacteria 3954
131 Ga0070664_100005721 3300005564 Bacteria 10018
132 Ga0070664_100009451 3300005564 Bacteria 7902
133 Ga0068857_100086612 3300005577 Bacteria 2801
134 Ga0068856_100069978 3300005614 Bacteria 3470
135 Ga0070702_100010436 3300005615 Bacteria 4575
136 Ga0070702_100128546 3300005615 Unclassified 1597
137 Ga0068859_100000001 3300005617 Bacteria 545224
138 Ga0068859_100001014 3300005617 Bacteria 28729
139 Ga0068859_100487613 3300005617 Bacteria 1328
140 Ga0068864_100000097 3300005618 Bacteria 85717
141 Ga0068864_100019276 3300005618 Bacteria 5702
142 Ga0068861_100062860 3300005719 Bacteria 2853
143 Ga0068861_100132034 3300005719 Bacteria 2028
144 Ga0068851_10091084 3300005834 Bacteria 1605
145 Ga0068870_10003769 3300005840 Bacteria 6448
146 Ga0068870_10006871 3300005840 Bacteria 5048
147 Ga0068870_10010632 3300005840 Bacteria 4235
148 Ga0068863_100012687 3300005841 Bacteria 8126
149 Ga0068863_100056184 3300005841 Bacteria 3727
150 Ga0068863_100060932 3300005841 Bacteria 3568
151 Ga0068863_100075901 3300005841 Bacteria 3180
152 Ga0068863_100368861 3300005841 Bacteria 1401
153 Ga0068858_100000535 3300005842 Bacteria 39601
154 Ga0068858_100000656 3300005842 Bacteria 36151
155 Ga0068858_100043317 3300005842 Bacteria 4174
156 Ga0068860_100001089 3300005843 Bacteria 29937
157 Ga0068860_100002216 3300005843 Bacteria 20448
158 Ga0068860_100025010 3300005843 Bacteria 5764
159 Ga0068860_100031385 3300005843 Bacteria 5107
160 Ga0068860_100049267 3300005843 Bacteria 4013
161 Ga0068862_100000687 3300005844 Bacteria 34543
162 Ga0081455_10060748 3300005937 Bacteria 3184
163 Ga0081539_10014649 3300005985 Bacteria 5774
164 Ga0070717_10000216 3300006028 Bacteria 40022
165 Ga0070717_10217899 3300006028 Bacteria 1677
166 Ga0070716_100020244 3300006173 Bacteria 3491
167 Ga0097621_100025982 3300006237 Bacteria 4588
168 Ga0097621_100058461 3300006237 Bacteria 3154
169 Ga0068871_100032995 3300006358 Bacteria 4095
170 Ga0068871_100037481 3300006358 Bacteria 3867
171 Ga0068871_100123545 3300006358 Bacteria 2189
172 Ga0075428_100000305 3300006844 Bacteria 48274
173 Ga0075428_100068217 3300006844 Bacteria 3891
174 Ga0075431_100057851 3300006847 Bacteria 3999
175 Ga0075433_10000923 3300006852 Bacteria 20691
176 Ga0075433_10054854 3300006852 Bacteria 3477
177 Ga0075434_100000559 3300006871 Bacteria 28566
178 Ga0075434_100164026 3300006871 Bacteria 2242
179 Ga0068865_100020445 3300006881 Bacteria 4292
180 Ga0068865_100054895 3300006881 Bacteria 2771
181 Ga0068865_100056372 3300006881 Bacteria 2737
182 Ga0097620_100000001 3300006931 Bacteria 545224
183 Ga0097620_100001014 3300006931 Bacteria 28729
184 Ga0097620_100487612 3300006931 Bacteria 1328
185 Ga0075435_100001424 3300007076 Bacteria 15421
186 Ga0075435_100001706 3300007076 Bacteria 14260
187 Ga0075435_100203903 3300007076 Bacteria 1676
188 Ga0105240_10023431 3300009093 Bacteria 8162
189 Ga0105240_10084935 3300009093 Bacteria 3880
190 Ga0111539_10000052 3300009094 Bacteria 116307
191 Ga0105245_10000004 3300009098 Bacteria 470684
192 Ga0105245_10003029 3300009098 Bacteria 15071
193 Ga0105245_10009835 3300009098 Bacteria 8333
194 Ga0105245_10040895 3300009098 Bacteria 4131
195 Ga0105245_10270836 3300009098 Bacteria 1656
196 Ga0105245_10429944 3300009098 Bacteria 1325
197 Ga0105247_10084965 3300009101 Bacteria 2000
198 Ga0114129_10013672 3300009147 Bacteria 11566
199 Ga0114129_10020258 3300009147 Bacteria 9465
200 Ga0114129_10023250 3300009147 Bacteria 8792
201 Ga0114129_10029580 3300009147 Bacteria 7757
202 Ga0114129_10105876 3300009147 Bacteria 3886
203 Ga0114129_10456577 3300009147 Bacteria 1675
204 Ga0105243_10010790 3300009148 Bacteria 6915
205 Ga0105243_10161137 3300009148 Bacteria 1934
206 Ga0105242_10004999 3300009176 Bacteria 10254
207 Ga0105248_10003323 3300009177 Bacteria 17856
208 Ga0105248_10036494 3300009177 Bacteria 5498
209 Ga0105248_10062791 3300009177 Bacteria 4171
210 Ga0105237_10137917 3300009545 Bacteria 2433
211 Ga0105238_10000001 3300009551 Bacteria 2036163
212 Ga0105249_10001464 3300009553 Bacteria 20697
213 Ga0105249_10003565 3300009553 Bacteria 13470
214 Ga0105239_10006639 3300010375 Bacteria 13389
215 Ga0105239_10042465 3300010375 Bacteria 4983
216 Ga0105239_10052818 3300010375 Bacteria 4457
217 Ga0105239_10118468 3300010375 Bacteria 2938
218 Ga0105246_10120563 3300011119 Bacteria 1943
219 Ga0105246_10203192 3300011119 Bacteria 1542
220 Ga0157369_10001042 3300013105 Bacteria 35030
221 Ga0157374_10000012 3300013296 Bacteria 462353
222 Ga0157374_10074412 3300013296 Bacteria 3207
223 Ga0157374_10158718 3300013296 Bacteria 2202
224 Ga0157378_10007473 3300013297 Bacteria 9545
225 Ga0157378_10007767 3300013297 Bacteria 9364
226 Ga0157378_10018512 3300013297 Bacteria 6121
227 Ga0157378_10109694 3300013297 Bacteria 2528
228 Ga0157378_10139357 3300013297 Bacteria 2251
229 Ga0163162_10022779 3300013306 Bacteria 6175
230 Ga0163162_10104939 3300013306 Bacteria 2920
231 Ga0163162_10230828 3300013306 Unclassified 1981
232 Ga0163162_10296533 3300013306 Bacteria 1749
233 Ga0163162_10572919 3300013306 Bacteria 1256
234 Ga0157375_10000001 3300013308 Bacteria 696576
235 Ga0157375_10000008 3300013308 Bacteria 373560
236 Ga0157375_10000201 3300013308 Bacteria 55923
237 Ga0157375_10007623 3300013308 Bacteria 9466
238 Ga0157375_10009868 3300013308 Bacteria 8397
239 Ga0163163_10007890 3300014325 Bacteria 9410
240 Ga0163163_10013898 3300014325 Bacteria 7384
241 Ga0163163_10049408 3300014325 Bacteria 4139
242 Ga0163163_10097183 3300014325 Bacteria 2965
243 Ga0163163_10281206 3300014325 Unclassified 1715
244 Ga0163163_10381291 3300014325 Bacteria 1467
245 Ga0157380_10010378 3300014326 Bacteria 6699
246 Ga0157380_10045368 3300014326 Bacteria 3449
247 Ga0157380_10056357 3300014326 Bacteria 3125
248 Ga0157380_10115373 3300014326 Bacteria 2265
249 Ga0157380_10115861 3300014326 Bacteria 2260
250 Ga0157380_10458216 3300014326 Bacteria 1227
251 Ga0182008_10102961 3300014497 Bacteria 1412
252 Ga0157377_10000002 3300014745 Bacteria 473827
253 Ga0157377_10000024 3300014745 Bacteria 142391
254 Ga0157379_10058393 3300014968 Bacteria 3449
255 Ga0157379_10240933 3300014968 Bacteria 1640
256 Ga0157376_10000025 3300014969 Bacteria 214212
257 Ga0157376_10021530 3300014969 Bacteria 5009
258 Ga0157376_10108873 3300014969 Bacteria 2435
259 Ga0163161_10092835 3300017792 Bacteria 2235
260 Ga0163161_10230297 3300017792 Bacteria 1438
261 Ga0213873_10000002 3300021358 Bacteria 1164195
262 Ga0213876_10000001 3300021384 Bacteria 1186326
263 Ga0213876_10000080 3300021384 Bacteria 109125
264 Ga0213876_10013522 3300021384 Bacteria 4332
265 Ga0213876_10179989 3300021384 Bacteria 1124
266 Ga0207682_10002222 3300025893 Bacteria 8758
267 Ga0207682_10040379 3300025893 Bacteria 1901
268 Ga0207642_10117392 3300025899 Bacteria 1366
269 Ga0207680_10000719 3300025903 Bacteria 15539
270 Ga0207645_10152435 3300025907 Bacteria 1509
271 Ga0207643_10002858 3300025908 Bacteria 9322
272 Ga0207643_10003770 3300025908 Bacteria 8146
273 Ga0207643_10007413 3300025908 Bacteria 5885
274 Ga0207705_10031207 3300025909 Bacteria 3802
275 Ga0207684_10000354 3300025910 Bacteria 62819
276 Ga0207684_10001478 3300025910 Bacteria 25294
277 Ga0207684_10006428 3300025910 Bacteria 10711
278 Ga0207684_10035728 3300025910 Bacteria 4219
279 Ga0207684_10064756 3300025910 Bacteria 3103
280 Ga0207684_10069336 3300025910 Bacteria 2997
281 Ga0207684_10072020 3300025910 Bacteria 2936
282 Ga0207684_10093552 3300025910 Bacteria 2563
283 Ga0207684_10126347 3300025910 Bacteria 2194
284 Ga0207684_10127555 3300025910 Bacteria 2184
285 Ga0207684_10150767 3300025910 Bacteria 2000
286 Ga0207684_10293599 3300025910 Bacteria 1402
287 Ga0207707_10010264 3300025912 Bacteria 8127
288 Ga0207660_10000002 3300025917 Bacteria 883566
289 Ga0207660_10009336 3300025917 Bacteria 6347
290 Ga0207662_10000761 3300025918 Bacteria 14779
291 Ga0207662_10002117 3300025918 Bacteria 9866
292 Ga0207662_10010636 3300025918 Bacteria 5087
293 Ga0207652_10256545 3300025921 Unclassified 1577
294 Ga0207646_10000242 3300025922 Bacteria 74986
295 Ga0207646_10014779 3300025922 Bacteria 7396
