F470705

General Info

Members Datasets Scaffolds Average Seq Length
629 217 1258 178

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10036428|Ga0065704_100364281
Length 199
Sequence MLEASAIERRAARIKLLLMDCDGVLTDGRIWLLANGDEEKGFHVHDGLGLDLWHRAGLRSGIISGRTSNVVAQRAKDLRIEFVSQGAENKVDVFLALLKEAGLDDSDVAYIGDDLNDIPVLLRAELAVAVADASEETRAAAHLITRAKGGHGAVREVIELILKSQGRWADVKEKYLKAGAVGXRQXVSEAVSSRQLIDS

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
166 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
167 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
177 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
178 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
190 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
191 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
192 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
193 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
194 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
195 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
196 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
197 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
198 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
199 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
200 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
201 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
202 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
205 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 0.95
Rhizosphere 97.77
Stem 0
Stem Tuber 0
Unclassified 16.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10036428 3300005289 Bacteria 867
2 MRS1b_contig_8454193 2162886011 Bacteria 993
3 JGI24751J29686_10000181 3300002459 Bacteria 28422
4 JGI25406J46586_10022961 3300003203 Bacteria 2473
5 Ga0065704_10018923 3300005289 Bacteria 1653
6 Ga0065704_10087543 3300005289 Bacteria 3017
7 Ga0065704_10095291 3300005289 Bacteria 2495
8 Ga0065712_10068508 3300005290 Bacteria 10188
9 Ga0065712_10137932 3300005290 Bacteria 1478
10 Ga0065715_10011762 3300005293 Bacteria 3595
11 Ga0065715_10065409 3300005293 Bacteria 861
12 Ga0065715_10099594 3300005293 Bacteria 3393
13 Ga0065715_10116890 3300005293 Bacteria 2359
14 Ga0065715_10188621 3300005293 Bacteria 1429
15 Ga0065715_10287262 3300005293 Unclassified 1072
16 Ga0065715_10469782 3300005293 Unclassified 782
17 Ga0065715_10509922 3300005293 Bacteria 772
18 Ga0065707_10030235 3300005295 Bacteria 1146
19 Ga0065707_10100829 3300005295 Bacteria 2902
20 Ga0065707_10318775 3300005295 Unclassified 970
21 Ga0070676_10173325 3300005328 Bacteria 1397
22 Ga0070676_10424913 3300005328 Unclassified 929
23 Ga0070690_100067537 3300005330 Bacteria 2317
24 Ga0070690_100142093 3300005330 Bacteria 1630
25 Ga0070690_100516724 3300005330 Unclassified 896
26 Ga0070670_100000680 3300005331 Bacteria 26419
27 Ga0070670_100874434 3300005331 Bacteria 814
28 Ga0068869_100213455 3300005334 Bacteria 1527
29 Ga0068869_100467594 3300005334 Unclassified 1048
30 Ga0068869_100763436 3300005334 Bacteria 829
31 Ga0070666_10037686 3300005335 Unclassified 3216
32 Ga0070666_10086239 3300005335 Bacteria 2151
33 Ga0068868_100342979 3300005338 Bacteria 1278
34 Ga0070689_100626943 3300005340 Bacteria 933
35 Ga0070689_101566462 3300005340 Bacteria 598
36 Ga0070687_100019763 3300005343 Bacteria 3139
37 Ga0070687_100096675 3300005343 Bacteria 1645
38 Ga0070692_10051263 3300005345 Bacteria 2146
39 Ga0070692_10190804 3300005345 Bacteria 1194
40 Ga0070668_100014196 3300005347 Bacteria 5950
41 Ga0070669_100045402 3300005353 Bacteria 3202
42 Ga0070669_100054235 3300005353 Bacteria 2936
43 Ga0070669_100510419 3300005353 Bacteria 998
44 Ga0070675_100091605 3300005354 Bacteria 2547
45 Ga0070675_100382228 3300005354 Bacteria 1253
46 Ga0070671_100001719 3300005355 Bacteria 16625
47 Ga0070674_100268786 3300005356 Bacteria 1347
48 Ga0070674_100380691 3300005356 Bacteria 1148
49 Ga0070673_100001735 3300005364 Bacteria 12975
50 Ga0070673_100458704 3300005364 Unclassified 1147
51 Ga0070673_100474136 3300005364 Bacteria 1129
52 Ga0070659_100057350 3300005366 Bacteria 3071
53 Ga0070659_100963171 3300005366 Unclassified 748
54 Ga0070659_100974805 3300005366 Unclassified 743
55 Ga0070703_10000098 3300005406 Bacteria 44872
56 Ga0070701_10166223 3300005438 Bacteria 1282
57 Ga0070705_100010909 3300005440 Bacteria 4564
58 Ga0070705_100040364 3300005440 Bacteria 2654
59 Ga0070705_100041634 3300005440 Bacteria 2620
60 Ga0070705_100070254 3300005440 Bacteria 2114
61 Ga0070700_100017593 3300005441 Bacteria 4093
62 Ga0070700_100164642 3300005441 Bacteria 1530
63 Ga0070694_100136858 3300005444 Bacteria 1775
64 Ga0070694_100182334 3300005444 Bacteria 1554
65 Ga0070694_100313887 3300005444 Bacteria 1205
66 Ga0070694_100316518 3300005444 Bacteria 1200
67 Ga0070694_101080224 3300005444 Unclassified 669
68 Ga0070708_100000893 3300005445 Bacteria 22576
69 Ga0070708_100166282 3300005445 Bacteria 2058
70 Ga0070708_100328547 3300005445 Bacteria 1441
71 Ga0070708_101430391 3300005445 Unclassified 645
72 Ga0070678_100012668 3300005456 Bacteria 5255
73 Ga0070678_100245229 3300005456 Bacteria 1500
74 Ga0070662_100058673 3300005457 Bacteria 2801
75 Ga0070662_100486212 3300005457 Bacteria 1028
76 Ga0070681_10044256 3300005458 Bacteria 4455
77 Ga0068867_100048668 3300005459 Bacteria 3120
