F470740

General Info

Members Datasets Scaffolds Average Seq Length
629 290 1258 89

Family's Representative Sequence

Representative Sequence 3300021358|Ga0213873_10036975|Ga0213873_100369752
Length 100
Sequence MRWRDKYRMRAPATGREVIIEVDPGRIYRDRETGEELTVVAKVLPLAPTPSELPWSVENLRFCNWCDQHVPKDLNDCPICGRRMDPIGVRVAEEERGEPL

Samples

Sample ID Description Type Environment
1 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
97 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
150 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
151 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
152 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
153 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
156 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
157 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
172 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
173 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
174 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
175 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
177 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
178 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
179 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
180 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
183 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
194 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
195 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
196 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
197 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
198 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
199 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
200 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
201 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
206 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
207 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
214 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
217 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
218 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
221 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
222 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
223 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
226 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
229 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
261 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
262 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
268 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
271 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
285 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
290 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.95
Nodule 0
Rhizoplane 5.41
Rhizosphere 88.87
Stem 0
Stem Tuber 0
Unclassified 14.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213873_10036975 3300021358 Bacteria 1242
2 CNBas_1008956 3300000531 Bacteria 598
3 JGI24748J21848_1044286 3300002074 Bacteria 571
4 JGI25407J50210_10012702 3300003373 Unclassified 2159
5 JGI25407J50210_10013034 3300003373 Bacteria 2135
6 JGI25407J50210_10032904 3300003373 Bacteria 1340
7 JGI25407J50210_10033165 3300003373 Bacteria 1334
8 JGI25407J50210_10046586 3300003373 Bacteria 1103
9 JGI25407J50210_10081832 3300003373 Bacteria 802
10 Ga0070676_10100328 3300005328 Bacteria 1787
11 Ga0070683_100028238 3300005329 Bacteria 5069
12 Ga0070683_100866752 3300005329 Bacteria 866
13 Ga0068869_100887095 3300005334 Bacteria 771
14 Ga0070682_100012109 3300005337 Bacteria 4937
15 Ga0068868_100687311 3300005338 Bacteria 914
16 Ga0070660_100011510 3300005339 Bacteria 6293
17 Ga0070660_100884755 3300005339 Bacteria 753
18 Ga0070689_101036501 3300005340 Bacteria 731
19 Ga0070691_10008516 3300005341 Bacteria 4696
20 Ga0070691_10019450 3300005341 Bacteria 3134
21 Ga0070691_10876375 3300005341 Bacteria 552
22 Ga0070661_100169353 3300005344 Bacteria 1658
23 Ga0070668_100014149 3300005347 Bacteria 5962
24 Ga0070668_100231379 3300005347 Bacteria 1528
25 Ga0070668_100422987 3300005347 Unclassified 1141
26 Ga0070669_100149325 3300005353 Bacteria 1808
27 Ga0070669_101806877 3300005353 Unclassified 533
28 Ga0070675_100053231 3300005354 Bacteria 3328
29 Ga0070674_100548820 3300005356 Bacteria 969
30 Ga0070673_100720349 3300005364 Bacteria 917
31 Ga0070659_100000077 3300005366 Bacteria 76934
32 Ga0070659_100070990 3300005366 Bacteria 2768
33 Ga0070659_101039847 3300005366 Bacteria 720
34 Ga0070703_10295958 3300005406 Bacteria 673
35 Ga0070709_10025029 3300005434 Bacteria 3521
36 Ga0070714_100075551 3300005435 Bacteria 2923
37 Ga0070714_100140269 3300005435 Unclassified 2169
38 Ga0070714_100913282 3300005435 Unclassified 853
39 Ga0070713_100021823 3300005436 Bacteria 4935
40 Ga0070713_100148106 3300005436 Unclassified 2085
41 Ga0070713_100357594 3300005436 Bacteria 1356
42 Ga0070713_100691115 3300005436 Bacteria 974
43 Ga0070710_10000008 3300005437 Bacteria 198148
44 Ga0070710_10038030 3300005437 Bacteria 2641
45 Ga0070710_10419713 3300005437 Bacteria 901
46 Ga0070711_100975523 3300005439 Bacteria 726
47 Ga0070705_100842471 3300005440 Bacteria 733
48 Ga0070700_100003009 3300005441 Bacteria 8642
49 Ga0070700_100006548 3300005441 Bacteria 6231
50 Ga0070694_100056981 3300005444 Bacteria 2656
51 Ga0070663_100179990 3300005455 Bacteria 1639
52 Ga0070678_100026160 3300005456 Bacteria 3940
53 Ga0070662_100001852 3300005457 Bacteria 12963
54 Ga0070685_10018363 3300005466 Bacteria 3760
55 Ga0070684_100251045 3300005535 Bacteria 1617
56 Ga0068853_100255625 3300005539 Bacteria 1609
57 Ga0070672_100286928 3300005543 Bacteria 1393
58 Ga0070695_100039745 3300005545 Bacteria 2975
59 Ga0070693_100945317 3300005547 Bacteria 649
60 Ga0070665_100208857 3300005548 Bacteria 1953
61 Ga0070704_100617391 3300005549 Bacteria 954
62 Ga0070704_101824855 3300005549 Unclassified 563
63 Ga0068855_102086231 3300005563 Bacteria 571
64 Ga0068854_100098701 3300005578 Bacteria 2186
65 Ga0068856_100521387 3300005614 Bacteria 1209