296 Ga0207646_10029056 3300025922 Bacteria 5026
297 Ga0207646_10062181 3300025922 Bacteria 3333
298 Ga0207646_10249496 3300025922 Bacteria 1603
299 Ga0207646_10265255 3300025922 Bacteria 1552
300 Ga0207681_10050786 3300025923 Bacteria 2807
301 Ga0207694_10000001 3300025924 Bacteria 4078485
302 Ga0207650_10000262 3300025925 Bacteria 56131
303 Ga0207650_10006075 3300025925 Bacteria 8238
304 Ga0207650_10156871 3300025925 Bacteria 1800
305 Ga0207659_10000067 3300025926 Bacteria 66315
306 Ga0207659_10003166 3300025926 Bacteria 9840
307 Ga0207659_10091745 3300025926 Bacteria 2270
308 Ga0207659_10234322 3300025926 Bacteria 1482
309 Ga0207687_10000003 3300025927 Bacteria 875159
310 Ga0207687_10000874 3300025927 Bacteria 20395
311 Ga0207687_10001356 3300025927 Bacteria 16754
312 Ga0207687_10026795 3300025927 Bacteria 3862
313 Ga0207687_10057430 3300025927 Bacteria 2734
314 Ga0207687_10060532 3300025927 Bacteria 2671
315 Ga0207644_10139847 3300025931 Bacteria 1863
316 Ga0207690_10007375 3300025932 Bacteria 6528
317 Ga0207706_10005264 3300025933 Bacteria 12066
318 Ga0207706_10040135 3300025933 Bacteria 4148
319 Ga0207706_10096548 3300025933 Bacteria 2599
320 Ga0207706_10234844 3300025933 Bacteria 1603
321 Ga0207686_10052556 3300025934 Bacteria 2543
322 Ga0207709_10238262 3300025935 Unclassified 1322
323 Ga0207670_10002583 3300025936 Bacteria 9524
324 Ga0207670_10004911 3300025936 Bacteria 7273
325 Ga0207669_10013257 3300025937 Bacteria 4087
326 Ga0207665_10033205 3300025939 Bacteria 3419
327 Ga0207691_10001623 3300025940 Bacteria 22338
328 Ga0207691_10002139 3300025940 Bacteria 19338
329 Ga0207691_10031463 3300025940 Bacteria 4952
330 Ga0207691_10034695 3300025940 Bacteria 4690
331 Ga0207691_10064519 3300025940 Bacteria 3318
332 Ga0207711_10003854 3300025941 Bacteria 12908
333 Ga0207711_10052073 3300025941 Bacteria 3507
334 Ga0207689_10008031 3300025942 Bacteria 9209
335 Ga0207689_10017106 3300025942 Bacteria 6137
336 Ga0207689_10023505 3300025942 Bacteria 5172
337 Ga0207661_10000001 3300025944 Bacteria 937688
338 Ga0207661_10110717 3300025944 Bacteria 2322
339 Ga0207661_10203204 3300025944 Bacteria 1743
340 Ga0207661_10311028 3300025944 Bacteria 1414
341 Ga0207679_10021058 3300025945 Bacteria 4411
342 Ga0207679_10213625 3300025945 Bacteria 1619
343 Ga0207651_10016931 3300025960 Bacteria 4290
344 Ga0207712_10096479 3300025961 Bacteria 2188
345 Ga0207640_10048547 3300025981 Bacteria 2745
346 Ga0207640_10111554 3300025981 Bacteria 1940
347 Ga0207658_10003795 3300025986 Bacteria 10636
348 Ga0207677_10000035 3300026023 Bacteria 117469
349 Ga0207677_10000249 3300026023 Bacteria 41568
350 Ga0207677_10049379 3300026023 Bacteria 2839
351 Ga0207677_10123489 3300026023 Bacteria 1952
352 Ga0207703_10000046 3300026035 Bacteria 154474
353 Ga0207703_10001102 3300026035 Bacteria 25601
354 Ga0207703_10315273 3300026035 Bacteria 1430
355 Ga0207639_10000051 3300026041 Bacteria 113927
356 Ga0207678_10009561 3300026067 Bacteria 8527
357 Ga0207678_10017619 3300026067 Bacteria 6269
358 Ga0207708_10000034 3300026075 Bacteria 144931
359 Ga0207708_10001539 3300026075 Bacteria 17190
360 Ga0207702_10027375 3300026078 Bacteria 4734
361 Ga0207641_10013141 3300026088 Bacteria 6788
362 Ga0207641_10146499 3300026088 Bacteria 2135
363 Ga0207641_10319120 3300026088 Bacteria 1473
364 Ga0207648_10011285 3300026089 Bacteria 8425
365 Ga0207648_10182439 3300026089 Bacteria 1858
366 Ga0207648_10351439 3300026089 Bacteria 1329
367 Ga0207676_10000013 3300026095 Bacteria 343067
368 Ga0207676_10142424 3300026095 Bacteria 2054
369 Ga0207674_10059045 3300026116 Bacteria 3884
370 Ga0207675_100105611 3300026118 Bacteria 2655
371 Ga0207675_100111357 3300026118 Bacteria 2583
372 Ga0207675_100153728 3300026118 Bacteria 2192
373 Ga0207683_10001081 3300026121 Bacteria 24825
374 Ga0207683_10009630 3300026121 Bacteria 8234
375 Ga0209996_1002487 3300027395 Bacteria 2281
376 Ga0209970_1000831 3300027614 Bacteria 5408
377 Ga0209983_1001136 3300027665 Bacteria 5877
378 Ga0209974_10015913 3300027876 Bacteria 2497
379 Ga0209974_10022459 3300027876 Bacteria 2090
380 Ga0207428_10000003 3300027907 Bacteria 799783
381 Ga0207428_10060251 3300027907 Bacteria 3007
382 Ga0268266_10048281 3300028379 Bacteria 3648
383 Ga0268266_10412137 3300028379 Bacteria 1279
384 Ga0268265_10002608 3300028380 Bacteria 13414
385 Ga0268264_10001715 3300028381 Bacteria 20197
386 Ga0268264_10002673 3300028381 Bacteria 15564
387 Ga0268264_10395477 3300028381 Bacteria 1327
388 Ga0265337_1003707 3300028556 Bacteria 6534
389 Ga0265326_10004762 3300028558 Bacteria 4313
390 Ga0265319_1004203 3300028563 Bacteria 7201
391 Ga0265319_1013527 3300028563 Bacteria 3240
392 Ga0265334_10005117 3300028573 Bacteria 5744
393 Ga0265318_10011166 3300028577 Bacteria 3880
394 Ga0265323_10035789 3300028653 Unclassified 1829
395 Ga0265322_10005011 3300028654 Bacteria 3929
396 Ga0265322_10009152 3300028654 Bacteria 2878
397 Ga0265322_10023369 3300028654 Bacteria 1768
398 Ga0265338_10052337 3300028800 Bacteria 3664
399 Ga0265338_10059121 3300028800 Bacteria 3378
400 Ga0307511_10020180 3300030521 Bacteria 6320
401 Ga0265330_10012480 3300031235 Bacteria 3974
402 Ga0265330_10050088 3300031235 Bacteria 1832
403 Ga0265332_10102180 3300031238 Bacteria 1209
404 Ga0265320_10006971 3300031240 Bacteria 7049
405 Ga0265320_10010665 3300031240 Bacteria 5452
406 Ga0265325_10010933 3300031241 Bacteria 5228
407 Ga0265325_10039889 3300031241 Bacteria 2469
408 Ga0265329_10029070 3300031242 Bacteria 1809
409 Ga0265329_10031940 3300031242 Bacteria 1708
410 Ga0265339_10068558 3300031249 Bacteria 1895
411 Ga0265339_10078440 3300031249 Bacteria 1748
412 Ga0265331_10047581 3300031250 Bacteria 2064
413 Ga0265316_10024348 3300031344 Bacteria 5075
414 Ga0265316_10249588 3300031344 Bacteria 1303
415 Ga0316575_10005760 3300031665 Bacteria 4422
416 Ga0316575_10010773 3300031665 Bacteria 3368
417 Ga0316579_10013828 3300031691 Bacteria 3479
418 Ga0316579_10059664 3300031691 Bacteria 1793
419 Ga0265314_10008942 3300031711 Bacteria 8531
420 Ga0265314_10073004 3300031711 Unclassified 2289
421 Ga0316576_10010653 3300031727 Bacteria 5987
422 Ga0316576_10013703 3300031727 Bacteria 5399
423 Ga0316576_10039189 3300031727 Bacteria 3401
424 Ga0316578_10005092 3300031728 Bacteria 6325
425 Ga0307405_10102976 3300031731 Bacteria 1919
426 Ga0307415_100022053 3300032126 Bacteria 3925
427 Ga0307415_100091175 3300032126 Bacteria 2207
428 Ga0316583_10005222 3300032133 Bacteria 4655
429 Ga0316583_10005503 3300032133 Bacteria 4546
430 Ga0316583_10008129 3300032133 Bacteria 3781
431 Ga0316583_10073822 3300032133 Unclassified 1193
432 Ga0316585_10003454 3300032137 Bacteria 4341
433 Ga0316580_10012162 3300032139 Bacteria 2620
434 Ga0373950_0000016 3300034818 Bacteria 277879
435 Ga0373932_0000024 3300035112 Bacteria 45717
436 Ga0316574_0015320 3300035398 Bacteria 4446
437 Ga0316574_0035974 3300035398 Bacteria 3029
438 Ga0316574_0090258 3300035398 Unclassified 1953
439 Ga0316574_0131511 3300035398 Bacteria 1610
440 Ga0373947_0081969 3300035725 Bacteria 1999
441 Ga0373937_0397596 3300036401 Bacteria 1307
442 Ga0316582_0009004 3300036647 Bacteria 5394
443 Ga0316582_0010088 3300036647 Bacteria 5158
444 Ga0316582_0029245 3300036647 Bacteria 3346
445 Ga0316582_0035450 3300036647 Bacteria 3081
446 Ga0316582_0048907 3300036647 Unclassified 2675
447 Ga0316584_0080762 3300036712 Bacteria 2436
448 Ga0316584_0139367 3300036712 Bacteria 1810
449 Ga0316584_0178458 3300036712 Bacteria 1573
450 Ga0373925_0218113 3300037068 Bacteria 1522
451 Ga0395899_0039592 3300037312 Bacteria 3527
452 Ga0395900_0056534 3300037418 Bacteria 4038
453 Ga0395898_0071382 3300037466 Bacteria 3355
454 Ga0316581_0016940 3300037588 Bacteria 2098
455 Ga0316581_0021242 3300037588 Bacteria 1905
456 Ga0395901_0042863 3300038443 Bacteria 4693
457 Ga0400491_01175 3300038727 Bacteria 3499
458 Ga0400485_12823 3300038735 Bacteria 26460
459 Ga0400485_12905 3300038735 Bacteria 17083
460 Ga0400486_16900 3300038742 Bacteria 50943
461 Ga0400486_27903 3300038742 Bacteria 26140
462 Ga0400489_56403 3300039093 Bacteria 38528
463 Ga0400489_80261 3300039093 Bacteria 10535