78 Ga0068867_100433136 3300005459 Bacteria 1117
79 Ga0068867_101310810 3300005459 Unclassified 669
80 Ga0070685_10233555 3300005466 Bacteria 1211
81 Ga0070706_100041508 3300005467 Bacteria 4247
82 Ga0070706_100095578 3300005467 Bacteria 2758
83 Ga0070706_100390436 3300005467 Bacteria 1296
84 Ga0070707_100014768 3300005468 Bacteria 7321
85 Ga0070707_100113232 3300005468 Bacteria 2632
86 Ga0070707_100488617 3300005468 Bacteria 1193
87 Ga0070698_100001844 3300005471 Bacteria 23599
88 Ga0070698_100010832 3300005471 Bacteria 9703
89 Ga0070698_100011586 3300005471 Bacteria 9358
90 Ga0070698_100145654 3300005471 Bacteria 2318
91 Ga0070698_100304074 3300005471 Bacteria 1526
92 Ga0070698_100663685 3300005471 Bacteria 984
93 Ga0070698_101261094 3300005471 Bacteria 689
94 Ga0070699_100001784 3300005518 Bacteria 19592
95 Ga0070699_100009477 3300005518 Bacteria 8434
96 Ga0070699_100088858 3300005518 Bacteria 2699
97 Ga0070679_100001964 3300005530 Bacteria 18448
98 Ga0070679_100058042 3300005530 Bacteria 3857
99 Ga0070697_100000264 3300005536 Bacteria 42531
100 Ga0070697_100000430 3300005536 Bacteria 32197
101 Ga0070697_100022691 3300005536 Bacteria 4986
102 Ga0070697_100119685 3300005536 Bacteria 2202
103 Ga0070697_100478903 3300005536 Bacteria 1087
104 Ga0070697_101150462 3300005536 Bacteria 691
105 Ga0068853_100044996 3300005539 Bacteria 3780
106 Ga0068853_100193362 3300005539 Bacteria 1849
107 Ga0070672_100246927 3300005543 Bacteria 1503
108 Ga0070672_100634692 3300005543 Bacteria 932
109 Ga0070686_100027382 3300005544 Bacteria 3450
110 Ga0070686_100044372 3300005544 Unclassified 2794
111 Ga0070686_100094105 3300005544 Bacteria 2010
112 Ga0070695_100015460 3300005545 Bacteria 4610
113 Ga0070695_100059057 3300005545 Bacteria 2482
114 Ga0070695_100092534 3300005545 Bacteria 2021
115 Ga0070695_100358262 3300005545 Bacteria 1095
116 Ga0070695_100441827 3300005545 Bacteria 995
117 Ga0070695_100442378 3300005545 Bacteria 994
118 Ga0070695_100486912 3300005545 Unclassified 952
119 Ga0070696_100065242 3300005546 Bacteria 2552
120 Ga0070696_100070442 3300005546 Bacteria 2460
121 Ga0070696_100112404 3300005546 Bacteria 1963
122 Ga0070696_100228113 3300005546 Bacteria 1400
123 Ga0070696_100513064 3300005546 Unclassified 955
124 Ga0070693_100091371 3300005547 Bacteria 1836
125 Ga0070693_100120652 3300005547 Bacteria 1625
126 Ga0070704_100249610 3300005549 Bacteria 1457
127 Ga0070704_100259968 3300005549 Bacteria 1430
128 Ga0070704_100385012 3300005549 Bacteria 1193
129 Ga0070704_100611686 3300005549 Bacteria 959
130 Ga0070704_100643182 3300005549 Bacteria 936
131 Ga0070664_100001136 3300005564 Bacteria 21041
132 Ga0070664_100053289 3300005564 Bacteria 3428
133 Ga0070664_100164498 3300005564 Unclassified 1965
134 Ga0070664_100849838 3300005564 Bacteria 854
135 Ga0068857_100009089 3300005577 Bacteria 8621
136 Ga0068857_100110044 3300005577 Bacteria 2476
137 Ga0068857_100250803 3300005577 Bacteria 1622
138 Ga0068857_100482481 3300005577 Bacteria 1162
139 Ga0068857_100862051 3300005577 Bacteria 867
140 Ga0068857_101442780 3300005577 Unclassified 670
141 Ga0068854_100024065 3300005578 Bacteria 4166
142 Ga0068854_100133215 3300005578 Bacteria 1900
143 Ga0068854_100962683 3300005578 Bacteria 753
144 Ga0070702_100004267 3300005615 Bacteria 6510
145 Ga0070702_100021791 3300005615 Bacteria 3378
146 Ga0070702_100177179 3300005615 Bacteria 1392
147 Ga0070702_100203722 3300005615 Bacteria 1312
148 Ga0070702_100251795 3300005615 Bacteria 1198
149 Ga0068852_100746650 3300005616 Unclassified 991
150 Ga0068852_100941539 3300005616 Bacteria 882
151 Ga0068859_100006625 3300005617 Bacteria 11763
152 Ga0068859_100029987 3300005617 Bacteria 5457
153 Ga0068859_100055149 3300005617 Bacteria 3999
154 Ga0068859_100094510 3300005617 Unclassified 3042
155 Ga0068859_100193312 3300005617 Bacteria 2119
156 Ga0068859_100233407 3300005617 Bacteria 1928
157 Ga0068859_100262324 3300005617 Bacteria 1819
158 Ga0068859_100431829 3300005617 Bacteria 1414
159 Ga0068859_100633482 3300005617 Bacteria 1162
160 Ga0068859_100635697 3300005617 Bacteria 1159
161 Ga0068859_100959055 3300005617 Unclassified 938
162 Ga0068859_101105549 3300005617 Unclassified 872
163 Ga0068859_101440406 3300005617 Bacteria 760
164 Ga0068859_102023324 3300005617 Bacteria 636
165 Ga0068864_100015500 3300005618 Bacteria 6337
166 Ga0068864_100040459 3300005618 Bacteria 3988
167 Ga0068864_100042917 3300005618 Bacteria 3871
168 Ga0068864_100074473 3300005618 Unclassified 2962
169 Ga0068864_100267324 3300005618 Bacteria 1592
170 Ga0068864_100701254 3300005618 Bacteria 989
171 Ga0068864_101257625 3300005618 Unclassified 740
172 Ga0068864_101436755 3300005618 Bacteria 692
173 Ga0068866_10273978 3300005718 Bacteria 1043
174 Ga0068861_100037511 3300005719 Bacteria 3603
175 Ga0068861_100072352 3300005719 Bacteria 2675
176 Ga0068861_100087514 3300005719 Bacteria 2452
177 Ga0068861_100325140 3300005719 Unclassified 1340
178 Ga0068851_10037673 3300005834 Bacteria 2425
179 Ga0068870_10025028 3300005840 Unclassified 2960
180 Ga0068870_10304104 3300005840 Bacteria 1008
181 Ga0068863_100064200 3300005841 Bacteria 3473
182 Ga0068863_100087880 3300005841 Bacteria 2945
183 Ga0068863_100189064 3300005841 Bacteria 1979
184 Ga0068863_100595734 3300005841 Bacteria 1094