66 Ga0068856_101440379 3300005614 Bacteria 703
67 Ga0070702_100021320 3300005615 Bacteria 3407
68 Ga0068852_100665218 3300005616 Bacteria 1050
69 Ga0068852_101182315 3300005616 Bacteria 786
70 Ga0068859_101025948 3300005617 Bacteria 906
71 Ga0068864_100030178 3300005618 Bacteria 4595
72 Ga0068861_100076907 3300005719 Bacteria 2602
73 Ga0068861_100196418 3300005719 Bacteria 1690
74 Ga0068851_10238080 3300005834 Bacteria 1028
75 Ga0068870_10077156 3300005840 Bacteria 1832
76 Ga0068863_100419997 3300005841 Bacteria 1310
77 Ga0068858_101180945 3300005842 Bacteria 752
78 Ga0068860_100634939 3300005843 Bacteria 1075
79 Ga0068860_102040177 3300005843 Archaea 595
80 Ga0068862_100094827 3300005844 Bacteria 2603
81 Ga0081455_10043664 3300005937 Bacteria 3918
82 Ga0081455_10488625 3300005937 Bacteria 830
83 Ga0081538_10000018 3300005981 Bacteria 143542
84 Ga0081538_10000173 3300005981 Bacteria 69480
85 Ga0081538_10000500 3300005981 Bacteria 43814
86 Ga0081538_10001651 3300005981 Bacteria 22862
87 Ga0081538_10002746 3300005981 Bacteria 16890
88 Ga0081538_10005481 3300005981 Bacteria 11401
89 Ga0081538_10006784 3300005981 Bacteria 10006
90 Ga0081538_10015671 3300005981 Bacteria 5855
91 Ga0081538_10020765 3300005981 Bacteria 4821
92 Ga0081538_10021556 3300005981 Bacteria 4695
93 Ga0081538_10024571 3300005981 Bacteria 4288
94 Ga0081538_10025184 3300005981 Bacteria 4205
95 Ga0081538_10062440 3300005981 Bacteria 2125
96 Ga0081538_10073962 3300005981 Bacteria 1858
97 Ga0081538_10139276 3300005981 Bacteria 1123
98 Ga0081538_10163977 3300005981 Bacteria 982
99 Ga0081538_10190254 3300005981 Bacteria 862
100 Ga0081540_1054207 3300005983 Bacteria 1961
101 Ga0081539_10072859 3300005985 Bacteria 1834
102 Ga0070717_10000004 3300006028 Bacteria 365525
103 Ga0070717_10053095 3300006028 Bacteria 3340
104 Ga0070717_10072474 3300006028 Bacteria 2876
105 Ga0070717_10249287 3300006028 Bacteria 1568
106 Ga0070717_10547024 3300006028 Unclassified 1048
107 Ga0075365_10658797 3300006038 Bacteria 740
108 Ga0075432_10031154 3300006058 Unclassified 1846
109 Ga0070716_101105721 3300006173 Bacteria 632
110 Ga0070712_100001459 3300006175 Bacteria 14415
111 Ga0070712_100540933 3300006175 Bacteria 980
112 Ga0075428_100030297 3300006844 Bacteria 5985
113 Ga0075428_100115000 3300006844 Bacteria 2931
114 Ga0075428_100120241 3300006844 Bacteria 2859
115 Ga0075428_100360439 3300006844 Unclassified 1560
116 Ga0075428_100960082 3300006844 Bacteria 905
117 Ga0075428_102485772 3300006844 Bacteria 531
118 Ga0075430_100000846 3300006846 Bacteria 24008
119 Ga0075430_100028421 3300006846 Bacteria 4751
120 Ga0075430_100098066 3300006846 Bacteria 2448
121 Ga0075430_100171760 3300006846 Bacteria 1804
122 Ga0075431_100278496 3300006847 Unclassified 1694
123 Ga0075431_100321036 3300006847 Bacteria 1561
124 Ga0075431_100350838 3300006847 Unclassified 1483
125 Ga0075431_101089858 3300006847 Bacteria 763
126 Ga0075431_101324343 3300006847 Bacteria 681
127 Ga0075431_101511853 3300006847 Bacteria 630
128 Ga0075431_102101274 3300006847 Bacteria 520
129 Ga0075433_10007676 3300006852 Bacteria 8567
130 Ga0075433_10238856 3300006852 Unclassified 1613
131 Ga0075433_10250969 3300006852 Bacteria 1570
132 Ga0075433_10272828 3300006852 Bacteria 1499
133 Ga0075433_11332553 3300006852 Bacteria 622
134 Ga0075434_100071826 3300006871 Unclassified 3453
135 Ga0075434_100385581 3300006871 Bacteria 1422
136 Ga0075434_100449047 3300006871 Bacteria 1310
137 Ga0075434_101503633 3300006871 Bacteria 682
138 Ga0075429_100019476 3300006880 Bacteria 5879
139 Ga0075429_100032693 3300006880 Bacteria 4521
140 Ga0075429_100042761 3300006880 Bacteria 3942
141 Ga0075429_100776889 3300006880 Bacteria 839
142 Ga0075429_100840320 3300006880 Bacteria 804
143 Ga0075429_101338401 3300006880 Bacteria 624
144 Ga0075429_101724756 3300006880 Unclassified 544
145 Ga0075436_100278620 3300006914 Bacteria 1195
146 Ga0097620_101026170 3300006931 Bacteria 906
147 Ga0075435_100107101 3300007076 Bacteria 2321
148 Ga0105240_10093658 3300009093 Bacteria 3666
149 Ga0111539_10021025 3300009094 Bacteria 8035
150 Ga0111539_10246163 3300009094 Bacteria 2082
151 Ga0111539_10350804 3300009094 Unclassified 1717
152 Ga0111539_10351971 3300009094 Bacteria 1714
153 Ga0111539_10727259 3300009094 Bacteria 1155
154 Ga0111539_11586864 3300009094 Bacteria 759
155 Ga0111539_12563749 3300009094 Bacteria 591
156 Ga0105245_10000909 3300009098 Bacteria 26907
157 Ga0105245_10002271 3300009098 Bacteria 17388
158 Ga0105245_13068949 3300009098 Bacteria 518
159 Ga0105247_10197732 3300009101 Bacteria 1349
160 Ga0114129_10000969 3300009147 Bacteria 37546
161 Ga0114129_10118461 3300009147 Bacteria 3647
162 Ga0114129_10150798 3300009147 Bacteria 3182
163 Ga0114129_10396364 3300009147 Unclassified 1820
164 Ga0114129_10962667 3300009147 Bacteria 1077
165 Ga0114129_11191053 3300009147 Bacteria 949
166 Ga0105243_10048574 3300009148 Bacteria 3346
167 Ga0105243_10139636 3300009148 Bacteria 2065
168 Ga0105243_12735388 3300009148 Bacteria 534
169 Ga0105241_11389314 3300009174 Bacteria 672
170 Ga0105241_12241226 3300009174 Unclassified 542
171 Ga0105242_10465428 3300009176 Bacteria 1195
172 Ga0105242_11998261 3300009176 Bacteria 622
173 Ga0105248_10050138 3300009177 Bacteria 4682
174 Ga0105238_11539740 3300009551 Unclassified 694
175 Ga0105249_10005678 3300009553 Bacteria 10786
176 Ga0105249_10121366 3300009553 Bacteria 2484
177 Ga0105239_10008378 3300010375 Bacteria 11778
178 Ga0105239_10019508 3300010375 Bacteria 7485
179 Ga0105239_10025600 3300010375 Bacteria 6496
180 Ga0105239_13367796 3300010375 Bacteria 520
181 Ga0105239_13553853 3300010375 Unclassified 507
182 Ga0105246_10140416 3300011119 Bacteria 1816
183 Ga0105246_10174066 3300011119 Bacteria 1651
184 Ga0157313_1048516 3300012503 Unclassified 545
185 Ga0157371_10559839 3300013102 Bacteria 848
186 Ga0157371_11575120 3300013102 Unclassified 514
187 Ga0157369_10982805 3300013105 Unclassified 864
188 Ga0157374_10390041 3300013296 Bacteria 1388
189 Ga0163162_10049327 3300013306 Bacteria 4219