464 Ga0400487_38723 3300039110 Bacteria 4178
465 Ga0400487_44648 3300039110 Bacteria 8074
466 Ga0436365_0138728 3300039437 Bacteria 44994
467 Ga0436365_0319611 3300039437 Bacteria 2764
468 Ga0436365_0404975 3300039437 Bacteria 180420
469 Ga0436365_0786638 3300039437 Bacteria 13785
470 Ga0436365_1530999 3300039437 Bacteria 2544
471 Ga0436362_0660519 3300039453 Bacteria 832172
472 Ga0436362_1042072 3300039453 Bacteria 9931
473 Ga0451577_0000018 3300042876 Bacteria 516495
474 Ga0451577_0001914 3300042876 Bacteria 26387
475 Ga0451577_0223915 3300042876 Bacteria 1700
476 Ga0453683_0020166 3300044673 Bacteria 4262
477 Ga0453684_0000166 3300044712 Bacteria 294291
478 Ga0453684_0000481 3300044712 Bacteria 158570
479 Ga0453684_0023645 3300044712 Bacteria 9032
480 Ga0453684_0037013 3300044712 Bacteria 6707
481 Ga0453684_0054690 3300044712 Bacteria 5197
482 Ga0466967_0050007 3300045976 Bacteria 3659
483 Ga0495629_0015900 3300046459 Bacteria 5406
484 Ga0495620_0000796 3300046515 Bacteria 19356
485 Ga0495640_0175120 3300046533 Bacteria 1370
486 Ga0495676_0160056 3300047321 Bacteria 1594
487 Ga0495680_0217410 3300047322 Bacteria 1366
488 Ga0495684_0086904 3300047471 Bacteria 2370
489 Ga0496100_0214806 3300048903 Bacteria 1409
490 Ga0496101_0002707 3300048904 Bacteria 10874
491 Ga0496101_0002712 3300048904 Bacteria 10864
492 Ga0496101_0167618 3300048904 Bacteria 1687
493 Ga0496102_0001300 3300048905 Bacteria 22454
494 Ga0496102_0022615 3300048905 Bacteria 5572
495 Ga0496102_0129288 3300048905 Bacteria 2363
496 Ga0496102_0238545 3300048905 Bacteria 1715
497 Ga0496102_0259029 3300048905 Unclassified 1640
498 Ga0496102_0357407 3300048905 Bacteria 1375
499 Ga0496104_0081501 3300048907 Bacteria 3086
500 Ga0496104_0142634 3300048907 Bacteria 2301
501 Ga0496104_0351071 3300048907 Bacteria 1388
502 Ga0496106_0000994 3300048909 Bacteria 20706
503 Ga0496106_0159315 3300048909 Bacteria 1784
504 Ga0496107_0001103 3300048910 Bacteria 16250
505 Ga0496108_0005830 3300048911 Bacteria 9986
506 Ga0496108_0013192 3300048911 Bacteria 6735
507 Ga0496108_0013250 3300048911 Bacteria 6719
508 Ga0496109_0012030 3300048912 Bacteria 7453
509 Ga0496109_0015410 3300048912 Bacteria 6661
510 Ga0496109_0021093 3300048912 Bacteria 5760
511 Ga0496109_0209138 3300048912 Bacteria 1835
512 Ga0496110_0008330 3300048913 Bacteria 8341
513 Ga0496110_0013989 3300048913 Bacteria 6649
514 Ga0496110_0046574 3300048913 Bacteria 3794
515 Ga0496110_0144756 3300048913 Bacteria 2149
516 Ga0496111_0007125 3300048914 Bacteria 7307
517 Ga0496111_0013535 3300048914 Bacteria 5556
518 Ga0496111_0031474 3300048914 Bacteria 3779
519 Ga0496111_0031774 3300048914 Bacteria 3762
520 Ga0496112_0000001 3300048915 Bacteria 1346031
521 Ga0496112_0123321 3300048915 Bacteria 2562
522 Ga0496113_0039907 3300048916 Bacteria 3457
523 Ga0496113_0114662 3300048916 Bacteria 2101
524 Ga0496113_0161139 3300048916 Bacteria 1773
525 Ga0496113_0161790 3300048916 Bacteria 1770
526 Ga0496114_0182505 3300048917 Bacteria 1833
527 Ga0496115_0133683 3300048918 Bacteria 2045
528 Ga0501031_0135315 3300049568 Bacteria 1610
529 Ga0501036_0080350 3300049572 Unclassified 2756
530 Ga0501036_0091353 3300049572 Bacteria 2572
531 Ga0501036_0290871 3300049572 Bacteria 1367
532 Ga0501040_0011760 3300049576 Bacteria 5726
533 Ga0501040_0056926 3300049576 Unclassified 2683
534 Ga0501040_0125183 3300049576 Bacteria 1805
535 Ga0501041_0034180 3300049577 Unclassified 3077
536 Ga0501041_0109957 3300049577 Bacteria 1710
537 Ga0501042_0088074 3300049578 Unclassified 2227
538 Ga0501042_0102098 3300049578 Bacteria 2063
539 Ga0501042_0130025 3300049578 Bacteria 1815
540 Ga0501042_0184328 3300049578 Bacteria 1506
541 Ga0501043_0099421 3300049579 Unclassified 2287
542 Ga0501046_0153379 3300049580 Unclassified 1737
543 Ga0501046_0259535 3300049580 Bacteria 1277
544 Ga0501048_0088831 3300049582 Bacteria 2180
545 Ga0501067_0010951 3300049583 Bacteria 5021
546 Ga0501067_0048720 3300049583 Bacteria 2349
547 Ga0501068_0015713 3300049584 Bacteria 4353
548 Ga0501069_0017652 3300049585 Bacteria 3845
549 Ga0501069_0044503 3300049585 Unclassified 2457
550 Ga0501070_0074587 3300049586 Bacteria 2808
551 Ga0501071_0016434 3300049587 Bacteria 5088
552 Ga0501071_0245409 3300049587 Bacteria 1351
553 Ga0501071_0301848 3300049587 Bacteria 1214
554 Ga0501072_0254331 3300049588 Bacteria 1399
555 Ga0501073_0000332 3300049589 Bacteria 31762
556 Ga0501073_0007235 3300049589 Bacteria 8264
557 Ga0501074_0023856 3300049590 Bacteria 4446
558 Ga0501075_0005186 3300049591 Bacteria 8911
559 Ga0501075_0012600 3300049591 Bacteria 6014
560 Ga0501075_0047794 3300049591 Bacteria 3215
561 Ga0501075_0103642 3300049591 Bacteria 2162
562 Ga0501075_0238754 3300049591 Bacteria 1385
563 Ga0501076_0059444 3300049592 Bacteria 3040
564 Ga0501076_0060791 3300049592 Bacteria 3006
565 Ga0501076_0100650 3300049592 Bacteria 2329
566 Ga0501076_0133880 3300049592 Bacteria 2011
567 Ga0501076_0196587 3300049592 Bacteria 1646
568 Ga0501077_0014692 3300049593 Bacteria 4920
569 Ga0501077_0015873 3300049593 Bacteria 4744
570 Ga0501079_0102757 3300049741 Bacteria 2216
571 Ga0501079_0154260 3300049741 Bacteria 1790
572 Ga0501079_0262383 3300049741 Bacteria 1350
573 Ga0501080_0009178 3300049742 Bacteria 9008
574 Ga0501080_0030371 3300049742 Bacteria 5034
575 Ga0501080_0067057 3300049742 Bacteria 3338
576 Ga0501080_0328344 3300049742 Bacteria 1384
577 Ga0501081_0074794 3300049743 Bacteria 2363
578 Ga0501081_0080164 3300049743 Bacteria 2284
579 Ga0501081_0276691 3300049743 Bacteria 1228
580 Ga0501083_0053471 3300049744 Bacteria 2711
581 Ga0501044_0397533 3300049823 Bacteria 1291
582 Ga0501045_0019377 3300049824 Bacteria 4849
583 Ga0501045_0057360 3300049824 Unclassified 2849
584 Ga0501045_0172971 3300049824 Bacteria 1609
585 Ga0501045_0178723 3300049824 Bacteria 1581
586 nmdc:mga05p37_138046_c1 3300050507 Bacteria 2988
587 nmdc:mga05p37_17992_c1 3300050507 Bacteria 8534
588 nmdc:mga05p37_1824_c1 3300050507 Bacteria 24835
589 nmdc:mga05p37_437763_c1 3300050507 Bacteria 1517
590 nmdc:mga05p37_569042_c1 3300050507 Bacteria 1286
591 nmdc:mga05p37_684009_c1 3300050507 Bacteria 1143
592 nmdc:mga05p37_744175_c1 3300050507 Bacteria 1082
593 nmdc:mga06r32_2010_c1 3300050510 Bacteria 15629
594 nmdc:mga08y16_199917_c1 3300050511 Bacteria 2071
595 nmdc:mga08y16_248110_c1 3300050511 Bacteria 1840
596 nmdc:mga08y16_4_c1 3300050511 Bacteria 916963
597 nmdc:mga0n895_1402_c1 3300050512 Bacteria 17974
598 nmdc:mga0n895_162198_c1 3300050512 Bacteria 2267
599 nmdc:mga0n895_162357_c1 3300050512 Bacteria 2266
600 nmdc:mga0n895_259536_c1 3300050512 Bacteria 1763
601 nmdc:mga0n895_453912_c1 3300050512 Bacteria 1294
602 nmdc:mga0rr50_118222_c1 3300050513 Bacteria 2106
603 nmdc:mga0rr50_368_c1 3300050513 Bacteria 24581
604 nmdc:mga0rr50_37_c1 3300050513 Bacteria 87211
605 nmdc:mga08x19_262210_c1 3300050514 Bacteria 1195
606 nmdc:mga08x19_5540_c1 3300050514 Bacteria 7464
607 nmdc:mga08x19_76552_c1 3300050514 Bacteria 2189
608 nmdc:mga08x19_81471_c1 3300050514 Bacteria 2125
609 nmdc:mga0a205_16901_c1 3300050515 Bacteria 6830
610 nmdc:mga0a205_226_c1 3300050515 Bacteria 31030
611 nmdc:mga0a205_385558_c1 3300050515 Bacteria 1266
612 nmdc:mga0a205_63668_c1 3300050515 Bacteria 3562
613 nmdc:mga0a205_87204_c1 3300050515 Bacteria 3015
614 nmdc:mga0a205_88607_c1 3300050515 Bacteria 2991
615 Ga0495601_0056655 3300053077 Bacteria 2482
616 Ga0495601_0128076 3300053077 Bacteria 1652
617 Ga0495655_0000162 3300053083 Bacteria 12713
618 Ga0495619_0021276 3300053085 Bacteria 4138
619 Ga0501084_0038173 3300054114 Bacteria 4015
620 Ga0501084_0065515 3300054114 Bacteria 3040
621 Ga0501084_0073668 3300054114 Unclassified 2859
622 Ga0590071_011322 3300059421 Bacteria 2087
623 Ga0590074_001032 3300059423 Bacteria 4379
624 Ga0501082_0052663 3300060353 Bacteria 3508
625 Ga0501082_0094724 3300060353 Bacteria 2580
626 Ga0501082_0114307 3300060353 Bacteria 2337
627 Ga0501082_0341790 3300060353 Bacteria 1304
628 Ga0530510_0003157 3300061734 Bacteria 11316
629 Ga0530510_0095172 3300061734 Bacteria 2175

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037588 Ga0316581_0016940 Ga0316581_0016940_44_886 279