185 Ga0068863_100998349 3300005841 Bacteria 840
186 Ga0068858_100042733 3300005842 Bacteria 4202
187 Ga0068858_100047909 3300005842 Unclassified 3961
188 Ga0068858_100083761 3300005842 Bacteria 2966
189 Ga0068858_100139677 3300005842 Bacteria 2274
190 Ga0068858_100322909 3300005842 Bacteria 1476
191 Ga0068858_100378359 3300005842 Bacteria 1358
192 Ga0068858_100379155 3300005842 Bacteria 1357
193 Ga0068858_100911748 3300005842 Unclassified 859
194 Ga0068858_101343409 3300005842 Unclassified 704
195 Ga0068860_100019429 3300005843 Bacteria 6589
196 Ga0068860_100067447 3300005843 Bacteria 3399
197 Ga0068860_100097650 3300005843 Bacteria 2801
198 Ga0068860_100113529 3300005843 Bacteria 2590
199 Ga0068860_100211843 3300005843 Bacteria 1880
200 Ga0068860_100364726 3300005843 Bacteria 1424
201 Ga0068860_100738287 3300005843 Bacteria 996
202 Ga0068862_100096280 3300005844 Bacteria 2583
203 Ga0068862_100226425 3300005844 Bacteria 1695
204 Ga0068862_100898555 3300005844 Bacteria 871
205 Ga0081455_10015476 3300005937 Bacteria 7409
206 Ga0081455_10027254 3300005937 Bacteria 5236
207 Ga0081455_10404630 3300005937 Bacteria 946
208 Ga0081455_10418283 3300005937 Bacteria 925
209 Ga0081540_1049994 3300005983 Bacteria 2080
210 Ga0081539_10000145 3300005985 Bacteria 165008
211 Ga0081539_10000189 3300005985 Bacteria 143321
212 Ga0081539_10002748 3300005985 Bacteria 23704
213 Ga0070715_10000058 3300006163 Bacteria 40861
214 Ga0097621_100096758 3300006237 Bacteria 2477
215 Ga0097621_100140022 3300006237 Bacteria 2067
216 Ga0097621_100957122 3300006237 Bacteria 799
217 Ga0068871_100001457 3300006358 Bacteria 15836
218 Ga0068871_100042572 3300006358 Bacteria 3646
219 Ga0075428_100268993 3300006844 Bacteria 1834
220 Ga0075428_100535882 3300006844 Bacteria 1252
221 Ga0075430_100017502 3300006846 Bacteria 6105
222 Ga0075430_100445613 3300006846 Bacteria 1068
223 Ga0075431_100019986 3300006847 Bacteria 6838
224 Ga0075431_100195588 3300006847 Bacteria 2070
225 Ga0075431_100366443 3300006847 Unclassified 1447
226 Ga0075431_100444707 3300006847 Bacteria 1292
227 Ga0075431_100957076 3300006847 Bacteria 824
228 Ga0075433_10008561 3300006852 Bacteria 8161
229 Ga0075433_10011716 3300006852 Bacteria 7063
230 Ga0075433_10033275 3300006852 Bacteria 4417
231 Ga0075433_10051995 3300006852 Unclassified 3569
232 Ga0075433_10265870 3300006852 Bacteria 1520
233 Ga0075433_10271240 3300006852 Bacteria 1504
234 Ga0075433_11014687 3300006852 Unclassified 723
235 Ga0075434_100041450 3300006871 Bacteria 4561
236 Ga0075434_100148338 3300006871 Bacteria 2365
237 Ga0075434_100219765 3300006871 Bacteria 1920
238 Ga0075434_100355621 3300006871 Bacteria 1486
239 Ga0075434_100738367 3300006871 Bacteria 1001
240 Ga0075434_101110812 3300006871 Bacteria 804
241 Ga0075434_101304100 3300006871 Unclassified 737
242 Ga0075429_100142680 3300006880 Bacteria 2097
243 Ga0075429_100176925 3300006880 Bacteria 1869
244 Ga0075429_100334872 3300006880 Bacteria 1325
245 Ga0075429_101241381 3300006880 Unclassified 650
246 Ga0068865_100025807 3300006881 Bacteria 3870
247 Ga0068865_100125565 3300006881 Bacteria 1915
248 Ga0097620_100006625 3300006931 Bacteria 11763
249 Ga0097620_100010287 3300006931 Bacteria 9417
250 Ga0097620_100029987 3300006931 Bacteria 5457
251 Ga0097620_100055151 3300006931 Bacteria 3999
252 Ga0097620_100094510 3300006931 Unclassified 3042
253 Ga0097620_100193310 3300006931 Bacteria 2119
254 Ga0097620_100233377 3300006931 Bacteria 1928
255 Ga0097620_100262334 3300006931 Bacteria 1819
256 Ga0097620_100431808 3300006931 Bacteria 1414
257 Ga0097620_100633460 3300006931 Bacteria 1162
258 Ga0097620_100635734 3300006931 Bacteria 1159
259 Ga0097620_100959171 3300006931 Unclassified 938
260 Ga0097620_101105730 3300006931 Unclassified 872
261 Ga0097620_101440531 3300006931 Bacteria 760
262 Ga0097620_102023930 3300006931 Bacteria 636
263 Ga0075435_100663598 3300007076 Bacteria 905
264 Ga0105251_10236391 3300009011 Bacteria 823
265 Ga0105240_10118744 3300009093 Bacteria 3187
266 Ga0105240_11318407 3300009093 Bacteria 761
267 Ga0111539_10011208 3300009094 Bacteria 11267
268 Ga0111539_10033257 3300009094 Bacteria 6262
269 Ga0111539_10071060 3300009094 Bacteria 4107
270 Ga0111539_10977644 3300009094 Bacteria 984
271 Ga0111539_11154647 3300009094 Bacteria 900
272 Ga0105245_10076096 3300009098 Unclassified 3057
273 Ga0105245_10625070 3300009098 Bacteria 1105
274 Ga0105245_10857695 3300009098 Unclassified 948
275 Ga0105247_10002426 3300009101 Bacteria 12685
276 Ga0105247_10232586 3300009101 Bacteria 1252
277 Ga0105247_10313567 3300009101 Bacteria 1092
278 Ga0105247_10398023 3300009101 Bacteria 980
279 Ga0105247_10570373 3300009101 Bacteria 835
280 Ga0114129_10051306 3300009147 Bacteria 5792
281 Ga0114129_10055335 3300009147 Bacteria 5560
282 Ga0114129_10389655 3300009147 Bacteria 1838
283 Ga0114129_10594401 3300009147 Unclassified 1435
284 Ga0114129_10700327 3300009147 Bacteria 1302
285 Ga0114129_10813363 3300009147 Bacteria 1191
286 Ga0105243_10032550 3300009148 Bacteria 4029
287 Ga0105243_10333177 3300009148 Bacteria 1387
288 Ga0105243_10351113 3300009148 Bacteria 1354
289 Ga0105243_10360753 3300009148 Bacteria 1337
290 Ga0105243_10407370 3300009148 Unclassified 1265
291 Ga0105243_10762082 3300009148 Unclassified 950
292 Ga0105243_11127088 3300009148 Bacteria 794