190 Ga0163162_11435513 3300013306 Bacteria 785
191 Ga0157372_10656264 3300013307 Bacteria 1222
192 Ga0157372_11322008 3300013307 Bacteria 832
193 Ga0157375_10933219 3300013308 Bacteria 1010
194 Ga0163163_10815394 3300014325 Bacteria 997
195 Ga0163163_12383316 3300014325 Bacteria 588
196 Ga0157380_10068831 3300014326 Bacteria 2854
197 Ga0157380_10286566 3300014326 Bacteria 1510
198 Ga0157377_10000807 3300014745 Bacteria 12953
199 Ga0163161_10446347 3300017792 Unclassified 1045
200 Ga0206355_1093364 3300020076 Unclassified 807
201 Ga0206350_10280394 3300020080 Bacteria 886
202 Ga0206353_11639253 3300020082 Bacteria 584
203 Ga0154015_1052682 3300020610 Unclassified 703
204 Ga0213874_10012644 3300021377 Unclassified 2169
205 Ga0213874_10044546 3300021377 Bacteria 1340
206 Ga0213876_10018289 3300021384 Bacteria 3700
207 Ga0213876_10042757 3300021384 Bacteria 2394
208 Ga0213876_10063847 3300021384 Unclassified 1944
209 Ga0213875_10004577 3300021388 Bacteria 7550
210 Ga0213875_10086440 3300021388 Bacteria 1463
211 Ga0213875_10297274 3300021388 Bacteria 764
212 Ga0207656_10271169 3300025321 Bacteria 835
213 Ga0207653_10365442 3300025885 Bacteria 564
214 Ga0207692_10000034 3300025898 Bacteria 45780
215 Ga0207692_10007490 3300025898 Bacteria 4476
216 Ga0207710_10155127 3300025900 Bacteria 1113
217 Ga0207688_10068523 3300025901 Bacteria 2010
218 Ga0207647_10581332 3300025904 Bacteria 619
219 Ga0207699_10047236 3300025906 Unclassified 2523
220 Ga0207699_10428765 3300025906 Bacteria 945
221 Ga0207645_10106235 3300025907 Bacteria 1815
222 Ga0207643_10468697 3300025908 Bacteria 803
223 Ga0207707_10387001 3300025912 Bacteria 1202
224 Ga0207693_10022737 3300025915 Bacteria 4980
225 Ga0207693_10044782 3300025915 Bacteria 3477
226 Ga0207663_10373791 3300025916 Bacteria 1084
227 Ga0207657_10020679 3300025919 Bacteria 6214
228 Ga0207657_10089682 3300025919 Bacteria 2568
229 Ga0207657_10546215 3300025919 Unclassified 906
230 Ga0207649_10087763 3300025920 Bacteria 2030
231 Ga0207681_10003085 3300025923 Bacteria 10462
232 Ga0207681_10234382 3300025923 Bacteria 1426
233 Ga0207687_10314961 3300025927 Bacteria 1265
234 Ga0207700_10356755 3300025928 Bacteria 1274
235 Ga0207700_10872885 3300025928 Bacteria 805
236 Ga0207700_11000774 3300025928 Bacteria 748
237 Ga0207664_10000349 3300025929 Bacteria 33673
238 Ga0207664_10122708 3300025929 Bacteria 2176
239 Ga0207664_10734313 3300025929 Bacteria 888
240 Ga0207690_10000017 3300025932 Bacteria 243513
241 Ga0207706_10002965 3300025933 Bacteria 16376
242 Ga0207706_10005768 3300025933 Bacteria 11520
243 Ga0207706_10642896 3300025933 Bacteria 909
244 Ga0207686_11224389 3300025934 Bacteria 615
245 Ga0207709_10641373 3300025935 Bacteria 845
246 Ga0207709_11491490 3300025935 Bacteria 561
247 Ga0207669_10369523 3300025937 Bacteria 1114
248 Ga0207704_10151237 3300025938 Bacteria 1638
249 Ga0207691_10131657 3300025940 Bacteria 2208
250 Ga0207711_10242088 3300025941 Bacteria 1654
251 Ga0207689_10737611 3300025942 Bacteria 831
252 Ga0207661_10064392 3300025944 Bacteria 2972
253 Ga0207661_10697825 3300025944 Bacteria 933
254 Ga0207679_10110388 3300025945 Bacteria 2169
255 Ga0207679_10713031 3300025945 Bacteria 911
256 Ga0207667_10909922 3300025949 Bacteria 871
257 Ga0207651_10537351 3300025960 Bacteria 1015
258 Ga0207712_10124047 3300025961 Bacteria 1959
259 Ga0207668_10009971 3300025972 Bacteria 5716
260 Ga0207668_10411830 3300025972 Bacteria 1145
261 Ga0207668_10787012 3300025972 Bacteria 841
262 Ga0207640_10624253 3300025981 Bacteria 915
263 Ga0207640_11003092 3300025981 Unclassified 734
264 Ga0207677_10350878 3300026023 Bacteria 1236
265 Ga0207639_10228099 3300026041 Bacteria 1613
266 Ga0207678_10253801 3300026067 Bacteria 1507
267 Ga0207708_10003084 3300026075 Bacteria 12268
268 Ga0207708_10012544 3300026075 Bacteria 6318
269 Ga0207708_10130243 3300026075 Bacteria 1967
270 Ga0207708_10579192 3300026075 Bacteria 949
271 Ga0207702_10316729 3300026078 Bacteria 1485
272 Ga0207702_11330530 3300026078 Bacteria 712
273 Ga0207641_10911964 3300026088 Bacteria 873
274 Ga0207674_10775770 3300026116 Bacteria 925
275 Ga0207675_100022935 3300026118 Bacteria 5806
276 Ga0207675_100139423 3300026118 Bacteria 2303
277 Ga0207675_100968073 3300026118 Bacteria 869
278 Ga0207683_10057432 3300026121 Bacteria 3416
279 Ga0207698_10224672 3300026142 Bacteria 1700
280 Ga0207698_11988655 3300026142 Bacteria 596
281 Ga0207428_10390559 3300027907 Unclassified 1020
282 Ga0207428_10594612 3300027907 Unclassified 798
283 Ga0207428_10993142 3300027907 Bacteria 590
284 Ga0268265_10383825 3300028380 Bacteria 1293
285 Ga0265337_1130871 3300028556 Bacteria 680
286 Ga0265337_1231670 3300028556 Bacteria 503
287 Ga0265326_10000016 3300028558 Bacteria 154674
288 Ga0265319_1002611 3300028563 Bacteria 9712
289 Ga0265334_10000076 3300028573 Bacteria 71688
290 Ga0265336_10008708 3300028666 Bacteria 3541
291 Ga0265338_10005347 3300028800 Bacteria 16789
292 Ga0265338_10073861 3300028800 Bacteria 2904
293 Ga0265338_10538683 3300028800 Bacteria 818
294 Ga0265324_10004261 3300029957 Bacteria 6532
295 Ga0265320_10071639 3300031240 Bacteria 1632
296 Ga0265340_10136260 3300031247 Bacteria 1124
297 Ga0265327_10108516 3300031251 Bacteria 1330
298 Ga0307408_100639957 3300031548 Bacteria 949
299 Ga0307408_101584395 3300031548 Bacteria 621
300 Ga0307408_101697117 3300031548 Bacteria 602
301 Ga0307405_10033608 3300031731 Bacteria 3044
302 Ga0307405_11779087 3300031731 Bacteria 547
303 Ga0307413_10204261 3300031824 Bacteria 1429
304 Ga0307413_10632228 3300031824 Bacteria 880
305 Ga0307410_10121523 3300031852 Bacteria 1905
306 Ga0307410_10408247 3300031852 Bacteria 1099
307 Ga0307406_10025325 3300031901 Bacteria 3551
308 Ga0307406_11037252 3300031901 Unclassified 705
309 Ga0307407_10052239 3300031903 Bacteria 2346
310 Ga0307407_10735028 3300031903 Unclassified 746
311 Ga0307407_11308635 3300031903 Bacteria 569
312 Ga0307412_10300124 3300031911 Bacteria 1269
313 Ga0307412_10580852 3300031911 Bacteria 946
314 Ga0307409_100042517 3300031995 Bacteria 3404