2 3300049741 Ga0501079_0262383 Ga0501079_0262383_458_1336 291
3 3300049742 Ga0501080_0328344 Ga0501080_0328344_27_926 298
4 3300025918 Ga0207662_10010636 Ga0207662_100106367 306
5 3300013306 Ga0163162_10572919 Ga0163162_105729191 308
6 3300049589 Ga0501073_0007235 Ga0501073_0007235_5287_6219 310
7 3300049742 Ga0501080_0009178 Ga0501080_0009178_7511_8443 310
8 3300048905 Ga0496102_0357407 Ga0496102_0357407_353_1339 312
9 3300009093 Ga0105240_10023431 Ga0105240_100234317 313
10 3300014325 Ga0163163_10007890 Ga0163163_100078908 313
11 3300048905 Ga0496102_0238545 Ga0496102_0238545_173_1192 313
12 3300048912 Ga0496109_0021093 Ga0496109_0021093_2902_3921 313
13 3300048913 Ga0496110_0144756 Ga0496110_0144756_150_1169 313
14 3300048914 Ga0496111_0031474 Ga0496111_0031474_437_1456 313
15 3300047322 Ga0495680_0217410 Ga0495680_0217410_112_1137 314
16 3300053077 Ga0495601_0128076 Ga0495601_0128076_413_1438 314
17 3300050512 nmdc:mga0n895_453912_c1 nmdc:mga0n895_453912_c1_120_1268 315
18 3300050514 nmdc:mga08x19_81471_c1 nmdc:mga08x19_81471_c1_69_1217 315
19 3300034818 Ga0373950_0000016 Ga0373950_0000016_239375_240391 317
20 3300049589 Ga0501073_0000332 Ga0501073_0000332_27801_28817 317
21 3300005354 Ga0070675_100000005 Ga0070675_10000000546 318
22 3300006871 Ga0075434_100164026 Ga0075434_1001640263 318
23 3300025926 Ga0207659_10000067 Ga0207659_1000006719 318
24 3300031665 Ga0316575_10010773 Ga0316575_100107732 318
25 3300031691 Ga0316579_10059664 Ga0316579_100596642 318
26 3300031727 Ga0316576_10010653 Ga0316576_100106532 318
27 3300031728 Ga0316578_10005092 Ga0316578_100050922 318
28 3300032133 Ga0316583_10005222 Ga0316583_100052223 318
29 3300032139 Ga0316580_10012162 Ga0316580_100121622 318
30 3300050512 nmdc:mga0n895_162198_c1 nmdc:mga0n895_162198_c1_60_1016 318
31 3300005330 Ga0070690_100031417 Ga0070690_1000314175 319
32 3300005445 Ga0070708_100010262 Ga0070708_1000102624 319
33 3300035398 Ga0316574_0035974 Ga0316574_0035974_1810_2808 319
34 3300036647 Ga0316582_0009004 Ga0316582_0009004_2470_3468 319
35 3300050510 nmdc:mga06r32_2010_c1 nmdc:mga06r32_2010_c1_11905_12864 319
36 3300036647 Ga0316582_0029245 Ga0316582_0029245_2246_3211 320
37 3300005445 Ga0070708_100066506 Ga0070708_1000665062 321
38 3300005536 Ga0070697_100071706 Ga0070697_1000717062 321
39 3300005546 Ga0070696_100079598 Ga0070696_1000795982 321
40 3300005841 Ga0068863_100368861 Ga0068863_1003688612 321
41 3300009093 Ga0105240_10084935 Ga0105240_100849352 321
42 3300014325 Ga0163163_10049408 Ga0163163_100494081 321
43 3300025922 Ga0207646_10062181 Ga0207646_100621813 321
44 3300026088 Ga0207641_10319120 Ga0207641_103191202 321
45 3300031731 Ga0307405_10102976 Ga0307405_101029762 321
46 3300035398 Ga0316574_0131511 Ga0316574_0131511_381_1385 321
47 3300036647 Ga0316582_0035450 Ga0316582_0035450_2064_3068 321
48 3300049578 Ga0501042_0130025 Ga0501042_0130025_38_1009 321
49 3300005337 Ga0070682_100038193 Ga0070682_1000381933 322
50 3300009177 Ga0105248_10062791 Ga0105248_100627912 322
51 3300025981 Ga0207640_10048547 Ga0207640_100485472 322
52 3300032126 Ga0307415_100022053 Ga0307415_1000220532 322
53 3300035725 Ga0373947_0081969 Ga0373947_0081969_453_1490 322
54 3300042876 Ga0451577_0000018 Ga0451577_0000018_373375_374346 322
55 3300044712 Ga0453684_0000166 Ga0453684_0000166_142154_143125 322
56 3300046533 Ga0495640_0175120 Ga0495640_0175120_83_1120 322
57 3300048905 Ga0496102_0022615 Ga0496102_0022615_189_1208 322
58 3300048915 Ga0496112_0123321 Ga0496112_0123321_779_1798 322
59 3300049568 Ga0501031_0135315 Ga0501031_0135315_506_1525 322
60 3300049572 Ga0501036_0091353 Ga0501036_0091353_765_1784 322
61 3300049572 Ga0501036_0290871 Ga0501036_0290871_199_1218 322
62 3300049576 Ga0501040_0011760 Ga0501040_0011760_2912_3931 322
63 3300049576 Ga0501040_0125183 Ga0501040_0125183_666_1685 322
64 3300049577 Ga0501041_0109957 Ga0501041_0109957_463_1482 322
65 3300049578 Ga0501042_0102098 Ga0501042_0102098_874_1893 322
66 3300049580 Ga0501046_0259535 Ga0501046_0259535_143_1162 322
67 3300049582 Ga0501048_0088831 Ga0501048_0088831_1095_2114 322
68 3300049591 Ga0501075_0005186 Ga0501075_0005186_4534_5553 322
69 3300049591 Ga0501075_0012600 Ga0501075_0012600_4425_5444 322
70 3300049591 Ga0501075_0103642 Ga0501075_0103642_353_1372 322
71 3300049591 Ga0501075_0238754 Ga0501075_0238754_198_1217 322
72 3300049592 Ga0501076_0060791 Ga0501076_0060791_534_1553 322
73 3300049592 Ga0501076_0133880 Ga0501076_0133880_966_1985 322
74 3300049592 Ga0501076_0196587 Ga0501076_0196587_39_1058 322
75 3300049593 Ga0501077_0015873 Ga0501077_0015873_1799_2818 322
76 3300049741 Ga0501079_0102757 Ga0501079_0102757_132_1151 322
77 3300049741 Ga0501079_0154260 Ga0501079_0154260_748_1767 322
78 3300049743 Ga0501081_0074794 Ga0501081_0074794_110_1129 322
79 3300049743 Ga0501081_0276691 Ga0501081_0276691_20_1039 322
80 3300049824 Ga0501045_0019377 Ga0501045_0019377_3456_4475 322
81 3300049824 Ga0501045_0172971 Ga0501045_0172971_169_1188 322
82 3300049824 Ga0501045_0178723 Ga0501045_0178723_325_1344 322
83 3300050507 nmdc:mga05p37_437763_c1 nmdc:mga05p37_437763_c1_41_1060 322
84 3300054114 Ga0501084_0038173 Ga0501084_0038173_971_1990 322
85 3300054114 Ga0501084_0065515 Ga0501084_0065515_1009_2028 322
86 3300060353 Ga0501082_0094724 Ga0501082_0094724_108_1127 322
87 3300061734 Ga0530510_0003157 Ga0530510_0003157_7891_8910 322
88 3300005467 Ga0070706_100458796 Ga0070706_1004587961 323
89 3300005535 Ga0070684_100175063 Ga0070684_1001750632 323
90 3300005546 Ga0070696_100003949 Ga0070696_1000039498 323
91 3300005546 Ga0070696_100184201 Ga0070696_1001842011 323
92 3300005840 Ga0068870_10010632 Ga0068870_100106323 323
93 3300005843 Ga0068860_100031385 Ga0068860_1000313854 323
94 3300006881 Ga0068865_100020445 Ga0068865_1000204452 323
95 3300025899 Ga0207642_10117392 Ga0207642_101173922 323
96 3300025908 Ga0207643_10007413 Ga0207643_100074134 323
97 3300025910 Ga0207684_10293599 Ga0207684_102935991 323
98 3300025918 Ga0207662_10000761 Ga0207662_100007615 323
99 3300025925 Ga0207650_10006075 Ga0207650_100060756 323
100 3300025926 Ga0207659_10003166 Ga0207659_100031665 323
101 3300025927 Ga0207687_10026795 Ga0207687_100267952 323
102 3300025932 Ga0207690_10007375 Ga0207690_100073753 323
103 3300025933 Ga0207706_10005264 Ga0207706_100052647 323
104 3300025936 Ga0207670_10004911 Ga0207670_100049112 323
105 3300025944 Ga0207661_10203204 Ga0207661_102032042 323
106 3300025960 Ga0207651_10016931 Ga0207651_100169312 323
107 3300026067 Ga0207678_10017619 Ga0207678_100176194 323
108 3300026075 Ga0207708_10001539 Ga0207708_1000153911 323
109 3300026089 Ga0207648_10011285 Ga0207648_100112858 323
110 3300026118 Ga0207675_100105611 Ga0207675_1001056112 323
111 3300032126 Ga0307415_100091175 Ga0307415_1000911752 323
112 3300035112 Ga0373932_0000024 Ga0373932_0000024_14040_15041 323
113 3300036401 Ga0373937_0397596 Ga0373937_0397596_287_1270 323
114 3300039093 Ga0400489_56403 Ga0400489_56403_36737_37720 323
115 3300044673 Ga0453683_0020166 Ga0453683_0020166_155_1129 323
116 3300048915 Ga0496112_0000001 Ga0496112_0000001_236564_237547 323
117 3300005467 Ga0070706_100059347 Ga0070706_1000593472 324
118 3300005471 Ga0070698_100057515 Ga0070698_1000575153 324
119 3300005518 Ga0070699_100026256 Ga0070699_1000262563 324
120 3300025910 Ga0207684_10035728 Ga0207684_100357282 324
121 3300045976 Ga0466967_0050007 Ga0466967_0050007_1653_2636 324
122 3300005329 Ga0070683_100133128 Ga0070683_1001331282 325
123 3300005329 Ga0070683_100208857 Ga0070683_1002088572 325
124 3300005331 Ga0070670_100004914 Ga0070670_1000049146 325
125 3300005334 Ga0068869_100026266 Ga0068869_1000262662 325
126 3300005338 Ga0068868_100148768 Ga0068868_1001487682 325
127 3300005340 Ga0070689_100004063 Ga0070689_10000406312 325
128 3300005343 Ga0070687_100000425 Ga0070687_10000042513 325
129 3300005344 Ga0070661_100033374 Ga0070661_1000333744 325
130 3300005345 Ga0070692_10000642 Ga0070692_1000064210 325
131 3300005354 Ga0070675_100051410 Ga0070675_1000514103 325
132 3300005356 Ga0070674_100003957 Ga0070674_1000039575 325