293 Ga0105243_11174453 3300009148 Bacteria 779
294 Ga0105243_11396053 3300009148 Unclassified 721
295 Ga0105243_11973977 3300009148 Bacteria 617
296 Ga0105241_10151019 3300009174 Bacteria 1900
297 Ga0105241_10327512 3300009174 Bacteria 1323
298 Ga0105241_10346701 3300009174 Bacteria 1288
299 Ga0105241_10389045 3300009174 Bacteria 1220
300 Ga0105241_10691811 3300009174 Bacteria 930
301 Ga0105241_10728507 3300009174 Bacteria 907
302 Ga0105241_10978029 3300009174 Bacteria 790
303 Ga0105242_10035508 3300009176 Bacteria 3997
304 Ga0105242_10629236 3300009176 Bacteria 1041
305 Ga0105248_10044548 3300009177 Unclassified 4976
306 Ga0105248_10049151 3300009177 Bacteria 4731
307 Ga0105248_10056424 3300009177 Bacteria 4406
308 Ga0105248_10084979 3300009177 Bacteria 3561
309 Ga0105248_10214970 3300009177 Bacteria 2166
310 Ga0105248_10302826 3300009177 Bacteria 1800
311 Ga0105248_10322848 3300009177 Bacteria 1739
312 Ga0105248_10339586 3300009177 Bacteria 1691
313 Ga0105248_10387474 3300009177 Bacteria 1573
314 Ga0105237_10000829 3300009545 Bacteria 42345
315 Ga0105237_10037333 3300009545 Bacteria 4912
316 Ga0105237_10176877 3300009545 Unclassified 2134
317 Ga0105237_10695362 3300009545 Bacteria 1023
318 Ga0105238_10060163 3300009551 Bacteria 3804
319 Ga0105238_10622642 3300009551 Unclassified 1088
320 Ga0105249_10000025 3300009553 Bacteria 232713
321 Ga0105249_10004759 3300009553 Bacteria 11710
322 Ga0105249_10049257 3300009553 Bacteria 3842
323 Ga0105249_10173101 3300009553 Bacteria 2095
324 Ga0105249_10761965 3300009553 Bacteria 1030
325 Ga0105249_10776947 3300009553 Bacteria 1021
326 Ga0105249_10779691 3300009553 Bacteria 1019
327 Ga0105239_10151415 3300010375 Bacteria 2589
328 Ga0105239_10245563 3300010375 Bacteria 2010
329 Ga0105239_10382386 3300010375 Bacteria 1591
330 Ga0105239_11064585 3300010375 Bacteria 931
331 Ga0105246_10055772 3300011119 Bacteria 2729
332 Ga0105246_10120586 3300011119 Bacteria 1943
333 Ga0105246_10148038 3300011119 Bacteria 1774
334 Ga0105246_10413050 3300011119 Bacteria 1124
335 Ga0105246_10541216 3300011119 Unclassified 996
336 Ga0105246_10900578 3300011119 Unclassified 793
337 Ga0157371_10760742 3300013102 Bacteria 728
338 Ga0157374_10406473 3300013296 Bacteria 1359
339 Ga0157378_10010660 3300013297 Bacteria 8031
340 Ga0157378_10051210 3300013297 Bacteria 3674
341 Ga0157378_10082586 3300013297 Bacteria 2906
342 Ga0157378_10090248 3300013297 Bacteria 2785
343 Ga0157378_10630814 3300013297 Unclassified 1086
344 Ga0157378_11003964 3300013297 Bacteria 869
345 Ga0157378_11440660 3300013297 Unclassified 732
346 Ga0157378_11614674 3300013297 Unclassified 694
347 Ga0163162_10000002 3300013306 Bacteria 717331
348 Ga0163162_10010154 3300013306 Bacteria 9146
349 Ga0163162_10286534 3300013306 Bacteria 1779
350 Ga0163162_10380375 3300013306 Bacteria 1545
351 Ga0163162_10388865 3300013306 Unclassified 1528
352 Ga0163162_10585845 3300013306 Unclassified 1242
353 Ga0163162_10808973 3300013306 Bacteria 1054
354 Ga0163162_10879455 3300013306 Bacteria 1010
355 Ga0163162_11186021 3300013306 Bacteria 866
356 Ga0163162_11574635 3300013306 Unclassified 749
357 Ga0157372_10069357 3300013307 Bacteria 3965
358 Ga0157372_10293835 3300013307 Bacteria 1890
359 Ga0157372_10670533 3300013307 Bacteria 1207
360 Ga0157372_10811990 3300013307 Bacteria 1086
361 Ga0157375_10234972 3300013308 Bacteria 1992
362 Ga0157375_11123510 3300013308 Bacteria 920
363 Ga0163163_10001618 3300014325 Bacteria 18943
364 Ga0163163_10010168 3300014325 Bacteria 8445
365 Ga0163163_10023860 3300014325 Bacteria 5814
366 Ga0163163_10115758 3300014325 Bacteria 2712
367 Ga0163163_10156793 3300014325 Unclassified 2321
368 Ga0163163_10378333 3300014325 Bacteria 1473
369 Ga0163163_10736722 3300014325 Bacteria 1049
370 Ga0163163_10749586 3300014325 Bacteria 1040
371 Ga0157380_10004497 3300014326 Bacteria 9668
372 Ga0157380_10006214 3300014326 Bacteria 8388
373 Ga0157380_10025673 3300014326 Bacteria 4470
374 Ga0157380_10038715 3300014326 Unclassified 3704
375 Ga0157377_10062602 3300014745 Bacteria 2129
376 Ga0157377_10304981 3300014745 Bacteria 1052
377 Ga0157377_10532844 3300014745 Unclassified 826
378 Ga0157379_10043753 3300014968 Bacteria 3998
379 Ga0157379_10044575 3300014968 Bacteria 3959
380 Ga0157379_10900161 3300014968 Bacteria 839
381 Ga0157376_10038296 3300014969 Bacteria 3900
382 Ga0213876_10001968 3300021384 Bacteria 12299
383 Ga0213876_10021908 3300021384 Bacteria 3380
384 Ga0207656_10054327 3300025321 Bacteria 1741
385 Ga0207653_10000177 3300025885 Bacteria 44860
386 Ga0207653_10001144 3300025885 Bacteria 8696
387 Ga0207642_10299171 3300025899 Bacteria 932
388 Ga0207710_10000871 3300025900 Bacteria 16165
389 Ga0207680_10105883 3300025903 Bacteria 1815
390 Ga0207647_10019402 3300025904 Bacteria 4574
391 Ga0207647_10052774 3300025904 Bacteria 2508
392 Ga0207685_10000041 3300025905 Bacteria 57491
393 Ga0207645_10156611 3300025907 Bacteria 1488
394 Ga0207643_10112780 3300025908 Unclassified 1603
395 Ga0207684_10006541 3300025910 Bacteria 10615
396 Ga0207684_10033387 3300025910 Bacteria 4376
397 Ga0207684_10661501 3300025910 Bacteria 889
398 Ga0207654_10303489 3300025911 Bacteria 1086
399 Ga0207654_10424864 3300025911 Bacteria 928
400 Ga0207654_10449121 3300025911 Unclassified 904
401 Ga0207707_10016184 3300025912 Bacteria 6506