315 Ga0307409_100221572 3300031995 Bacteria 1708
316 Ga0307409_100406366 3300031995 Bacteria 1302
317 Ga0307409_100770568 3300031995 Bacteria 967
318 Ga0307416_100023716 3300032002 Bacteria 4460
319 Ga0307416_100024067 3300032002 Bacteria 4435
320 Ga0307416_100565733 3300032002 Unclassified 1212
321 Ga0307416_102632811 3300032002 Bacteria 600
322 Ga0307414_10868352 3300032004 Bacteria 826
323 Ga0307411_10232609 3300032005 Bacteria 1438
324 Ga0307411_10338724 3300032005 Bacteria 1221
325 Ga0307411_12139885 3300032005 Unclassified 524
326 Ga0307415_100009879 3300032126 Bacteria 5379
327 Ga0307415_100036912 3300032126 Bacteria 3207
328 Ga0307415_100895659 3300032126 Bacteria 817
329 Ga0307415_101226249 3300032126 Bacteria 708
330 Ga0373948_0116141 3300034817 Unclassified 643
331 Ga0373958_0189152 3300034819 Unclassified 534
332 Ga0373938_0178333 3300034957 Bacteria 579
333 Ga0373951_0143837 3300035091 Unclassified 664
334 Ga0373923_0616425 3300035111 Bacteria 535
335 Ga0373932_0072665 3300035112 Unclassified 1070
336 Ga0373939_0128744 3300035114 Unclassified 901
337 Ga0373954_0621100 3300035118 Bacteria 536
338 Ga0373956_0058257 3300035119 Unclassified 1746
339 Ga0373960_0067348 3300035121 Unclassified 1099
340 Ga0373960_0446859 3300035121 Bacteria 506
341 Ga0373943_0555528 3300035170 Bacteria 674
342 Ga0373961_0099400 3300035241 Unclassified 940
343 Ga0373962_0035959 3300035242 Unclassified 1377
344 Ga0373931_0132654 3300035691 Unclassified 1435
345 Ga0373933_0698623 3300035724 Bacteria 667
346 Ga0395900_0967993 3300037418 Bacteria 772
347 Ga0395898_0211863 3300037466 Bacteria 1848
348 Ga0395898_0810716 3300037466 Bacteria 876
349 Ga0395898_0990036 3300037466 Bacteria 777
350 Ga0395898_1032636 3300037466 Bacteria 757
351 Ga0395898_1065091 3300037466 Bacteria 743
352 Ga0395905_0910991 3300037471 Bacteria 782
353 Ga0436364_0178285 3300037853 Unclassified 1619
354 Ga0436364_0185151 3300037853 Bacteria 2606
355 Ga0436364_0261803 3300037853 Bacteria 13274
356 Ga0436364_0426125 3300037853 Bacteria 1285
357 Ga0436364_0850142 3300037853 Bacteria 5623
358 Ga0436364_1022743 3300037853 Bacteria 4733
359 Ga0436364_1113073 3300037853 Bacteria 1586
360 Ga0436364_1126991 3300037853 Bacteria 532
361 Ga0395901_0049282 3300038443 Bacteria 4376
362 Ga0395901_0837369 3300038443 Bacteria 906
363 Ga0395901_0968855 3300038443 Bacteria 828
364 Ga0395901_1885818 3300038443 Bacteria 545
365 Ga0436365_0025512 3300039437 Bacteria 6612
366 Ga0436365_0377309 3300039437 Bacteria 26799
367 Ga0436365_0398007 3300039437 Bacteria 5758
368 Ga0436365_0425865 3300039437 Bacteria 2396
369 Ga0436365_1124760 3300039437 Bacteria 9544
370 Ga0436365_1454171 3300039437 Bacteria 2181
371 Ga0436365_1888293 3300039437 Bacteria 3993
372 Ga0436363_0048403 3300039450 Bacteria 23056
373 Ga0436363_0442259 3300039450 Bacteria 619
374 Ga0436363_0519676 3300039450 Bacteria 724
375 Ga0436363_0661865 3300039450 Unclassified 502
376 Ga0436363_1084682 3300039450 Unclassified 3145
377 Ga0436363_1084969 3300039450 Bacteria 794
378 Ga0436362_0074903 3300039453 Unclassified 823
379 Ga0436362_0319236 3300039453 Bacteria 2625
380 Ga0436362_0475254 3300039453 Bacteria 628
381 Ga0451853_0869430 3300041512 Unclassified 522
382 Ga0439448_0021681 3300042005 Bacteria 1992
383 Ga0439454_071986 3300042011 Bacteria 615
384 Ga0439455_0066720 3300042012 Bacteria 962
385 Ga0439463_077288 3300042016 Bacteria 855
386 Ga0439460_0037001 3300042461 Bacteria 1418
387 Ga0466969_0005379 3300044656 Bacteria 6814
388 Ga0466969_0443913 3300044656 Unclassified 590
389 Ga0466965_0104431 3300044683 Bacteria 1451
390 Ga0466965_0245055 3300044683 Bacteria 960
391 Ga0466966_0077475 3300044684 Bacteria 2075
392 Ga0466966_0147154 3300044684 Bacteria 1438
393 Ga0466966_0224693 3300044684 Unclassified 1133
394 Ga0466966_0267029 3300044684 Bacteria 1030
395 Ga0466966_0864370 3300044684 Bacteria 545
396 Ga0466961_0008978 3300044693 Bacteria 6378
397 Ga0466961_0035963 3300044693 Bacteria 3179
398 Ga0466961_0201034 3300044693 Unclassified 1232
399 Ga0466961_0935006 3300044693 Bacteria 516
400 Ga0466963_0002750 3300044694 Bacteria 9924
401 Ga0466963_0002814 3300044694 Bacteria 9807
402 Ga0466963_0004205 3300044694 Bacteria 8347
403 Ga0466963_0009703 3300044694 Bacteria 5806
404 Ga0466963_0016680 3300044694 Bacteria 4570
405 Ga0466963_0066114 3300044694 Bacteria 2425
406 Ga0466963_0150264 3300044694 Bacteria 1617
407 Ga0466963_0166748 3300044694 Bacteria 1534
408 Ga0466963_0611772 3300044694 Bacteria 769
409 Ga0466963_0796193 3300044694 Bacteria 667
410 Ga0466963_1254875 3300044694 Bacteria 520
411 Ga0466964_0460968 3300044706 Unclassified 676
412 Ga0466964_0826179 3300044706 Unclassified 525
413 Ga0466971_0004298 3300044719 Bacteria 6139
414 Ga0466971_0068152 3300044719 Bacteria 1613
415 Ga0466971_0148829 3300044719 Bacteria 1092
416 Ga0466971_0190581 3300044719 Bacteria 966
417 Ga0466971_0217811 3300044719 Bacteria 904
418 Ga0466971_0437553 3300044719 Bacteria 640
419 Ga0466968_0017072 3300044735 Bacteria 2896
420 Ga0466968_0041713 3300044735 Unclassified 1938
421 Ga0466968_0045082 3300044735 Bacteria 1870
422 Ga0466968_0055796 3300044735 Bacteria 1696
423 Ga0466968_0095180 3300044735 Bacteria 1324
424 Ga0466968_0384666 3300044735 Bacteria 686
425 Ga0466968_0549058 3300044735 Bacteria 580
426 Ga0466970_0018115 3300044765 Unclassified 3644
427 Ga0466970_0102041 3300044765 Bacteria 1563
428 Ga0466970_0194392 3300044765 Bacteria 1128
429 Ga0466970_0276184 3300044765 Bacteria 944
430 Ga0466970_0335509 3300044765 Bacteria 856
431 Ga0466970_0390699 3300044765 Bacteria 793
432 Ga0466957_0003271 3300044842 Bacteria 8876
433 Ga0466957_0028194 3300044842 Bacteria 3342
434 Ga0466957_0125642 3300044842 Unclassified 1639
435 Ga0466957_0136710 3300044842 Unclassified 1576
436 Ga0466957_0221912 3300044842 Bacteria 1248
437 Ga0466957_0316329 3300044842 Bacteria 1052
438 Ga0466957_0980372 3300044842 Bacteria 606
439 Ga0466959_0004119 3300045049 Bacteria 9685
440 Ga0466959_0016430 3300045049 Bacteria 5408