133 3300005356 Ga0070674_100038734 Ga0070674_1000387343 325
134 3300005364 Ga0070673_100180099 Ga0070673_1001800992 325
135 3300005365 Ga0070688_100010351 Ga0070688_1000103513 325
136 3300005366 Ga0070659_100001254 Ga0070659_1000012544 325
137 3300005438 Ga0070701_10001392 Ga0070701_100013923 325
138 3300005440 Ga0070705_100059050 Ga0070705_1000590502 325
139 3300005441 Ga0070700_100001257 Ga0070700_1000012576 325
140 3300005441 Ga0070700_100186866 Ga0070700_1001868662 325
141 3300005455 Ga0070663_100028054 Ga0070663_1000280542 325
142 3300005456 Ga0070678_100003548 Ga0070678_1000035483 325
143 3300005457 Ga0070662_100005463 Ga0070662_1000054637 325
144 3300005466 Ga0070685_10006547 Ga0070685_100065473 325
145 3300005467 Ga0070706_100030392 Ga0070706_1000303925 325
146 3300005467 Ga0070706_100086679 Ga0070706_1000866792 325
147 3300005467 Ga0070706_100090360 Ga0070706_1000903603 325
148 3300005468 Ga0070707_100001134 Ga0070707_10000113425 325
149 3300005468 Ga0070707_100062993 Ga0070707_1000629931 325
150 3300005468 Ga0070707_100197995 Ga0070707_1001979951 325
151 3300005468 Ga0070707_100413795 Ga0070707_1004137951 325
152 3300005471 Ga0070698_100016054 Ga0070698_1000160543 325
153 3300005471 Ga0070698_100039399 Ga0070698_1000393993 325
154 3300005518 Ga0070699_100022070 Ga0070699_1000220702 325
155 3300005518 Ga0070699_100140006 Ga0070699_1001400062 325
156 3300005518 Ga0070699_100195372 Ga0070699_1001953722 325
157 3300005530 Ga0070679_100199049 Ga0070679_1001990492 325
158 3300005535 Ga0070684_100201832 Ga0070684_1002018322 325
159 3300005536 Ga0070697_100051652 Ga0070697_1000516522 325
160 3300005536 Ga0070697_100054003 Ga0070697_1000540032 325
161 3300005543 Ga0070672_100047389 Ga0070672_1000473892 325
162 3300005544 Ga0070686_100003654 Ga0070686_1000036542 325
163 3300005545 Ga0070695_100040534 Ga0070695_1000405342 325
164 3300005546 Ga0070696_100028738 Ga0070696_1000287383 325
165 3300005546 Ga0070696_100049261 Ga0070696_1000492613 325
166 3300005546 Ga0070696_100228594 Ga0070696_1002285941 325
167 3300005549 Ga0070704_100010977 Ga0070704_1000109774 325
168 3300005564 Ga0070664_100009451 Ga0070664_1000094516 325
169 3300005577 Ga0068857_100086612 Ga0068857_1000866122 325
170 3300005615 Ga0070702_100010436 Ga0070702_1000104365 325
171 3300005615 Ga0070702_100128546 Ga0070702_1001285461 325
172 3300005719 Ga0068861_100132034 Ga0068861_1001320342 325
173 3300005834 Ga0068851_10091084 Ga0068851_100910842 325
174 3300005842 Ga0068858_100043317 Ga0068858_1000433173 325
175 3300005937 Ga0081455_10060748 Ga0081455_100607482 325
176 3300005985 Ga0081539_10014649 Ga0081539_100146495 325
177 3300006844 Ga0075428_100000305 Ga0075428_10000030534 325
178 3300006852 Ga0075433_10054854 Ga0075433_100548543 325
179 3300009098 Ga0105245_10009835 Ga0105245_100098358 325
180 3300009098 Ga0105245_10040895 Ga0105245_100408953 325
181 3300009098 Ga0105245_10429944 Ga0105245_104299441 325
182 3300009147 Ga0114129_10020258 Ga0114129_100202582 325
183 3300009147 Ga0114129_10023250 Ga0114129_100232508 325
184 3300009147 Ga0114129_10105876 Ga0114129_101058763 325
185 3300009148 Ga0105243_10010790 Ga0105243_100107903 325
186 3300009148 Ga0105243_10161137 Ga0105243_101611371 325
187 3300009545 Ga0105237_10137917 Ga0105237_101379172 325
188 3300009553 Ga0105249_10003565 Ga0105249_1000356510 325
189 3300010375 Ga0105239_10006639 Ga0105239_100066399 325
190 3300010375 Ga0105239_10042465 Ga0105239_100424654 325
191 3300010375 Ga0105239_10118468 Ga0105239_101184682 325
192 3300011119 Ga0105246_10120563 Ga0105246_101205632 325
193 3300013297 Ga0157378_10007473 Ga0157378_100074734 325
194 3300013306 Ga0163162_10230828 Ga0163162_102308282 325
195 3300013306 Ga0163162_10296533 Ga0163162_102965332 325
196 3300013308 Ga0157375_10009868 Ga0157375_100098683 325
197 3300014325 Ga0163163_10097183 Ga0163163_100971832 325
198 3300014325 Ga0163163_10281206 Ga0163163_102812062 325
199 3300014325 Ga0163163_10381291 Ga0163163_103812912 325
200 3300014326 Ga0157380_10010378 Ga0157380_100103784 325
201 3300014326 Ga0157380_10458216 Ga0157380_104582162 325
202 3300014497 Ga0182008_10102961 Ga0182008_101029612 325
203 3300014968 Ga0157379_10058393 Ga0157379_100583932 325
204 3300014968 Ga0157379_10240933 Ga0157379_102409332 325
205 3300017792 Ga0163161_10092835 Ga0163161_100928352 325
206 3300025910 Ga0207684_10006428 Ga0207684_100064288 325
207 3300025910 Ga0207684_10064756 Ga0207684_100647563 325
208 3300025910 Ga0207684_10150767 Ga0207684_101507672 325
209 3300025912 Ga0207707_10010264 Ga0207707_100102649 325
210 3300025917 Ga0207660_10000002 Ga0207660_10000002687 325
211 3300025918 Ga0207662_10002117 Ga0207662_100021175 325
212 3300025921 Ga0207652_10256545 Ga0207652_102565452 325
213 3300025922 Ga0207646_10000242 Ga0207646_1000024223 325
214 3300025922 Ga0207646_10249496 Ga0207646_102494962 325
215 3300025922 Ga0207646_10265255 Ga0207646_102652552 325
216 3300025927 Ga0207687_10060532 Ga0207687_100605322 325
217 3300025933 Ga0207706_10234844 Ga0207706_102348441 325
218 3300025935 Ga0207709_10238262 Ga0207709_102382621 325
219 3300025940 Ga0207691_10064519 Ga0207691_100645193 325
220 3300025944 Ga0207661_10110717 Ga0207661_101107172 325
221 3300025945 Ga0207679_10213625 Ga0207679_102136252 325
222 3300025961 Ga0207712_10096479 Ga0207712_100964791 325
223 3300025981 Ga0207640_10111554 Ga0207640_101115542 325
224 3300026023 Ga0207677_10049379 Ga0207677_100493792 325
225 3300026023 Ga0207677_10123489 Ga0207677_101234892 325
226 3300026118 Ga0207675_100111357 Ga0207675_1001113572 325
227 3300026121 Ga0207683_10009630 Ga0207683_100096304 325
228 3300027876 Ga0209974_10015913 Ga0209974_100159132 325
229 3300027907 Ga0207428_10060251 Ga0207428_100602512 325
230 3300028556 Ga0265337_1003707 Ga0265337_10037072 325
231 3300028558 Ga0265326_10004762 Ga0265326_100047623 325
232 3300028563 Ga0265319_1004203 Ga0265319_10042034 325
233 3300028563 Ga0265319_1013527 Ga0265319_10135271 325
234 3300028573 Ga0265334_10005117 Ga0265334_100051173 325
235 3300028577 Ga0265318_10011166 Ga0265318_100111662 325
236 3300028653 Ga0265323_10035789 Ga0265323_100357892 325
237 3300028654 Ga0265322_10005011 Ga0265322_100050113 325
238 3300028654 Ga0265322_10009152 Ga0265322_100091522 325
239 3300028800 Ga0265338_10052337 Ga0265338_100523373 325
240 3300031235 Ga0265330_10012480 Ga0265330_100124801 325
241 3300031235 Ga0265330_10050088 Ga0265330_100500882 325
242 3300031240 Ga0265320_10006971 Ga0265320_100069712 325
243 3300031241 Ga0265325_10039889 Ga0265325_100398892 325
244 3300031242 Ga0265329_10029070 Ga0265329_100290702 325
245 3300031249 Ga0265339_10068558 Ga0265339_100685582 325
246 3300031344 Ga0265316_10024348 Ga0265316_100243485 325
247 3300031711 Ga0265314_10073004 Ga0265314_100730042 325
248 3300031727 Ga0316576_10013703 Ga0316576_100137034 325
249 3300032133 Ga0316583_10008129 Ga0316583_100081292 325
250 3300037588 Ga0316581_0021242 Ga0316581_0021242_598_1632 325
251 3300047321 Ga0495676_0160056 Ga0495676_0160056_320_1357 325
252 3300048903 Ga0496100_0214806 Ga0496100_0214806_181_1206 325
253 3300048904 Ga0496101_0002712 Ga0496101_0002712_2632_3657 325
254 3300048904 Ga0496101_0167618 Ga0496101_0167618_334_1353 325
255 3300048905 Ga0496102_0129288 Ga0496102_0129288_1135_2154 325
256 3300048905 Ga0496102_0259029 Ga0496102_0259029_487_1467 325
257 3300048907 Ga0496104_0142634 Ga0496104_0142634_1189_2214 325
258 3300048907 Ga0496104_0351071 Ga0496104_0351071_59_1078 325
259 3300048909 Ga0496106_0159315 Ga0496106_0159315_478_1497 325
260 3300048911 Ga0496108_0005830 Ga0496108_0005830_2404_3423 325
261 3300048911 Ga0496108_0013192 Ga0496108_0013192_5260_6285 325
262 3300048911 Ga0496108_0013250 Ga0496108_0013250_628_1653 325
263 3300048912 Ga0496109_0012030 Ga0496109_0012030_2035_3060 325
264 3300048912 Ga0496109_0015410 Ga0496109_0015410_3238_4257 325
265 3300048912 Ga0496109_0209138 Ga0496109_0209138_51_1070 325
266 3300048913 Ga0496110_0008330 Ga0496110_0008330_6978_8003 325
267 3300048913 Ga0496110_0013989 Ga0496110_0013989_3178_4197 325
268 3300048914 Ga0496111_0013535 Ga0496111_0013535_1024_2043 325