402 Ga0207707_10030238 3300025912 Bacteria 4738
403 Ga0207707_10352160 3300025912 Bacteria 1269
404 Ga0207671_10008214 3300025914 Bacteria 8890
405 Ga0207671_10340726 3300025914 Unclassified 1188
406 Ga0207660_10245782 3300025917 Bacteria 1411
407 Ga0207662_10018662 3300025918 Bacteria 3940
408 Ga0207646_10007290 3300025922 Bacteria 11268
409 Ga0207646_10603413 3300025922 Unclassified 985
410 Ga0207646_10714261 3300025922 Bacteria 896
411 Ga0207681_10000638 3300025923 Bacteria 23369
412 Ga0207681_10159810 3300025923 Bacteria 1697
413 Ga0207681_10220179 3300025923 Bacteria 1468
414 Ga0207681_10244589 3300025923 Bacteria 1398
415 Ga0207681_10666776 3300025923 Bacteria 863
416 Ga0207694_10002023 3300025924 Bacteria 16795
417 Ga0207694_10060590 3300025924 Bacteria 2946
418 Ga0207650_10000041 3300025925 Bacteria 197115
419 Ga0207650_10004761 3300025925 Bacteria 9270
420 Ga0207650_10762043 3300025925 Bacteria 819
421 Ga0207687_10035648 3300025927 Bacteria 3385
422 Ga0207687_10599584 3300025927 Bacteria 928
423 Ga0207644_10030532 3300025931 Bacteria 3749
424 Ga0207644_11010967 3300025931 Bacteria 698
425 Ga0207690_10024150 3300025932 Bacteria 3804
426 Ga0207706_10071016 3300025933 Bacteria 3062
427 Ga0207686_10000082 3300025934 Bacteria 79873
428 Ga0207686_10128924 3300025934 Bacteria 1732
429 Ga0207709_10000219 3300025935 Bacteria 72376
430 Ga0207709_10005273 3300025935 Bacteria 7350
431 Ga0207709_10220740 3300025935 Bacteria 1367
432 Ga0207709_10489851 3300025935 Unclassified 957
433 Ga0207709_11095246 3300025935 Unclassified 654
434 Ga0207670_10000378 3300025936 Bacteria 25624
435 Ga0207670_10022435 3300025936 Bacteria 3913
436 Ga0207669_10086991 3300025937 Bacteria 2023
437 Ga0207669_10474246 3300025937 Archaea 996
438 Ga0207704_10018112 3300025938 Bacteria 3669
439 Ga0207691_10008635 3300025940 Bacteria 9778
440 Ga0207691_10579616 3300025940 Bacteria 950
441 Ga0207711_10011396 3300025941 Bacteria 7389
442 Ga0207711_10134706 3300025941 Unclassified 2218
443 Ga0207711_10234157 3300025941 Bacteria 1683
444 Ga0207711_10870472 3300025941 Unclassified 838
445 Ga0207689_10008668 3300025942 Bacteria 8851
446 Ga0207689_10193452 3300025942 Bacteria 1678
447 Ga0207689_10234313 3300025942 Unclassified 1517
448 Ga0207689_10691433 3300025942 Bacteria 860
449 Ga0207689_10812690 3300025942 Bacteria 789
450 Ga0207689_10828377 3300025942 Unclassified 781
451 Ga0207679_10062943 3300025945 Bacteria 2767
452 Ga0207679_10116644 3300025945 Bacteria 2117
453 Ga0207651_10003153 3300025960 Bacteria 8044
454 Ga0207651_10008941 3300025960 Bacteria 5441
455 Ga0207651_10079288 3300025960 Unclassified 2359
456 Ga0207651_10296903 3300025960 Bacteria 1342
457 Ga0207651_10435710 3300025960 Unclassified 1122
458 Ga0207712_10000333 3300025961 Bacteria 43028
459 Ga0207712_10095737 3300025961 Bacteria 2196
460 Ga0207712_10369491 3300025961 Bacteria 1197
461 Ga0207712_10507856 3300025961 Bacteria 1031
462 Ga0207712_10660233 3300025961 Bacteria 909
463 Ga0207712_11111853 3300025961 Unclassified 704
464 Ga0207668_10032473 3300025972 Bacteria 3449
465 Ga0207640_10020605 3300025981 Bacteria 3917
466 Ga0207640_10375170 3300025981 Bacteria 1151
467 Ga0207640_10520814 3300025981 Bacteria 994
468 Ga0207703_10200495 3300026035 Bacteria 1773
469 Ga0207703_10274942 3300026035 Unclassified 1527
470 Ga0207703_10283442 3300026035 Bacteria 1506
471 Ga0207703_10330622 3300026035 Unclassified 1398
472 Ga0207703_10430636 3300026035 Bacteria 1229
473 Ga0207639_10140730 3300026041 Bacteria 2010
474 Ga0207639_10185992 3300026041 Bacteria 1771
475 Ga0207639_11372329 3300026041 Unclassified 663
476 Ga0207708_10021734 3300026075 Bacteria 4841
477 Ga0207708_10105185 3300026075 Bacteria 2187
478 Ga0207708_10275431 3300026075 Bacteria 1362
479 Ga0207708_10569364 3300026075 Bacteria 957
480 Ga0207641_10072352 3300026088 Bacteria 2969
481 Ga0207641_10560683 3300026088 Bacteria 1115
482 Ga0207641_10738436 3300026088 Bacteria 971
483 Ga0207641_10748907 3300026088 Bacteria 964
484 Ga0207648_10046741 3300026089 Bacteria 3795
485 Ga0207648_10166795 3300026089 Bacteria 1946
486 Ga0207648_10401183 3300026089 Bacteria 1243
487 Ga0207648_10483676 3300026089 Bacteria 1131
488 Ga0207676_10008762 3300026095 Bacteria 7197
489 Ga0207676_10010489 3300026095 Bacteria 6600
490 Ga0207676_10457515 3300026095 Unclassified 1204
491 Ga0207676_10947680 3300026095 Unclassified 846
492 Ga0207674_10002461 3300026116 Bacteria 23376
493 Ga0207674_10078894 3300026116 Bacteria 3297
494 Ga0207674_10089695 3300026116 Bacteria 3067
495 Ga0207674_10304801 3300026116 Bacteria 1542
496 Ga0207674_10338825 3300026116 Bacteria 1454
497 Ga0207674_10536152 3300026116 Bacteria 1131
498 Ga0207674_11059392 3300026116 Bacteria 780
499 Ga0207674_11269088 3300026116 Unclassified 706
500 Ga0207675_100005424 3300026118 Bacteria 12217
501 Ga0207675_100012571 3300026118 Bacteria 7907
502 Ga0207675_100026551 3300026118 Bacteria 5391
503 Ga0207675_100053479 3300026118 Bacteria 3767
504 Ga0207683_10062587 3300026121 Bacteria 3277
505 Ga0207683_10077910 3300026121 Bacteria 2936
506 Ga0207698_10482391 3300026142 Bacteria 1203
507 Ga0209971_1070382 3300027682 Unclassified 849
508 Ga0207428_10008064 3300027907 Bacteria 9553
509 Ga0207428_10025210 3300027907 Bacteria 4979
510 Ga0207428_10168168 3300027907 Bacteria 1661