441 Ga0466959_0019955 3300045049 Bacteria 4934
442 Ga0466959_0025104 3300045049 Bacteria 4414
443 Ga0466959_0094087 3300045049 Bacteria 2150
444 Ga0466959_0144245 3300045049 Unclassified 1681
445 Ga0466959_1075967 3300045049 Unclassified 535
446 Ga0466958_0001555 3300045836 Bacteria 10996
447 Ga0466958_0003521 3300045836 Bacteria 8139
448 Ga0466958_0011736 3300045836 Bacteria 4945
449 Ga0466958_0017886 3300045836 Bacteria 4106
450 Ga0466958_0018699 3300045836 Bacteria 4026
451 Ga0466958_0031742 3300045836 Bacteria 3140
452 Ga0466958_0038889 3300045836 Bacteria 2856
453 Ga0466958_0067801 3300045836 Unclassified 2180
454 Ga0466958_0208757 3300045836 Unclassified 1244
455 Ga0466958_0415346 3300045836 Bacteria 869
456 Ga0466958_0529183 3300045836 Bacteria 765
457 Ga0466967_0006740 3300045976 Bacteria 8174
458 Ga0466967_0067369 3300045976 Bacteria 3193
459 Ga0466967_0130608 3300045976 Bacteria 2331
460 Ga0466967_0161164 3300045976 Bacteria 2105
461 Ga0466967_0444134 3300045976 Unclassified 1267
462 Ga0466967_0580723 3300045976 Bacteria 1105
463 Ga0466967_0647561 3300045976 Unclassified 1045
464 Ga0466967_0956581 3300045976 Bacteria 852
465 Ga0466967_1050158 3300045976 Bacteria 811
466 Ga0466967_1546145 3300045976 Bacteria 661
467 Ga0495617_159020 3300046452 Bacteria 717
468 Ga0495590_0211587 3300046457 Bacteria 715
469 Ga0495653_0068696 3300046463 Bacteria 2657
470 Ga0495584_0343006 3300046491 Bacteria 759
471 Ga0495596_0023238 3300046500 Bacteria 2517
472 Ga0495596_0237782 3300046500 Bacteria 707
473 Ga0495616_0174317 3300046513 Unclassified 960
474 Ga0495628_0381357 3300046516 Unclassified 1032
475 Ga0495637_0132560 3300046520 Bacteria 951
476 Ga0495637_0155834 3300046520 Unclassified 859
477 Ga0495644_0447214 3300046523 Bacteria 514
478 Ga0495642_0180121 3300046528 Bacteria 920
479 Ga0495609_0265046 3300046538 Bacteria 705
480 Ga0495656_0275844 3300046615 Bacteria 856
481 Ga0495668_0322590 3300046616 Bacteria 847
482 Ga0495668_0378868 3300046616 Bacteria 777
483 Ga0495599_0098009 3300046678 Unclassified 1827
484 Ga0495670_0265890 3300046691 Unclassified 916
485 Ga0495671_0547236 3300046692 Bacteria 551
486 Ga0495589_0379171 3300046794 Bacteria 650
487 Ga0495600_0041175 3300046809 Bacteria 3010
488 Ga0495672_0009586 3300047320 Bacteria 6995
489 Ga0495602_0036947 3300048088 Bacteria 4539
490 Ga0495626_0338539 3300048091 Bacteria 589
491 Ga0496100_0020849 3300048903 Bacteria 3938
492 Ga0496100_0231318 3300048903 Bacteria 1360
493 Ga0496100_0464137 3300048903 Bacteria 972
494 Ga0496101_0004517 3300048904 Bacteria 8780
495 Ga0496101_0124922 3300048904 Bacteria 1949
496 Ga0496102_0031064 3300048905 Bacteria 4787
497 Ga0496102_1246286 3300048905 Bacteria 663
498 Ga0496103_0204133 3300048906 Bacteria 1271
499 Ga0496104_0350757 3300048907 Bacteria 1388
500 Ga0496105_0493106 3300048908 Bacteria 962
501 Ga0496106_0032498 3300048909 Bacteria 3891
502 Ga0496106_0164010 3300048909 Bacteria 1758
503 Ga0496107_0096627 3300048910 Bacteria 2162
504 Ga0496107_0181902 3300048910 Bacteria 1561
505 Ga0496108_0027511 3300048911 Bacteria 4696
506 Ga0496108_0041903 3300048911 Bacteria 3822
507 Ga0496109_0006236 3300048912 Bacteria 10029
508 Ga0496109_0252007 3300048912 Bacteria 1662
509 Ga0496109_1788850 3300048912 Bacteria 548
510 Ga0496110_0294862 3300048913 Bacteria 1477
511 Ga0496110_0338580 3300048913 Bacteria 1370
512 Ga0496111_0138097 3300048914 Bacteria 1806
513 Ga0496111_0540970 3300048914 Bacteria 855
514 Ga0496112_0030571 3300048915 Bacteria 5213
515 Ga0496112_0082312 3300048915 Bacteria 3183
516 Ga0496112_0347582 3300048915 Unclassified 1426
517 Ga0496112_0903223 3300048915 Bacteria 805
518 Ga0496113_0029027 3300048916 Bacteria 3988
519 Ga0496113_0364432 3300048916 Bacteria 1159
520 Ga0496113_0470923 3300048916 Bacteria 1009
521 Ga0496114_0149787 3300048917 Bacteria 2024
522 Ga0496114_1251837 3300048917 Bacteria 628
523 Ga0496115_0253054 3300048918 Bacteria 1450
524 Ga0496115_0774146 3300048918 Bacteria 749
525 Ga0501031_0106165 3300049568 Bacteria 1833
526 Ga0501036_0054239 3300049572 Bacteria 3395
527 Ga0501036_0414238 3300049572 Bacteria 1124
528 Ga0501036_0772186 3300049572 Unclassified 792
529 Ga0501036_0820861 3300049572 Bacteria 765
530 Ga0501037_0548831 3300049573 Bacteria 780
531 Ga0501038_0136418 3300049574 Bacteria 2010
532 Ga0501038_0199239 3300049574 Bacteria 1608
533 Ga0501039_0064910 3300049575 Bacteria 2831
534 Ga0501040_0052650 3300049576 Bacteria 2787
535 Ga0501040_0315142 3300049576 Bacteria 1119
536 Ga0501040_0350535 3300049576 Bacteria 1057
537 Ga0501040_0566508 3300049576 Bacteria 820
538 Ga0501041_0052485 3300049577 Bacteria 2486
539 Ga0501041_0361084 3300049577 Bacteria 918
540 Ga0501042_0196884 3300049578 Bacteria 1453
541 Ga0501042_0335852 3300049578 Bacteria 1092
542 Ga0501042_0424115 3300049578 Bacteria 964
543 Ga0501043_1294980 3300049579 Unclassified 509
544 Ga0501046_0154841 3300049580 Bacteria 1728
545 Ga0501069_0590945 3300049585 Bacteria 666
546 Ga0501071_0278387 3300049587 Bacteria 1266
547 Ga0501071_0282732 3300049587 Bacteria 1256
548 Ga0501071_0294667 3300049587 Bacteria 1229
549 Ga0501071_0608362 3300049587 Unclassified 840
550 Ga0501071_0655465 3300049587 Bacteria 808
551 Ga0501072_0089815 3300049588 Bacteria 2439
552 Ga0501072_0098138 3300049588 Bacteria 2329
553 Ga0501072_0196832 3300049588 Bacteria 1607
554 Ga0501072_1035032 3300049588 Bacteria 640
555 Ga0501075_0117021 3300049591 Bacteria 2026
556 Ga0501076_0043908 3300049592 Bacteria 3524
557 Ga0501077_0221776 3300049593 Bacteria 1202
558 Ga0501077_0370067 3300049593 Unclassified 915
559 Ga0501079_0138473 3300049741 Bacteria 1896
560 Ga0501079_0280420 3300049741 Bacteria 1303
561 Ga0501081_0030299 3300049743 Bacteria 3662
562 Ga0501081_0147722 3300049743 Bacteria 1687
563 Ga0501081_0520151 3300049743 Bacteria 888
564 Ga0501035_0445320 3300049822 Bacteria 1072
565 Ga0501045_0031108 3300049824 Bacteria 3865
566 Ga0501045_1061309 3300049824 Bacteria 593
567 nmdc:mga03n38_48729_c1 3300050490 Bacteria 1881