269 3300048914 Ga0496111_0031774 Ga0496111_0031774_2048_3073 325
270 3300048916 Ga0496113_0039907 Ga0496113_0039907_93_1118 325
271 3300048916 Ga0496113_0161139 Ga0496113_0161139_442_1461 325
272 3300048916 Ga0496113_0161790 Ga0496113_0161790_104_1123 325
273 3300048917 Ga0496114_0182505 Ga0496114_0182505_402_1421 325
274 3300049572 Ga0501036_0080350 Ga0501036_0080350_1464_2483 325
275 3300049576 Ga0501040_0056926 Ga0501040_0056926_315_1334 325
276 3300049577 Ga0501041_0034180 Ga0501041_0034180_525_1544 325
277 3300049578 Ga0501042_0088074 Ga0501042_0088074_288_1307 325
278 3300049579 Ga0501043_0099421 Ga0501043_0099421_768_1787 325
279 3300049580 Ga0501046_0153379 Ga0501046_0153379_185_1204 325
280 3300049583 Ga0501067_0010951 Ga0501067_0010951_2803_3822 325
281 3300049583 Ga0501067_0048720 Ga0501067_0048720_1009_2034 325
282 3300049584 Ga0501068_0015713 Ga0501068_0015713_1176_2195 325
283 3300049585 Ga0501069_0017652 Ga0501069_0017652_1324_2349 325
284 3300049585 Ga0501069_0044503 Ga0501069_0044503_267_1286 325
285 3300049586 Ga0501070_0074587 Ga0501070_0074587_614_1633 325
286 3300049587 Ga0501071_0016434 Ga0501071_0016434_633_1652 325
287 3300049587 Ga0501071_0245409 Ga0501071_0245409_321_1337 325
288 3300049587 Ga0501071_0301848 Ga0501071_0301848_99_1118 325
289 3300049588 Ga0501072_0254331 Ga0501072_0254331_336_1355 325
290 3300049590 Ga0501074_0023856 Ga0501074_0023856_1596_2615 325
291 3300049591 Ga0501075_0047794 Ga0501075_0047794_1967_2986 325
292 3300049592 Ga0501076_0059444 Ga0501076_0059444_1350_2369 325
293 3300049592 Ga0501076_0100650 Ga0501076_0100650_248_1264 325
294 3300049593 Ga0501077_0014692 Ga0501077_0014692_3161_4180 325
295 3300049742 Ga0501080_0030371 Ga0501080_0030371_1223_2242 325
296 3300049742 Ga0501080_0067057 Ga0501080_0067057_1832_2851 325
297 3300049743 Ga0501081_0080164 Ga0501081_0080164_647_1666 325
298 3300049744 Ga0501083_0053471 Ga0501083_0053471_696_1715 325
299 3300049823 Ga0501044_0397533 Ga0501044_0397533_212_1231 325
300 3300049824 Ga0501045_0057360 Ga0501045_0057360_1641_2660 325
301 3300050507 nmdc:mga05p37_138046_c1 nmdc:mga05p37_138046_c1_875_1894 325
302 3300050507 nmdc:mga05p37_1824_c1 nmdc:mga05p37_1824_c1_18754_19770 325
303 3300050507 nmdc:mga05p37_744175_c1 nmdc:mga05p37_744175_c1_23_1042 325
304 3300050511 nmdc:mga08y16_199917_c1 nmdc:mga08y16_199917_c1_884_1903 325
305 3300050511 nmdc:mga08y16_248110_c1 nmdc:mga08y16_248110_c1_206_1225 325
306 3300050512 nmdc:mga0n895_162357_c1 nmdc:mga0n895_162357_c1_471_1490 325
307 3300050512 nmdc:mga0n895_259536_c1 nmdc:mga0n895_259536_c1_673_1653 325
308 3300050514 nmdc:mga08x19_76552_c1 nmdc:mga08x19_76552_c1_687_1706 325
309 3300050515 nmdc:mga0a205_385558_c1 nmdc:mga0a205_385558_c1_16_1032 325
310 3300050515 nmdc:mga0a205_63668_c1 nmdc:mga0a205_63668_c1_1172_2191 325
311 3300050515 nmdc:mga0a205_87204_c1 nmdc:mga0a205_87204_c1_687_1706 325
312 3300050515 nmdc:mga0a205_88607_c1 nmdc:mga0a205_88607_c1_1787_2803 325
313 3300054114 Ga0501084_0073668 Ga0501084_0073668_211_1230 325
314 3300059421 Ga0590071_011322 Ga0590071_011322_812_1798 325
315 3300059423 Ga0590074_001032 Ga0590074_001032_1514_2500 325
316 3300060353 Ga0501082_0114307 Ga0501082_0114307_1089_2108 325
317 3300061734 Ga0530510_0095172 Ga0530510_0095172_495_1514 325
318 3300005467 Ga0070706_100001433 Ga0070706_1000014338 326
319 3300006358 Ga0068871_100123545 Ga0068871_1001235453 326
320 3300013296 Ga0157374_10074412 Ga0157374_100744124 326
321 3300025910 Ga0207684_10000354 Ga0207684_1000035421 326
322 3300025937 Ga0207669_10013257 Ga0207669_100132574 326
323 3300026121 Ga0207683_10001081 Ga0207683_1000108118 326
324 3300028800 Ga0265338_10059121 Ga0265338_100591213 326
325 3300036647 Ga0316582_0048907 Ga0316582_0048907_869_1849 326
326 3300036712 Ga0316584_0178458 Ga0316584_0178458_381_1445 326
327 3300037312 Ga0395899_0039592 Ga0395899_0039592_726_1715 326
328 3300037418 Ga0395900_0056534 Ga0395900_0056534_865_1854 326
329 3300037466 Ga0395898_0071382 Ga0395898_0071382_2094_3083 326
330 3300038443 Ga0395901_0042863 Ga0395901_0042863_811_1800 326
331 3300039437 Ga0436365_0319611 Ga0436365_0319611_1431_2420 326
332 3300039437 Ga0436365_1530999 Ga0436365_1530999_420_1409 326
333 3300044712 Ga0453684_0023645 Ga0453684_0023645_2509_3498 326
334 3300028654 Ga0265322_10023369 Ga0265322_100233692 327
335 3300031238 Ga0265332_10102180 Ga0265332_101021801 327
336 3300031240 Ga0265320_10010665 Ga0265320_100106652 327
337 3300031241 Ga0265325_10010933 Ga0265325_100109332 327
338 3300031249 Ga0265339_10078440 Ga0265339_100784402 327
339 3300031250 Ga0265331_10047581 Ga0265331_100475812 327
340 3300031665 Ga0316575_10005760 Ga0316575_100057602 327
341 3300031711 Ga0265314_10008942 Ga0265314_100089422 327
342 3300032133 Ga0316583_10005503 Ga0316583_100055036 327
343 3300032137 Ga0316585_10003454 Ga0316585_100034542 327
344 3300035398 Ga0316574_0015320 Ga0316574_0015320_1987_2970 327
345 3300036647 Ga0316582_0010088 Ga0316582_0010088_658_1641 327
346 3300005436 Ga0070713_100014092 Ga0070713_1000140924 328
347 3300005549 Ga0070704_100024581 Ga0070704_1000245814 328
348 3300005617 Ga0068859_100000001 Ga0068859_100000001357 328
349 3300006028 Ga0070717_10000216 Ga0070717_100002164 328
350 3300006028 Ga0070717_10217899 Ga0070717_102178992 328
351 3300006931 Ga0097620_100000001 Ga0097620_100000001357 328
352 3300007076 Ga0075435_100001706 Ga0075435_1000017064 328
353 3300009147 Ga0114129_10456577 Ga0114129_104565772 328
354 3300036712 Ga0316584_0139367 Ga0316584_0139367_515_1501 328
355 3300050507 nmdc:mga05p37_569042_c1 nmdc:mga05p37_569042_c1_245_1234 328
356 3300050513 nmdc:mga0rr50_37_c1 nmdc:mga0rr50_37_c1_46066_47052 328
357 3300050514 nmdc:mga08x19_5540_c1 nmdc:mga08x19_5540_c1_4732_5718 328
358 3300005331 Ga0070670_100056618 Ga0070670_1000566183 329
359 3300005335 Ga0070666_10024193 Ga0070666_100241934 329
360 3300005338 Ga0068868_100026790 Ga0068868_1000267904 329
361 3300005364 Ga0070673_100114186 Ga0070673_1001141862 329
362 3300005367 Ga0070667_100070353 Ga0070667_1000703533 329
363 3300005456 Ga0070678_100006558 Ga0070678_1000065585 329
364 3300005543 Ga0070672_100119147 Ga0070672_1001191473 329
365 3300005548 Ga0070665_100053302 Ga0070665_1000533023 329
366 3300005841 Ga0068863_100012687 Ga0068863_1000126872 329
367 3300006237 Ga0097621_100058461 Ga0097621_1000584613 329
368 3300006358 Ga0068871_100037481 Ga0068871_1000374813 329
369 3300006844 Ga0075428_100068217 Ga0075428_1000682174 329
370 3300009177 Ga0105248_10036494 Ga0105248_100364943 329
371 3300013296 Ga0157374_10158718 Ga0157374_101587182 329
372 3300014325 Ga0163163_10013898 Ga0163163_100138984 329
373 3300014969 Ga0157376_10021530 Ga0157376_100215302 329
374 3300025910 Ga0207684_10127555 Ga0207684_101275552 329
375 3300025926 Ga0207659_10091745 Ga0207659_100917452 329
376 3300025931 Ga0207644_10139847 Ga0207644_101398472 329
377 3300025933 Ga0207706_10096548 Ga0207706_100965482 329
378 3300025941 Ga0207711_10052073 Ga0207711_100520734 329
379 3300026041 Ga0207639_10000051 Ga0207639_1000005150 329
380 3300026118 Ga0207675_100153728 Ga0207675_1001537282 329
381 3300028379 Ga0268266_10048281 Ga0268266_100482813 329
382 3300031691 Ga0316579_10013828 Ga0316579_100138282 329
383 3300031727 Ga0316576_10039189 Ga0316576_100391893 329
384 3300032133 Ga0316583_10073822 Ga0316583_100738221 329
385 3300035398 Ga0316574_0090258 Ga0316574_0090258_667_1701 329
386 3300036712 Ga0316584_0080762 Ga0316584_0080762_198_1187 329
387 3300037068 Ga0373925_0218113 Ga0373925_0218113_189_1184 329
388 3300038727 Ga0400491_01175 Ga0400491_01175_884_1873 329
389 3300038735 Ga0400485_12823 Ga0400485_12823_2986_3975 329
390 3300038735 Ga0400485_12905 Ga0400485_12905_2979_3968 329
391 3300038742 Ga0400486_16900 Ga0400486_16900_45039_46028 329
392 3300038742 Ga0400486_27903 Ga0400486_27903_17412_18401 329
393 3300039093 Ga0400489_80261 Ga0400489_80261_403_1392 329
394 3300039110 Ga0400487_44648 Ga0400487_44648_4050_5039 329
395 3300049578 Ga0501042_0184328 Ga0501042_0184328_418_1407 329
396 3300005330 Ga0070690_100000448 Ga0070690_10000044817 330