511 Ga0207428_10871363 3300027907 Unclassified 637
512 Ga0268265_10082726 3300028380 Bacteria 2539
513 Ga0268265_10389220 3300028380 Bacteria 1285
514 Ga0268265_10593486 3300028380 Bacteria 1057
515 Ga0268265_11007900 3300028380 Unclassified 823
516 Ga0268265_11354066 3300028380 Unclassified 713
517 Ga0268264_10049576 3300028381 Bacteria 3494
518 Ga0268264_10080575 3300028381 Bacteria 2780
519 Ga0268264_10398311 3300028381 Bacteria 1322
520 Ga0268264_10628691 3300028381 Bacteria 1061
521 Ga0307513_10004416 3300031456 Bacteria 18779
522 Ga0307413_10013437 3300031824 Bacteria 4116
523 Ga0307413_10269347 3300031824 Bacteria 1274
524 Ga0307410_10018839 3300031852 Bacteria 4181
525 Ga0307410_10058773 3300031852 Bacteria 2623
526 Ga0307406_10509833 3300031901 Bacteria 977
527 Ga0307412_10734388 3300031911 Unclassified 851
528 Ga0307409_100059788 3300031995 Unclassified 2968
529 Ga0307416_100569729 3300032002 Bacteria 1208
530 Ga0307416_101387954 3300032002 Bacteria 808
531 Ga0307414_10246796 3300032004 Bacteria 1481
532 Ga0307411_10023463 3300032005 Bacteria 3655
533 Ga0307415_100249576 3300032126 Bacteria 1441
534 Ga0307415_100541344 3300032126 Unclassified 1026
535 Ga0373959_0020250 3300034820 Bacteria 1268
536 Ga0373940_0230227 3300035088 Bacteria 619
537 Ga0373942_0014977 3300035207 Bacteria 1883
538 Ga0373931_0670425 3300035691 Bacteria 683
539 Ga0395899_0257887 3300037312 Bacteria 1194
540 Ga0395900_0165134 3300037418 Unclassified 2257
541 Ga0395905_0012340 3300037471 Bacteria 8225
542 Ga0395905_0272768 3300037471 Bacteria 1578
543 Ga0395905_0866628 3300037471 Bacteria 806
544 Ga0436364_1554593 3300037853 Unclassified 1472
545 Ga0395901_0371621 3300038443 Bacteria 1473
546 Ga0395901_0639649 3300038443 Bacteria 1068
547 Ga0395901_1167912 3300038443 Unclassified 737
548 Ga0242422_01800 3300038699 Bacteria 1477
549 Ga0436365_0012893 3300039437 Bacteria 3380
550 Ga0436365_0740107 3300039437 Bacteria 83165
551 Ga0436365_1009534 3300039437 Bacteria 67843
552 Ga0439446_0112803 3300042156 Unclassified 869
553 Ga0439458_0002212 3300042157 Bacteria 4800
554 Ga0439434_0028057 3300042435 Bacteria 1704
555 Ga0439434_0255144 3300042435 Bacteria 600
556 Ga0451576_0832338 3300045051 Bacteria 969
557 Ga0495632_0007785 3300046519 Bacteria 6678
558 Ga0495640_0256820 3300046533 Bacteria 1093
559 Ga0495672_0054942 3300047320 Bacteria 2325
560 Ga0496102_0848195 3300048905 Unclassified 836
561 Ga0496102_1290043 3300048905 Bacteria 649
562 Ga0496106_0304087 3300048909 Bacteria 1279
563 Ga0496108_0106274 3300048911 Bacteria 2397
564 Ga0496109_0000171 3300048912 Bacteria 64203
565 Ga0496112_0155335 3300048915 Bacteria 2255
566 Ga0501074_0774361 3300049590 Unclassified 676
567 Ga0501198_063121 3300049649 Bacteria 684
568 Ga0501208_002000 3300049655 Bacteria 2059
569 Ga0501216_015835 3300049660 Unclassified 1275
570 Ga0501217_009935 3300049661 Bacteria 2077
571 Ga0501217_044187 3300049661 Unclassified 1144
572 Ga0501223_017737 3300049663 Bacteria 1404
573 Ga0501224_028822 3300049664 Bacteria 831
574 Ga0501227_005738 3300049665 Bacteria 2660
575 Ga0501227_131783 3300049665 Unclassified 681
576 Ga0501230_051300 3300049667 Bacteria 820
577 Ga0501233_030667 3300049668 Bacteria 1213
578 Ga0501233_083154 3300049668 Unclassified 827
579 Ga0501235_034490 3300049669 Unclassified 1148
580 Ga0501235_051031 3300049669 Bacteria 958
581 Ga0501240_009218 3300049673 Bacteria 1285
582 Ga0501249_095048 3300049679 Unclassified 710
583 Ga0501257_035077 3300049686 Bacteria 1219
584 Ga0501225_0022787 3300049705 Bacteria 1729
585 Ga0501081_0754259 3300049743 Bacteria 731
586 Ga0501283_069545 3300049779 Unclassified 647
587 Ga0501212_016843 3300049851 Unclassified 1101
588 nmdc:mga05p37_248089_c1 3300050507 Bacteria 2137
589 nmdc:mga05p37_311923_c1 3300050507 Bacteria 1864
590 nmdc:mga05p37_468703_c1 3300050507 Bacteria 1454
591 nmdc:mga05p37_479962_c1 3300050507 Bacteria 1432
592 nmdc:mga05p37_590800_c1 3300050507 Bacteria 1255
593 nmdc:mga05p37_733965_c1 3300050507 Bacteria 1091
594 nmdc:mga05p37_793361_c1 3300050507 Unclassified 1037
595 nmdc:mga09592_311318_c1 3300050508 Bacteria 1364
596 nmdc:mga09592_391213_c1 3300050508 Bacteria 1202
597 nmdc:mga09592_929649_c1 3300050508 Bacteria 730
598 nmdc:mga0qj67_1294903_c1 3300050509 Unclassified 565
599 nmdc:mga06r32_115087_c1 3300050510 Bacteria 2648
600 nmdc:mga06r32_182240_c1 3300050510 Bacteria 2086
601 nmdc:mga06r32_22460_c1 3300050510 Bacteria 5834
602 nmdc:mga06r32_51729_c1 3300050510 Bacteria 3932
603 nmdc:mga06r32_793966_c1 3300050510 Bacteria 908
604 nmdc:mga06r32_859339_c1 3300050510 Bacteria 865
605 nmdc:mga08y16_1221153_c1 3300050511 Unclassified 722
606 nmdc:mga08y16_20152_c1 3300050511 Bacteria 7038
607 nmdc:mga08y16_259724_c1 3300050511 Bacteria 1794
608 nmdc:mga08y16_366311_c1 3300050511 Bacteria 1479
609 nmdc:mga08y16_438331_c1 3300050511 Bacteria 1334
610 nmdc:mga0n895_152586_c1 3300050512 Bacteria 2341
611 nmdc:mga0n895_311668_c1 3300050512 Bacteria 1595
612 nmdc:mga0n895_444306_c1 3300050512 Bacteria 1310
613 nmdc:mga0n895_54427_c1 3300050512 Bacteria 3936
614 nmdc:mga0n895_726597_c1 3300050512 Bacteria 987
615 nmdc:mga0n895_761926_c1 3300050512 Bacteria 960
616 nmdc:mga0n895_771479_c1 3300050512 Unclassified 953
617 nmdc:mga0rr50_514615_c1 3300050513 Bacteria 1018