568 nmdc:mga00v17_61235_c1 3300050491 Bacteria 2313
569 nmdc:mga0yw44_147398_c1 3300050492 Bacteria 1533
570 nmdc:mga0yw44_462423_c1 3300050492 Unclassified 860
571 nmdc:mga06z11_945667_c1 3300050494 Bacteria 525
572 nmdc:mga05p37_1140166_c1 3300050507 Bacteria 812
573 nmdc:mga05p37_368531_c1 3300050507 Bacteria 1686
574 nmdc:mga05p37_421780_c1 3300050507 Bacteria 1552
575 nmdc:mga05p37_43041_c1 3300050507 Bacteria 5552
576 nmdc:mga05p37_601_c1 3300050507 Bacteria 39708
577 nmdc:mga05p37_773602_c1 3300050507 Unclassified 1054
578 nmdc:mga05p37_960287_c1 3300050507 Bacteria 913
579 nmdc:mga09592_1059182_c1 3300050508 Bacteria 676
580 nmdc:mga09592_1520233_c1 3300050508 Bacteria 544
581 nmdc:mga09592_17392_c1 3300050508 Bacteria 5890
582 nmdc:mga09592_19631_c1 3300050508 Bacteria 5550
583 nmdc:mga09592_305575_c1 3300050508 Bacteria 1379
584 nmdc:mga09592_646698_c1 3300050508 Bacteria 903
585 nmdc:mga0qj67_10715_c1 3300050509 Bacteria 5404
586 nmdc:mga0qj67_255855_c1 3300050509 Bacteria 1421
587 nmdc:mga0qj67_356527_c1 3300050509 Bacteria 1182
588 nmdc:mga0qj67_782599_c1 3300050509 Bacteria 756
589 nmdc:mga06r32_1268038_c1 3300050510 Bacteria 681
590 nmdc:mga06r32_13363_c1 3300050510 Bacteria 7436
591 nmdc:mga06r32_1439901_c1 3300050510 Bacteria 630
592 nmdc:mga06r32_2073480_c1 3300050510 Bacteria 502
593 nmdc:mga06r32_4468_c1 3300050510 Bacteria 12524
594 nmdc:mga06r32_793236_c1 3300050510 Bacteria 908
595 nmdc:mga06r32_974125_c1 3300050510 Bacteria 802
596 nmdc:mga08y16_1180940_c1 3300050511 Bacteria 737
597 nmdc:mga08y16_141222_c1 3300050511 Unclassified 2504
598 nmdc:mga08y16_353437_c1 3300050511 Unclassified 1509
599 nmdc:mga08y16_38207_c1 3300050511 Bacteria 5042
600 nmdc:mga08y16_569235_c1 3300050511 Unclassified 1145
601 nmdc:mga08y16_589708_c1 3300050511 Unclassified 613
602 nmdc:mga0n895_292937_c1 3300050512 Unclassified 1650
603 nmdc:mga0n895_87299_c1 3300050512 Bacteria 3116
604 nmdc:mga0rr50_67264_c1 3300050513 Bacteria 2721
605 nmdc:mga08x19_157889_c1 3300050514 Bacteria 1539
606 nmdc:mga08x19_71564_c1 3300050514 Bacteria 2261
607 nmdc:mga0a205_157714_c1 3300050515 Unclassified 2167
608 nmdc:mga0a205_57940_c1 3300050515 Bacteria 3741
609 Ga0495601_0016045 3300053077 Bacteria 4533
610 Ga0495601_0414472 3300053077 Bacteria 873
611 Ga0495655_0031342 3300053083 Bacteria 1293
612 Ga0495595_0014266 3300053084 Bacteria 3367
613 Ga0501084_0109752 3300054114 Bacteria 2318
614 Ga0501084_0464487 3300054114 Bacteria 1070
615 Ga0587088_065499 3300059508 Unclassified 746
616 Ga0501082_0011255 3300060353 Bacteria 7690
617 Ga0501082_0112789 3300060353 Bacteria 2354
618 Ga0501082_0347499 3300060353 Bacteria 1293
619 Ga0466962_0019257 3300061719 Bacteria 3279
620 Ga0466962_0034777 3300061719 Bacteria 2412
621 Ga0466962_0115325 3300061719 Unclassified 1294
622 Ga0466962_0234603 3300061719 Bacteria 900
623 Ga0466962_0334740 3300061719 Unclassified 752
624 Ga0466962_0374580 3300061719 Bacteria 711
625 Ga0530510_0215441 3300061734 Bacteria 1427
626 Ga0530510_0313288 3300061734 Bacteria 1175
627 Ga0530510_0971302 3300061734 Unclassified 650
628 Ga0530510_1152083 3300061734 Unclassified 594
629 Ga0530510_1499271 3300061734 Bacteria 518
630 Ga0213873_10036975
631 CNBas_1008956
632 JGI24748J21848_1044286
633 JGI25407J50210_10012702
634 JGI25407J50210_10013034
635 JGI25407J50210_10032904
636 JGI25407J50210_10033165
637 JGI25407J50210_10046586
638 JGI25407J50210_10081832
639 Ga0070676_10100328
640 Ga0070683_100028238
641 Ga0070683_100866752
642 Ga0068869_100887095
643 Ga0070682_100012109
644 Ga0068868_100687311
645 Ga0070660_100011510
646 Ga0070660_100884755
647 Ga0070689_101036501
648 Ga0070691_10008516
649 Ga0070691_10019450
650 Ga0070691_10876375
651 Ga0070661_100169353
652 Ga0070668_100014149
653 Ga0070668_100231379
654 Ga0070668_100422987
655 Ga0070669_100149325
656 Ga0070669_101806877
657 Ga0070675_100053231
658 Ga0070674_100548820
659 Ga0070673_100720349
660 Ga0070659_100000077
661 Ga0070659_100070990
662 Ga0070659_101039847
663 Ga0070703_10295958
664 Ga0070709_10025029
665 Ga0070714_100075551
666 Ga0070714_100140269
667 Ga0070714_100913282
668 Ga0070713_100021823
669 Ga0070713_100148106
670 Ga0070713_100357594
671 Ga0070713_100691115
672 Ga0070710_10000008
673 Ga0070710_10038030
674 Ga0070710_10419713
675 Ga0070711_100975523
676 Ga0070705_100842471
677 Ga0070700_100003009
678 Ga0070700_100006548
679 Ga0070694_100056981
680 Ga0070663_100179990
681 Ga0070678_100026160
682 Ga0070662_100001852
683 Ga0070685_10018363
684 Ga0070684_100251045
685 Ga0068853_100255625
686 Ga0070672_100286928
687 Ga0070695_100039745
688 Ga0070693_100945317
689 Ga0070665_100208857
690 Ga0070704_100617391
691 Ga0070704_101824855
692 Ga0068855_102086231
693 Ga0068854_100098701
694 Ga0068856_100521387
695 Ga0068856_101440379
696 Ga0070702_100021320
697 Ga0068852_100665218
698 Ga0068852_101182315
699 Ga0068859_101025948
700 Ga0068864_100030178
701 Ga0068861_100076907
702 Ga0068861_100196418
703 Ga0068851_10238080
704 Ga0068870_10077156
705 Ga0068863_100419997
706 Ga0068858_101180945
707 Ga0068860_100634939
708 Ga0068860_102040177
709 Ga0068862_100094827
710 Ga0081455_10043664
711 Ga0081455_10488625
712 Ga0081538_10000018
713 Ga0081538_10000173
714 Ga0081538_10000500
715 Ga0081538_10001651
716 Ga0081538_10002746
717 Ga0081538_10005481
718 Ga0081538_10006784
719 Ga0081538_10015671
720 Ga0081538_10020765
721 Ga0081538_10021556
722 Ga0081538_10024571
723 Ga0081538_10025184
724 Ga0081538_10062440
725 Ga0081538_10073962
726 Ga0081538_10139276
727 Ga0081538_10163977
728 Ga0081538_10190254
729 Ga0081540_1054207
730 Ga0081539_10072859
731 Ga0070717_10000004
732 Ga0070717_10053095
733 Ga0070717_10072474
734 Ga0070717_10249287
735 Ga0070717_10547024
736 Ga0075365_10658797
737 Ga0075432_10031154
738 Ga0070716_101105721
739 Ga0070712_100001459
740 Ga0070712_100540933
741 Ga0075428_100030297
742 Ga0075428_100115000
743 Ga0075428_100120241
744 Ga0075428_100360439
745 Ga0075428_100960082
746 Ga0075428_102485772
747 Ga0075430_100000846
748 Ga0075430_100028421