397 3300005333 Ga0070677_10013681 Ga0070677_100136813 330
398 3300005335 Ga0070666_10000299 Ga0070666_100002993 330
399 3300005340 Ga0070689_100003483 Ga0070689_1000034835 330
400 3300005344 Ga0070661_100092975 Ga0070661_1000929752 330
401 3300005353 Ga0070669_100217865 Ga0070669_1002178652 330
402 3300005367 Ga0070667_100001154 Ga0070667_10000115412 330
403 3300005441 Ga0070700_100013777 Ga0070700_1000137775 330
404 3300005445 Ga0070708_100316701 Ga0070708_1003167011 330
405 3300005455 Ga0070663_100004197 Ga0070663_1000041976 330
406 3300005459 Ga0068867_100008933 Ga0068867_1000089333 330
407 3300005468 Ga0070707_100007211 Ga0070707_10000721110 330
408 3300005543 Ga0070672_100019300 Ga0070672_1000193006 330
409 3300005546 Ga0070696_100047684 Ga0070696_1000476843 330
410 3300005548 Ga0070665_100143722 Ga0070665_1001437222 330
411 3300005549 Ga0070704_100015344 Ga0070704_1000153442 330
412 3300005564 Ga0070664_100005721 Ga0070664_10000572111 330
413 3300005614 Ga0068856_100069978 Ga0068856_1000699783 330
414 3300005617 Ga0068859_100001014 Ga0068859_10000101418 330
415 3300005617 Ga0068859_100487613 Ga0068859_1004876132 330
416 3300005618 Ga0068864_100019276 Ga0068864_1000192766 330
417 3300005719 Ga0068861_100062860 Ga0068861_1000628604 330
418 3300005840 Ga0068870_10003769 Ga0068870_100037696 330
419 3300005841 Ga0068863_100060932 Ga0068863_1000609324 330
420 3300005841 Ga0068863_100075901 Ga0068863_1000759012 330
421 3300005842 Ga0068858_100000656 Ga0068858_1000006565 330
422 3300005843 Ga0068860_100001089 Ga0068860_10000108914 330
423 3300005843 Ga0068860_100049267 Ga0068860_1000492674 330
424 3300006237 Ga0097621_100025982 Ga0097621_1000259822 330
425 3300006881 Ga0068865_100056372 Ga0068865_1000563722 330
426 3300006931 Ga0097620_100001014 Ga0097620_10000101414 330
427 3300006931 Ga0097620_100487612 Ga0097620_1004876122 330
428 3300009101 Ga0105247_10084965 Ga0105247_100849653 330
429 3300009177 Ga0105248_10003323 Ga0105248_1000332314 330
430 3300013306 Ga0163162_10104939 Ga0163162_101049393 330
431 3300013308 Ga0157375_10000201 Ga0157375_1000020129 330
432 3300014326 Ga0157380_10056357 Ga0157380_100563572 330
433 3300014969 Ga0157376_10108873 Ga0157376_101088732 330
434 3300017792 Ga0163161_10230297 Ga0163161_102302972 330
435 3300025893 Ga0207682_10002222 Ga0207682_100022225 330
436 3300025903 Ga0207680_10000719 Ga0207680_1000071914 330
437 3300025907 Ga0207645_10152435 Ga0207645_101524352 330
438 3300025908 Ga0207643_10002858 Ga0207643_100028586 330
439 3300025922 Ga0207646_10029056 Ga0207646_100290564 330
440 3300025925 Ga0207650_10156871 Ga0207650_101568712 330
441 3300025926 Ga0207659_10234322 Ga0207659_102343222 330
442 3300025933 Ga0207706_10040135 Ga0207706_100401352 330
443 3300025940 Ga0207691_10002139 Ga0207691_100021393 330
444 3300025940 Ga0207691_10031463 Ga0207691_100314632 330
445 3300025941 Ga0207711_10003854 Ga0207711_1000385410 330
446 3300025942 Ga0207689_10008031 Ga0207689_100080316 330
447 3300025945 Ga0207679_10021058 Ga0207679_100210583 330
448 3300025986 Ga0207658_10003795 Ga0207658_1000379510 330
449 3300026035 Ga0207703_10001102 Ga0207703_1000110211 330
450 3300026067 Ga0207678_10009561 Ga0207678_100095615 330
451 3300026078 Ga0207702_10027375 Ga0207702_100273753 330
452 3300026088 Ga0207641_10013141 Ga0207641_100131414 330
453 3300026095 Ga0207676_10142424 Ga0207676_101424242 330
454 3300028379 Ga0268266_10412137 Ga0268266_104121371 330
455 3300028381 Ga0268264_10001715 Ga0268264_1000171520 330
456 3300028381 Ga0268264_10395477 Ga0268264_103954772 330
457 3300031242 Ga0265329_10031940 Ga0265329_100319402 330
458 3300031344 Ga0265316_10249588 Ga0265316_102495882 330
459 3300039110 Ga0400487_38723 Ga0400487_38723_1216_2217 330
460 3300044712 Ga0453684_0037013 Ga0453684_0037013_5141_6136 330
461 3300048904 Ga0496101_0002707 Ga0496101_0002707_6661_7662 330
462 3300048905 Ga0496102_0001300 Ga0496102_0001300_11491_12492 330
463 3300048907 Ga0496104_0081501 Ga0496104_0081501_325_1326 330
464 3300048909 Ga0496106_0000994 Ga0496106_0000994_13242_14243 330
465 3300048910 Ga0496107_0001103 Ga0496107_0001103_8954_9955 330
466 3300048913 Ga0496110_0046574 Ga0496110_0046574_919_1920 330
467 3300048914 Ga0496111_0007125 Ga0496111_0007125_4420_5421 330
468 3300048916 Ga0496113_0114662 Ga0496113_0114662_816_1817 330
469 3300048918 Ga0496115_0133683 Ga0496115_0133683_631_1632 330
470 3300005334 Ga0068869_100058975 Ga0068869_1000589753 331
471 3300005345 Ga0070692_10001369 Ga0070692_100013696 331
472 3300005444 Ga0070694_100038190 Ga0070694_1000381902 331
473 3300005455 Ga0070663_100144519 Ga0070663_1001445192 331
474 3300005518 Ga0070699_100228877 Ga0070699_1002288771 331
475 3300005543 Ga0070672_100055526 Ga0070672_1000555262 331
476 3300005545 Ga0070695_100009746 Ga0070695_1000097466 331
477 3300005546 Ga0070696_100020827 Ga0070696_1000208274 331
478 3300005843 Ga0068860_100025010 Ga0068860_1000250105 331
479 3300006852 Ga0075433_10000923 Ga0075433_100009233 331
480 3300006871 Ga0075434_100000559 Ga0075434_10000055920 331
481 3300007076 Ga0075435_100001424 Ga0075435_1000014245 331
482 3300009147 Ga0114129_10013672 Ga0114129_100136725 331
483 3300009553 Ga0105249_10001464 Ga0105249_1000146416 331
484 3300013297 Ga0157378_10109694 Ga0157378_101096942 331
485 3300013306 Ga0163162_10022779 Ga0163162_100227794 331
486 3300014326 Ga0157380_10115861 Ga0157380_101158612 331
487 3300025923 Ga0207681_10050786 Ga0207681_100507862 331
488 3300025940 Ga0207691_10034695 Ga0207691_100346954 331
489 3300025942 Ga0207689_10023505 Ga0207689_100235055 331
490 3300026089 Ga0207648_10351439 Ga0207648_103514392 331
491 3300027395 Ga0209996_1002487 Ga0209996_10024873 331
492 3300027614 Ga0209970_1000831 Ga0209970_10008315 331
493 3300027665 Ga0209983_1001136 Ga0209983_10011365 331
494 3300027876 Ga0209974_10022459 Ga0209974_100224593 331
495 3300046459 Ga0495629_0015900 Ga0495629_0015900_2073_3077 331
496 3300047471 Ga0495684_0086904 Ga0495684_0086904_30_1034 331
497 3300050507 nmdc:mga05p37_684009_c1 nmdc:mga05p37_684009_c1_14_1018 331
498 3300050512 nmdc:mga0n895_1402_c1 nmdc:mga0n895_1402_c1_16696_17703 331
499 3300050513 nmdc:mga0rr50_368_c1 nmdc:mga0rr50_368_c1_12395_13402 331
500 3300050515 nmdc:mga0a205_226_c1 nmdc:mga0a205_226_c1_27669_28676 331
501 3300053077 Ga0495601_0056655 Ga0495601_0056655_1215_2219 331
502 3300053085 Ga0495619_0021276 Ga0495619_0021276_121_1125 331
503 3300060353 Ga0501082_0052663 Ga0501082_0052663_1462_2466 331
504 3300005459 Ga0068867_100072211 Ga0068867_1000722113 332
505 3300026089 Ga0207648_10182439 Ga0207648_101824391 332
506 3300005338 Ga0068868_100001348 Ga0068868_10000134813 333
507 3300005445 Ga0070708_100005909 Ga0070708_1000059093 333
508 3300005467 Ga0070706_100002585 Ga0070706_10000258510 333
509 3300005467 Ga0070706_100007815 Ga0070706_1000078154 333
510 3300005468 Ga0070707_100119229 Ga0070707_1001192293 333
511 3300005471 Ga0070698_100016763 Ga0070698_1000167635 333
512 3300005518 Ga0070699_100327908 Ga0070699_1003279082 333
513 3300005536 Ga0070697_100024031 Ga0070697_1000240311 333
514 3300005841 Ga0068863_100056184 Ga0068863_1000561844 333
515 3300005844 Ga0068862_100000687 Ga0068862_10000068728 333
516 3300006358 Ga0068871_100032995 Ga0068871_1000329953 333
517 3300009098 Ga0105245_10003029 Ga0105245_1000302913 333
518 3300009098 Ga0105245_10270836 Ga0105245_102708362 333
519 3300009147 Ga0114129_10029580 Ga0114129_100295805 333
520 3300010375 Ga0105239_10052818 Ga0105239_100528185 333
521 3300014326 Ga0157380_10115373 Ga0157380_101153732 333
522 3300025910 Ga0207684_10001478 Ga0207684_1000147811 333
523 3300025910 Ga0207684_10072020 Ga0207684_100720202 333
524 3300025910 Ga0207684_10126347 Ga0207684_101263472 333
525 3300025927 Ga0207687_10000874 Ga0207687_100008744 333
526 3300025927 Ga0207687_10001356 Ga0207687_100013561 333
527 3300025927 Ga0207687_10057430 Ga0207687_100574302 333
528 3300026023 Ga0207677_10000035 Ga0207677_1000003535 333
529 3300026035 Ga0207703_10315273 Ga0207703_103152731 333
530 3300026088 Ga0207641_10146499 Ga0207641_101464993 333