618 nmdc:mga0a205_11844_c2 3300050515 Bacteria 7428
619 nmdc:mga0a205_15063_c1 3300050515 Bacteria 7220
620 nmdc:mga0a205_19333_c1 3300050515 Bacteria 6421
621 nmdc:mga0a205_25226_c1 3300050515 Bacteria 5662
622 nmdc:mga0a205_264223_c1 3300050515 Bacteria 1598
623 nmdc:mga0a205_408264_c1 3300050515 Bacteria 1221
624 nmdc:mga0a205_811238_c1 3300050515 Unclassified 783
625 Ga0500616_0001009 3300053153 Bacteria 30168
626 Ga0501084_0114637 3300054114 Bacteria 2266
627 Ga0501084_0153246 3300054114 Bacteria 1943
628 Ga0501082_1008711 3300060353 Unclassified 728
629 Ga0530510_0300190 3300061734 Bacteria 1202
630 Ga0065704_10036428
631 MRS1b_contig_8454193
632 JGI24751J29686_10000181
633 JGI25406J46586_10022961
634 Ga0065704_10018923
635 Ga0065704_10087543
636 Ga0065704_10095291
637 Ga0065712_10068508
638 Ga0065712_10137932
639 Ga0065715_10011762
640 Ga0065715_10065409
641 Ga0065715_10099594
642 Ga0065715_10116890
643 Ga0065715_10188621
644 Ga0065715_10287262
645 Ga0065715_10469782
646 Ga0065715_10509922
647 Ga0065707_10030235
648 Ga0065707_10100829
649 Ga0065707_10318775
650 Ga0070676_10173325
651 Ga0070676_10424913
652 Ga0070690_100067537
653 Ga0070690_100142093
654 Ga0070690_100516724
655 Ga0070670_100000680
656 Ga0070670_100874434
657 Ga0068869_100213455
658 Ga0068869_100467594
659 Ga0068869_100763436
660 Ga0070666_10037686
661 Ga0070666_10086239
662 Ga0068868_100342979
663 Ga0070689_100626943
664 Ga0070689_101566462
665 Ga0070687_100019763
666 Ga0070687_100096675
667 Ga0070692_10051263
668 Ga0070692_10190804
669 Ga0070668_100014196
670 Ga0070669_100045402
671 Ga0070669_100054235
672 Ga0070669_100510419
673 Ga0070675_100091605
674 Ga0070675_100382228
675 Ga0070671_100001719
676 Ga0070674_100268786
677 Ga0070674_100380691
678 Ga0070673_100001735
679 Ga0070673_100458704
680 Ga0070673_100474136
681 Ga0070659_100057350
682 Ga0070659_100963171
683 Ga0070659_100974805
684 Ga0070703_10000098
685 Ga0070701_10166223
686 Ga0070705_100010909
687 Ga0070705_100040364
688 Ga0070705_100041634
689 Ga0070705_100070254
690 Ga0070700_100017593
691 Ga0070700_100164642
692 Ga0070694_100136858
693 Ga0070694_100182334
694 Ga0070694_100313887
695 Ga0070694_100316518
696 Ga0070694_101080224
697 Ga0070708_100000893
698 Ga0070708_100166282
699 Ga0070708_100328547
700 Ga0070708_101430391
701 Ga0070678_100012668
702 Ga0070678_100245229
703 Ga0070662_100058673
704 Ga0070662_100486212
705 Ga0070681_10044256
706 Ga0068867_100048668
707 Ga0068867_100433136
708 Ga0068867_101310810
709 Ga0070685_10233555
710 Ga0070706_100041508
711 Ga0070706_100095578
712 Ga0070706_100390436
713 Ga0070707_100014768
714 Ga0070707_100113232
715 Ga0070707_100488617
716 Ga0070698_100001844
717 Ga0070698_100010832
718 Ga0070698_100011586
719 Ga0070698_100145654
720 Ga0070698_100304074
721 Ga0070698_100663685
722 Ga0070698_101261094
723 Ga0070699_100001784
724 Ga0070699_100009477
725 Ga0070699_100088858
726 Ga0070679_100001964
727 Ga0070679_100058042
728 Ga0070697_100000264
729 Ga0070697_100000430
730 Ga0070697_100022691
731 Ga0070697_100119685
732 Ga0070697_100478903
733 Ga0070697_101150462
734 Ga0068853_100044996
735 Ga0068853_100193362
736 Ga0070672_100246927
737 Ga0070672_100634692
738 Ga0070686_100027382
739 Ga0070686_100044372
740 Ga0070686_100094105
741 Ga0070695_100015460
742 Ga0070695_100059057
743 Ga0070695_100092534
744 Ga0070695_100358262
745 Ga0070695_100441827
746 Ga0070695_100442378
747 Ga0070695_100486912
748 Ga0070696_100065242
749 Ga0070696_100070442
750 Ga0070696_100112404
751 Ga0070696_100228113
752 Ga0070696_100513064
753 Ga0070693_100091371
754 Ga0070693_100120652
755 Ga0070704_100249610
756 Ga0070704_100259968
757 Ga0070704_100385012
758 Ga0070704_100611686
759 Ga0070704_100643182
760 Ga0070664_100001136
761 Ga0070664_100053289
762 Ga0070664_100164498
763 Ga0070664_100849838
764 Ga0068857_100009089
765 Ga0068857_100110044
766 Ga0068857_100250803
767 Ga0068857_100482481
768 Ga0068857_100862051
769 Ga0068857_101442780
770 Ga0068854_100024065
771 Ga0068854_100133215
772 Ga0068854_100962683
773 Ga0070702_100004267
774 Ga0070702_100021791
775 Ga0070702_100177179
776 Ga0070702_100203722
777 Ga0070702_100251795
778 Ga0068852_100746650
779 Ga0068852_100941539
780 Ga0068859_100006625
781 Ga0068859_100029987
782 Ga0068859_100055149
783 Ga0068859_100094510
784 Ga0068859_100193312
785 Ga0068859_100233407
786 Ga0068859_100262324
787 Ga0068859_100431829
788 Ga0068859_100633482
789 Ga0068859_100635697
790 Ga0068859_100959055
791 Ga0068859_101105549
792 Ga0068859_101440406
793 Ga0068859_102023324
794 Ga0068864_100015500
795 Ga0068864_100040459
796 Ga0068864_100042917
797 Ga0068864_100074473
798 Ga0068864_100267324
799 Ga0068864_100701254
800 Ga0068864_101257625
801 Ga0068864_101436755
802 Ga0068866_10273978
803 Ga0068861_100037511
804 Ga0068861_100072352
805 Ga0068861_100087514
806 Ga0068861_100325140
807 Ga0068851_10037673
808 Ga0068870_10025028
809 Ga0068870_10304104
810 Ga0068863_100064200
811 Ga0068863_100087880
812 Ga0068863_100189064
813 Ga0068863_100595734
814 Ga0068863_100998349
815 Ga0068858_100042733
816 Ga0068858_100047909
817 Ga0068858_100083761
818 Ga0068858_100139677
819 Ga0068858_100322909
820 Ga0068858_100378359
821 Ga0068858_100379155
822 Ga0068858_100911748
823 Ga0068858_101343409
824 Ga0068860_100019429