749 Ga0075430_100098066
750 Ga0075430_100171760
751 Ga0075431_100278496
752 Ga0075431_100321036
753 Ga0075431_100350838
754 Ga0075431_101089858
755 Ga0075431_101324343
756 Ga0075431_101511853
757 Ga0075431_102101274
758 Ga0075433_10007676
759 Ga0075433_10238856
760 Ga0075433_10250969
761 Ga0075433_10272828
762 Ga0075433_11332553
763 Ga0075434_100071826
764 Ga0075434_100385581
765 Ga0075434_100449047
766 Ga0075434_101503633
767 Ga0075429_100019476
768 Ga0075429_100032693
769 Ga0075429_100042761
770 Ga0075429_100776889
771 Ga0075429_100840320
772 Ga0075429_101338401
773 Ga0075429_101724756
774 Ga0075436_100278620
775 Ga0097620_101026170
776 Ga0075435_100107101
777 Ga0105240_10093658
778 Ga0111539_10021025
779 Ga0111539_10246163
780 Ga0111539_10350804
781 Ga0111539_10351971
782 Ga0111539_10727259
783 Ga0111539_11586864
784 Ga0111539_12563749
785 Ga0105245_10000909
786 Ga0105245_10002271
787 Ga0105245_13068949
788 Ga0105247_10197732
789 Ga0114129_10000969
790 Ga0114129_10118461
791 Ga0114129_10150798
792 Ga0114129_10396364
793 Ga0114129_10962667
794 Ga0114129_11191053
795 Ga0105243_10048574
796 Ga0105243_10139636
797 Ga0105243_12735388
798 Ga0105241_11389314
799 Ga0105241_12241226
800 Ga0105242_10465428
801 Ga0105242_11998261
802 Ga0105248_10050138
803 Ga0105238_11539740
804 Ga0105249_10005678
805 Ga0105249_10121366
806 Ga0105239_10008378
807 Ga0105239_10019508
808 Ga0105239_10025600
809 Ga0105239_13367796
810 Ga0105239_13553853
811 Ga0105246_10140416
812 Ga0105246_10174066
813 Ga0157313_1048516
814 Ga0157371_10559839
815 Ga0157371_11575120
816 Ga0157369_10982805
817 Ga0157374_10390041
818 Ga0163162_10049327
819 Ga0163162_11435513
820 Ga0157372_10656264
821 Ga0157372_11322008
822 Ga0157375_10933219
823 Ga0163163_10815394
824 Ga0163163_12383316
825 Ga0157380_10068831
826 Ga0157380_10286566
827 Ga0157377_10000807
828 Ga0163161_10446347
829 Ga0206355_1093364
830 Ga0206350_10280394
831 Ga0206353_11639253
832 Ga0154015_1052682
833 Ga0213874_10012644
834 Ga0213874_10044546
835 Ga0213876_10018289
836 Ga0213876_10042757
837 Ga0213876_10063847
838 Ga0213875_10004577
839 Ga0213875_10086440
840 Ga0213875_10297274
841 Ga0207656_10271169
842 Ga0207653_10365442
843 Ga0207692_10000034
844 Ga0207692_10007490
845 Ga0207710_10155127
846 Ga0207688_10068523
847 Ga0207647_10581332
848 Ga0207699_10047236
849 Ga0207699_10428765
850 Ga0207645_10106235
851 Ga0207643_10468697
852 Ga0207707_10387001
853 Ga0207693_10022737
854 Ga0207693_10044782
855 Ga0207663_10373791
856 Ga0207657_10020679
857 Ga0207657_10089682
858 Ga0207657_10546215
859 Ga0207649_10087763
860 Ga0207681_10003085
861 Ga0207681_10234382
862 Ga0207687_10314961
863 Ga0207700_10356755
864 Ga0207700_10872885
865 Ga0207700_11000774
866 Ga0207664_10000349
867 Ga0207664_10122708
868 Ga0207664_10734313
869 Ga0207690_10000017
870 Ga0207706_10002965
871 Ga0207706_10005768
872 Ga0207706_10642896
873 Ga0207686_11224389
874 Ga0207709_10641373
875 Ga0207709_11491490
876 Ga0207669_10369523
877 Ga0207704_10151237
878 Ga0207691_10131657
879 Ga0207711_10242088
880 Ga0207689_10737611
881 Ga0207661_10064392
882 Ga0207661_10697825
883 Ga0207679_10110388
884 Ga0207679_10713031
885 Ga0207667_10909922
886 Ga0207651_10537351
887 Ga0207712_10124047
888 Ga0207668_10009971
889 Ga0207668_10411830
890 Ga0207668_10787012
891 Ga0207640_10624253
892 Ga0207640_11003092
893 Ga0207677_10350878
894 Ga0207639_10228099
895 Ga0207678_10253801
896 Ga0207708_10003084
897 Ga0207708_10012544
898 Ga0207708_10130243
899 Ga0207708_10579192
900 Ga0207702_10316729
901 Ga0207702_11330530
902 Ga0207641_10911964
903 Ga0207674_10775770
904 Ga0207675_100022935
905 Ga0207675_100139423
906 Ga0207675_100968073
907 Ga0207683_10057432
908 Ga0207698_10224672
909 Ga0207698_11988655
910 Ga0207428_10390559
911 Ga0207428_10594612
912 Ga0207428_10993142
913 Ga0268265_10383825
914 Ga0265337_1130871
915 Ga0265337_1231670
916 Ga0265326_10000016
917 Ga0265319_1002611
918 Ga0265334_10000076
919 Ga0265336_10008708
920 Ga0265338_10005347
921 Ga0265338_10073861
922 Ga0265338_10538683
923 Ga0265324_10004261
924 Ga0265320_10071639
925 Ga0265340_10136260
926 Ga0265327_10108516
927 Ga0307408_100639957
928 Ga0307408_101584395
929 Ga0307408_101697117
930 Ga0307405_10033608
931 Ga0307405_11779087
932 Ga0307413_10204261
933 Ga0307413_10632228
934 Ga0307410_10121523
935 Ga0307410_10408247
936 Ga0307406_10025325
937 Ga0307406_11037252
938 Ga0307407_10052239
939 Ga0307407_10735028
940 Ga0307407_11308635
941 Ga0307412_10300124
942 Ga0307412_10580852
943 Ga0307409_100042517
944 Ga0307409_100221572
945 Ga0307409_100406366
946 Ga0307409_100770568
947 Ga0307416_100023716
948 Ga0307416_100024067
949 Ga0307416_100565733
950 Ga0307416_102632811
951 Ga0307414_10868352
952 Ga0307411_10232609
953 Ga0307411_10338724
954 Ga0307411_12139885
955 Ga0307415_100009879
956 Ga0307415_100036912
957 Ga0307415_100895659
958 Ga0307415_101226249
959 Ga0373948_0116141
960 Ga0373958_0189152
961 Ga0373938_0178333
962 Ga0373951_0143837
963 Ga0373923_0616425
964 Ga0373932_0072665
965 Ga0373939_0128744
966 Ga0373954_0621100
967 Ga0373956_0058257
968 Ga0373960_0067348
969 Ga0373960_0446859
970 Ga0373943_0555528
971 Ga0373961_0099400
972 Ga0373962_0035959
973 Ga0373931_0132654
974 Ga0373933_0698623
975 Ga0395900_0967993
976 Ga0395898_0211863
977 Ga0395898_0810716
978 Ga0395898_0990036
979 Ga0395898_1032636
980 Ga0395898_1065091
981 Ga0395905_0910991
982 Ga0436364_0178285
983 Ga0436364_0185151
984 Ga0436364_0261803
985 Ga0436364_0426125
986 Ga0436364_0850142
987 Ga0436364_1022743
988 Ga0436364_1113073
989 Ga0436364_1126991
990 Ga0395901_0049282
991 Ga0395901_0837369
992 Ga0395901_0968855
993 Ga0395901_1885818
994 Ga0436365_0025512
995 Ga0436365_0377309
996 Ga0436365_0398007
997 Ga0436365_0425865
998 Ga0436365_1124760
999 Ga0436365_1454171
1000 Ga0436365_1888293
1001 Ga0436363_0048403
1002 Ga0436363_0442259
1003 Ga0436363_0519676
1004 Ga0436363_0661865
1005 Ga0436363_1084682
1006 Ga0436363_1084969
1007 Ga0436362_0074903
1008 Ga0436362_0319236
1009 Ga0436362_0475254
1010 Ga0451853_0869430