531 3300028380 Ga0268265_10002608 Ga0268265_1000260812 333
532 3300050507 nmdc:mga05p37_17992_c1 nmdc:mga05p37_17992_c1_3478_4491 333
533 3300050514 nmdc:mga08x19_262210_c1 nmdc:mga08x19_262210_c1_27_1040 333
534 3300050515 nmdc:mga0a205_16901_c1 nmdc:mga0a205_16901_c1_452_1465 333
535 3300060353 Ga0501082_0341790 Ga0501082_0341790_137_1138 333
536 3300005331 Ga0070670_100022934 Ga0070670_1000229342 334
537 3300005345 Ga0070692_10000298 Ga0070692_100002982 334
538 3300005468 Ga0070707_100007456 Ga0070707_10000745610 334
539 3300009098 Ga0105245_10000004 Ga0105245_1000000453 334
540 3300025922 Ga0207646_10014779 Ga0207646_100147794 334
541 3300025927 Ga0207687_10000003 Ga0207687_10000003270 334
542 3300025944 Ga0207661_10311028 Ga0207661_103110281 334
543 3300026116 Ga0207674_10059045 Ga0207674_100590455 334
544 3300042876 Ga0451577_0223915 Ga0451577_0223915_273_1277 334
545 3300044712 Ga0453684_0054690 Ga0453684_0054690_1471_2475 334
546 3300005327 Ga0070658_10017136 Ga0070658_100171364 335
547 3300005329 Ga0070683_100000068 Ga0070683_1000000686 335
548 3300005331 Ga0070670_100005934 Ga0070670_1000059342 335
549 3300005333 Ga0070677_10029410 Ga0070677_100294102 335
550 3300005336 Ga0070680_100013589 Ga0070680_1000135894 335
551 3300005337 Ga0070682_100000014 Ga0070682_10000001413 335
552 3300005338 Ga0068868_100000163 Ga0068868_10000016314 335
553 3300005340 Ga0070689_100001747 Ga0070689_1000017473 335
554 3300005438 Ga0070701_10000943 Ga0070701_100009439 335
555 3300005441 Ga0070700_100000025 Ga0070700_10000002518 335
556 3300005467 Ga0070706_100001538 Ga0070706_10000153827 335
557 3300005467 Ga0070706_100022070 Ga0070706_1000220703 335
558 3300005471 Ga0070698_100050900 Ga0070698_1000509003 335
559 3300005471 Ga0070698_100074400 Ga0070698_1000744002 335
560 3300005471 Ga0070698_100090534 Ga0070698_1000905342 335
561 3300005518 Ga0070699_100015660 Ga0070699_1000156602 335
562 3300005535 Ga0070684_100001023 Ga0070684_10000102312 335
563 3300005535 Ga0070684_100348090 Ga0070684_1003480902 335
564 3300005536 Ga0070697_100036239 Ga0070697_1000362392 335
565 3300005536 Ga0070697_100179255 Ga0070697_1001792551 335
566 3300005539 Ga0068853_100188915 Ga0068853_1001889151 335
567 3300005543 Ga0070672_100000082 Ga0070672_10000008235 335
568 3300005618 Ga0068864_100000097 Ga0068864_10000009727 335
569 3300005840 Ga0068870_10006871 Ga0068870_100068712 335
570 3300005842 Ga0068858_100000535 Ga0068858_10000053512 335
571 3300005843 Ga0068860_100002216 Ga0068860_1000022164 335
572 3300006173 Ga0070716_100020244 Ga0070716_1000202442 335
573 3300006881 Ga0068865_100054895 Ga0068865_1000548954 335
574 3300009176 Ga0105242_10004999 Ga0105242_100049996 335
575 3300009551 Ga0105238_10000001 Ga0105238_10000001538 335
576 3300011119 Ga0105246_10203192 Ga0105246_102031922 335
577 3300013105 Ga0157369_10001042 Ga0157369_1000104213 335
578 3300013296 Ga0157374_10000012 Ga0157374_10000012103 335
579 3300013297 Ga0157378_10007767 Ga0157378_100077675 335
580 3300013297 Ga0157378_10018512 Ga0157378_100185123 335
581 3300013297 Ga0157378_10139357 Ga0157378_101393571 335
582 3300013308 Ga0157375_10000001 Ga0157375_1000000133 335
583 3300013308 Ga0157375_10000008 Ga0157375_10000008194 335
584 3300013308 Ga0157375_10007623 Ga0157375_100076233 335
585 3300014326 Ga0157380_10045368 Ga0157380_100453684 335
586 3300014745 Ga0157377_10000002 Ga0157377_10000002337 335
587 3300014745 Ga0157377_10000024 Ga0157377_10000024149 335
588 3300014969 Ga0157376_10000025 Ga0157376_1000002523 335
589 3300021358 Ga0213873_10000002 Ga0213873_10000002833 335
590 3300021384 Ga0213876_10000001 Ga0213876_10000001916 335
591 3300021384 Ga0213876_10000080 Ga0213876_100000802 335
592 3300021384 Ga0213876_10013522 Ga0213876_100135224 335
593 3300021384 Ga0213876_10179989 Ga0213876_101799892 335
594 3300025893 Ga0207682_10040379 Ga0207682_100403792 335
595 3300025908 Ga0207643_10003770 Ga0207643_100037707 335
596 3300025909 Ga0207705_10031207 Ga0207705_100312072 335
597 3300025910 Ga0207684_10069336 Ga0207684_100693362 335
598 3300025910 Ga0207684_10093552 Ga0207684_100935523 335
599 3300025917 Ga0207660_10009336 Ga0207660_100093364 335
600 3300025924 Ga0207694_10000001 Ga0207694_100000011579 335
601 3300025925 Ga0207650_10000262 Ga0207650_100002622 335
602 3300025934 Ga0207686_10052556 Ga0207686_100525563 335
603 3300025936 Ga0207670_10002583 Ga0207670_100025837 335
604 3300025939 Ga0207665_10033205 Ga0207665_100332052 335
605 3300025940 Ga0207691_10001623 Ga0207691_100016233 335
606 3300025942 Ga0207689_10017106 Ga0207689_100171064 335
607 3300025944 Ga0207661_10000001 Ga0207661_10000001150 335
608 3300026023 Ga0207677_10000249 Ga0207677_100002496 335
609 3300026035 Ga0207703_10000046 Ga0207703_10000046114 335
610 3300026075 Ga0207708_10000034 Ga0207708_10000034125 335
611 3300026095 Ga0207676_10000013 Ga0207676_10000013250 335
612 3300028381 Ga0268264_10002673 Ga0268264_1000267315 335
613 3300030521 Ga0307511_10020180 Ga0307511_100201804 335
614 3300039437 Ga0436365_0138728 Ga0436365_0138728_21221_22228 335
615 3300039437 Ga0436365_0404975 Ga0436365_0404975_175288_176400 335
616 3300039437 Ga0436365_0786638 Ga0436365_0786638_2593_3606 335
617 3300039453 Ga0436362_0660519 Ga0436362_0660519_88625_89737 335
618 3300039453 Ga0436362_1042072 Ga0436362_1042072_8598_9605 335
619 3300053083 Ga0495655_0000162 Ga0495655_0000162_8528_9535 335
620 3300005295 Ga0065707_10090239 Ga0065707_100902392 336
621 3300006847 Ga0075431_100057851 Ga0075431_1000578512 336
622 3300007076 Ga0075435_100203903 Ga0075435_1002039032 336
623 3300009094 Ga0111539_10000052 Ga0111539_1000005288 336
624 3300027907 Ga0207428_10000003 Ga0207428_1000000388 336
625 3300042876 Ga0451577_0001914 Ga0451577_0001914_4403_5449 336
626 3300044712 Ga0453684_0000481 Ga0453684_0000481_147630_148676 336
627 3300046515 Ga0495620_0000796 Ga0495620_0000796_113_1123 336
628 3300050511 nmdc:mga08y16_4_c1 nmdc:mga08y16_4_c1_836107_837117 336
629 3300050513 nmdc:mga0rr50_118222_c1 nmdc:mga0rr50_118222_c1_774_1784 336

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00579

tRNA-synt_1b

tRNA synthetases class I (W and Y)

37

320

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g36-assembly1.cif.gz_A-2 crystal structure of tryptophanyl-trna synthetase (ec 6.1.1.2) (tryptophan-trna ligase)(trprs) (tm0492) from thermotoga maritima at 2.50 a resolution 0.9579 6 331
2g36-assembly1.cif.gz_A-2 crystal structure of tryptophanyl-trna synthetase (ec 6.1.1.2) (tryptophan-trna ligase)(trprs) (tm0492) from thermotoga maritima at 2.50 a resolution 0.9521 6 331
6ncr-assembly3.cif.gz_A crystal structure of tryptophan-trna ligase from chlamydia trachomatis with bound l-tryptophan 0.9517 6 328
3tzl-assembly1.cif.gz_A crystal structure of tryptophanyl-trna synthetase from campylobacter jejuni complexed with adp and tryptophane 0.9421 6 328
3m5w-assembly1.cif.gz_A crystal structure of tryptophanyl-trna synthetase from campylobacter jejuni 0.9379 6 328
ID Description Score Start End Superfamily
1yiaC02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9567 192 297 1.10.240.10
1yi8C02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9513 203 297 1.10.240.10
2g36A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9507 6 331 3.40.50.620
5ekdB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.947 3 185 3.40.50.620
2g36A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.942 6 331 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A534IQW5-F1-model_v4 tryptophan--tRNA ligase (EC 6.1.1.2) 0.9958 12 174 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A7X9HV82-F1-model_v4 tryptophan--tRNA ligase (EC 6.1.1.2) 0.9916 12 149 GO:0004830
GO:0005524
GO:0006436
AF-A0A3N5N3V4-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) 0.9913 3 174 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A6L9KRB4-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) 0.9909 5 174 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A7X7UA31-F1-model_v4 deleted 0.9894 6 329

Feature Viewer

pLDDT pTM Quality
92.86 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map