1011 Ga0439448_0021681
1012 Ga0439454_071986
1013 Ga0439455_0066720
1014 Ga0439463_077288
1015 Ga0439460_0037001
1016 Ga0466969_0005379
1017 Ga0466969_0443913
1018 Ga0466965_0104431
1019 Ga0466965_0245055
1020 Ga0466966_0077475
1021 Ga0466966_0147154
1022 Ga0466966_0224693
1023 Ga0466966_0267029
1024 Ga0466966_0864370
1025 Ga0466961_0008978
1026 Ga0466961_0035963
1027 Ga0466961_0201034
1028 Ga0466961_0935006
1029 Ga0466963_0002750
1030 Ga0466963_0002814
1031 Ga0466963_0004205
1032 Ga0466963_0009703
1033 Ga0466963_0016680
1034 Ga0466963_0066114
1035 Ga0466963_0150264
1036 Ga0466963_0166748
1037 Ga0466963_0611772
1038 Ga0466963_0796193
1039 Ga0466963_1254875
1040 Ga0466964_0460968
1041 Ga0466964_0826179
1042 Ga0466971_0004298
1043 Ga0466971_0068152
1044 Ga0466971_0148829
1045 Ga0466971_0190581
1046 Ga0466971_0217811
1047 Ga0466971_0437553
1048 Ga0466968_0017072
1049 Ga0466968_0041713
1050 Ga0466968_0045082
1051 Ga0466968_0055796
1052 Ga0466968_0095180
1053 Ga0466968_0384666
1054 Ga0466968_0549058
1055 Ga0466970_0018115
1056 Ga0466970_0102041
1057 Ga0466970_0194392
1058 Ga0466970_0276184
1059 Ga0466970_0335509
1060 Ga0466970_0390699
1061 Ga0466957_0003271
1062 Ga0466957_0028194
1063 Ga0466957_0125642
1064 Ga0466957_0136710
1065 Ga0466957_0221912
1066 Ga0466957_0316329
1067 Ga0466957_0980372
1068 Ga0466959_0004119
1069 Ga0466959_0016430
1070 Ga0466959_0019955
1071 Ga0466959_0025104
1072 Ga0466959_0094087
1073 Ga0466959_0144245
1074 Ga0466959_1075967
1075 Ga0466958_0001555
1076 Ga0466958_0003521
1077 Ga0466958_0011736
1078 Ga0466958_0017886
1079 Ga0466958_0018699
1080 Ga0466958_0031742
1081 Ga0466958_0038889
1082 Ga0466958_0067801
1083 Ga0466958_0208757
1084 Ga0466958_0415346
1085 Ga0466958_0529183
1086 Ga0466967_0006740
1087 Ga0466967_0067369
1088 Ga0466967_0130608
1089 Ga0466967_0161164
1090 Ga0466967_0444134
1091 Ga0466967_0580723
1092 Ga0466967_0647561
1093 Ga0466967_0956581
1094 Ga0466967_1050158
1095 Ga0466967_1546145
1096 Ga0495617_159020
1097 Ga0495590_0211587
1098 Ga0495653_0068696
1099 Ga0495584_0343006
1100 Ga0495596_0023238
1101 Ga0495596_0237782
1102 Ga0495616_0174317
1103 Ga0495628_0381357
1104 Ga0495637_0132560
1105 Ga0495637_0155834
1106 Ga0495644_0447214
1107 Ga0495642_0180121
1108 Ga0495609_0265046
1109 Ga0495656_0275844
1110 Ga0495668_0322590
1111 Ga0495668_0378868
1112 Ga0495599_0098009
1113 Ga0495670_0265890
1114 Ga0495671_0547236
1115 Ga0495589_0379171
1116 Ga0495600_0041175
1117 Ga0495672_0009586
1118 Ga0495602_0036947
1119 Ga0495626_0338539
1120 Ga0496100_0020849
1121 Ga0496100_0231318
1122 Ga0496100_0464137
1123 Ga0496101_0004517
1124 Ga0496101_0124922
1125 Ga0496102_0031064
1126 Ga0496102_1246286
1127 Ga0496103_0204133
1128 Ga0496104_0350757
1129 Ga0496105_0493106
1130 Ga0496106_0032498
1131 Ga0496106_0164010
1132 Ga0496107_0096627
1133 Ga0496107_0181902
1134 Ga0496108_0027511
1135 Ga0496108_0041903
1136 Ga0496109_0006236
1137 Ga0496109_0252007
1138 Ga0496109_1788850
1139 Ga0496110_0294862
1140 Ga0496110_0338580
1141 Ga0496111_0138097
1142 Ga0496111_0540970
1143 Ga0496112_0030571
1144 Ga0496112_0082312
1145 Ga0496112_0347582
1146 Ga0496112_0903223
1147 Ga0496113_0029027
1148 Ga0496113_0364432
1149 Ga0496113_0470923
1150 Ga0496114_0149787
1151 Ga0496114_1251837
1152 Ga0496115_0253054
1153 Ga0496115_0774146
1154 Ga0501031_0106165
1155 Ga0501036_0054239
1156 Ga0501036_0414238
1157 Ga0501036_0772186
1158 Ga0501036_0820861
1159 Ga0501037_0548831
1160 Ga0501038_0136418
1161 Ga0501038_0199239
1162 Ga0501039_0064910
1163 Ga0501040_0052650
1164 Ga0501040_0315142
1165 Ga0501040_0350535
1166 Ga0501040_0566508
1167 Ga0501041_0052485
1168 Ga0501041_0361084
1169 Ga0501042_0196884
1170 Ga0501042_0335852
1171 Ga0501042_0424115
1172 Ga0501043_1294980
1173 Ga0501046_0154841
1174 Ga0501069_0590945
1175 Ga0501071_0278387
1176 Ga0501071_0282732
1177 Ga0501071_0294667
1178 Ga0501071_0608362
1179 Ga0501071_0655465
1180 Ga0501072_0089815
1181 Ga0501072_0098138
1182 Ga0501072_0196832
1183 Ga0501072_1035032
1184 Ga0501075_0117021
1185 Ga0501076_0043908
1186 Ga0501077_0221776
1187 Ga0501077_0370067
1188 Ga0501079_0138473
1189 Ga0501079_0280420
1190 Ga0501081_0030299
1191 Ga0501081_0147722
1192 Ga0501081_0520151
1193 Ga0501035_0445320
1194 Ga0501045_0031108
1195 Ga0501045_1061309
1196 nmdc:mga03n38_48729_c1
1197 nmdc:mga00v17_61235_c1
1198 nmdc:mga0yw44_147398_c1
1199 nmdc:mga0yw44_462423_c1
1200 nmdc:mga06z11_945667_c1
1201 nmdc:mga05p37_1140166_c1
1202 nmdc:mga05p37_368531_c1
1203 nmdc:mga05p37_421780_c1
1204 nmdc:mga05p37_43041_c1
1205 nmdc:mga05p37_601_c1
1206 nmdc:mga05p37_773602_c1
1207 nmdc:mga05p37_960287_c1
1208 nmdc:mga09592_1059182_c1
1209 nmdc:mga09592_1520233_c1
1210 nmdc:mga09592_17392_c1
1211 nmdc:mga09592_19631_c1
1212 nmdc:mga09592_305575_c1
1213 nmdc:mga09592_646698_c1
1214 nmdc:mga0qj67_10715_c1
1215 nmdc:mga0qj67_255855_c1
1216 nmdc:mga0qj67_356527_c1
1217 nmdc:mga0qj67_782599_c1
1218 nmdc:mga06r32_1268038_c1
1219 nmdc:mga06r32_13363_c1
1220 nmdc:mga06r32_1439901_c1
1221 nmdc:mga06r32_2073480_c1
1222 nmdc:mga06r32_4468_c1
1223 nmdc:mga06r32_793236_c1
1224 nmdc:mga06r32_974125_c1
1225 nmdc:mga08y16_1180940_c1
1226 nmdc:mga08y16_141222_c1
1227 nmdc:mga08y16_353437_c1
1228 nmdc:mga08y16_38207_c1
1229 nmdc:mga08y16_569235_c1
1230 nmdc:mga08y16_589708_c1
1231 nmdc:mga0n895_292937_c1
1232 nmdc:mga0n895_87299_c1
1233 nmdc:mga0rr50_67264_c1
1234 nmdc:mga08x19_157889_c1
1235 nmdc:mga08x19_71564_c1
1236 nmdc:mga0a205_157714_c1
1237 nmdc:mga0a205_57940_c1
1238 Ga0495601_0016045
1239 Ga0495601_0414472
1240 Ga0495655_0031342
1241 Ga0495595_0014266
1242 Ga0501084_0109752
1243 Ga0501084_0464487
1244 Ga0587088_065499
1245 Ga0501082_0011255
1246 Ga0501082_0112789
1247 Ga0501082_0347499
1248 Ga0466962_0019257
1249 Ga0466962_0034777
1250 Ga0466962_0115325
1251 Ga0466962_0234603
1252 Ga0466962_0334740
1253 Ga0466962_0374580
1254 Ga0530510_0215441
1255 Ga0530510_0313288
1256 Ga0530510_0971302
1257 Ga0530510_1152083
1258 Ga0530510_1499271

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map