825 Ga0068860_100067447
826 Ga0068860_100097650
827 Ga0068860_100113529
828 Ga0068860_100211843
829 Ga0068860_100364726
830 Ga0068860_100738287
831 Ga0068862_100096280
832 Ga0068862_100226425
833 Ga0068862_100898555
834 Ga0081455_10015476
835 Ga0081455_10027254
836 Ga0081455_10404630
837 Ga0081455_10418283
838 Ga0081540_1049994
839 Ga0081539_10000145
840 Ga0081539_10000189
841 Ga0081539_10002748
842 Ga0070715_10000058
843 Ga0097621_100096758
844 Ga0097621_100140022
845 Ga0097621_100957122
846 Ga0068871_100001457
847 Ga0068871_100042572
848 Ga0075428_100268993
849 Ga0075428_100535882
850 Ga0075430_100017502
851 Ga0075430_100445613
852 Ga0075431_100019986
853 Ga0075431_100195588
854 Ga0075431_100366443
855 Ga0075431_100444707
856 Ga0075431_100957076
857 Ga0075433_10008561
858 Ga0075433_10011716
859 Ga0075433_10033275
860 Ga0075433_10051995
861 Ga0075433_10265870
862 Ga0075433_10271240
863 Ga0075433_11014687
864 Ga0075434_100041450
865 Ga0075434_100148338
866 Ga0075434_100219765
867 Ga0075434_100355621
868 Ga0075434_100738367
869 Ga0075434_101110812
870 Ga0075434_101304100
871 Ga0075429_100142680
872 Ga0075429_100176925
873 Ga0075429_100334872
874 Ga0075429_101241381
875 Ga0068865_100025807
876 Ga0068865_100125565
877 Ga0097620_100006625
878 Ga0097620_100010287
879 Ga0097620_100029987
880 Ga0097620_100055151
881 Ga0097620_100094510
882 Ga0097620_100193310
883 Ga0097620_100233377
884 Ga0097620_100262334
885 Ga0097620_100431808
886 Ga0097620_100633460
887 Ga0097620_100635734
888 Ga0097620_100959171
889 Ga0097620_101105730
890 Ga0097620_101440531
891 Ga0097620_102023930
892 Ga0075435_100663598
893 Ga0105251_10236391
894 Ga0105240_10118744
895 Ga0105240_11318407
896 Ga0111539_10011208
897 Ga0111539_10033257
898 Ga0111539_10071060
899 Ga0111539_10977644
900 Ga0111539_11154647
901 Ga0105245_10076096
902 Ga0105245_10625070
903 Ga0105245_10857695
904 Ga0105247_10002426
905 Ga0105247_10232586
906 Ga0105247_10313567
907 Ga0105247_10398023
908 Ga0105247_10570373
909 Ga0114129_10051306
910 Ga0114129_10055335
911 Ga0114129_10389655
912 Ga0114129_10594401
913 Ga0114129_10700327
914 Ga0114129_10813363
915 Ga0105243_10032550
916 Ga0105243_10333177
917 Ga0105243_10351113
918 Ga0105243_10360753
919 Ga0105243_10407370
920 Ga0105243_10762082
921 Ga0105243_11127088
922 Ga0105243_11174453
923 Ga0105243_11396053
924 Ga0105243_11973977
925 Ga0105241_10151019
926 Ga0105241_10327512
927 Ga0105241_10346701
928 Ga0105241_10389045
929 Ga0105241_10691811
930 Ga0105241_10728507
931 Ga0105241_10978029
932 Ga0105242_10035508
933 Ga0105242_10629236
934 Ga0105248_10044548
935 Ga0105248_10049151
936 Ga0105248_10056424
937 Ga0105248_10084979
938 Ga0105248_10214970
939 Ga0105248_10302826
940 Ga0105248_10322848
941 Ga0105248_10339586
942 Ga0105248_10387474
943 Ga0105237_10000829
944 Ga0105237_10037333
945 Ga0105237_10176877
946 Ga0105237_10695362
947 Ga0105238_10060163
948 Ga0105238_10622642
949 Ga0105249_10000025
950 Ga0105249_10004759
951 Ga0105249_10049257
952 Ga0105249_10173101
953 Ga0105249_10761965
954 Ga0105249_10776947
955 Ga0105249_10779691
956 Ga0105239_10151415
957 Ga0105239_10245563
958 Ga0105239_10382386
959 Ga0105239_11064585
960 Ga0105246_10055772
961 Ga0105246_10120586
962 Ga0105246_10148038
963 Ga0105246_10413050
964 Ga0105246_10541216
965 Ga0105246_10900578
966 Ga0157371_10760742
967 Ga0157374_10406473
968 Ga0157378_10010660
969 Ga0157378_10051210
970 Ga0157378_10082586
971 Ga0157378_10090248
972 Ga0157378_10630814
973 Ga0157378_11003964
974 Ga0157378_11440660
975 Ga0157378_11614674
976 Ga0163162_10000002
977 Ga0163162_10010154
978 Ga0163162_10286534
979 Ga0163162_10380375
980 Ga0163162_10388865
981 Ga0163162_10585845
982 Ga0163162_10808973
983 Ga0163162_10879455
984 Ga0163162_11186021
985 Ga0163162_11574635
986 Ga0157372_10069357
987 Ga0157372_10293835
988 Ga0157372_10670533
989 Ga0157372_10811990
990 Ga0157375_10234972
991 Ga0157375_11123510
992 Ga0163163_10001618
993 Ga0163163_10010168
994 Ga0163163_10023860
995 Ga0163163_10115758
996 Ga0163163_10156793
997 Ga0163163_10378333
998 Ga0163163_10736722
999 Ga0163163_10749586
1000 Ga0157380_10004497
1001 Ga0157380_10006214
1002 Ga0157380_10025673
1003 Ga0157380_10038715
1004 Ga0157377_10062602
1005 Ga0157377_10304981
1006 Ga0157377_10532844
1007 Ga0157379_10043753
1008 Ga0157379_10044575
1009 Ga0157379_10900161
1010 Ga0157376_10038296
1011 Ga0213876_10001968
1012 Ga0213876_10021908
1013 Ga0207656_10054327
1014 Ga0207653_10000177
1015 Ga0207653_10001144
1016 Ga0207642_10299171
1017 Ga0207710_10000871
1018 Ga0207680_10105883
1019 Ga0207647_10019402
1020 Ga0207647_10052774
1021 Ga0207685_10000041
1022 Ga0207645_10156611
1023 Ga0207643_10112780
1024 Ga0207684_10006541
1025 Ga0207684_10033387
1026 Ga0207684_10661501
1027 Ga0207654_10303489
1028 Ga0207654_10424864
1029 Ga0207654_10449121
1030 Ga0207707_10016184
1031 Ga0207707_10030238
1032 Ga0207707_10352160
1033 Ga0207671_10008214
1034 Ga0207671_10340726
1035 Ga0207660_10245782
1036 Ga0207662_10018662
1037 Ga0207646_10007290
1038 Ga0207646_10603413
1039 Ga0207646_10714261
1040 Ga0207681_10000638
1041 Ga0207681_10159810
1042 Ga0207681_10220179
1043 Ga0207681_10244589
1044 Ga0207681_10666776
1045 Ga0207694_10002023
1046 Ga0207694_10060590
1047 Ga0207650_10000041
1048 Ga0207650_10004761
1049 Ga0207650_10762043
1050 Ga0207687_10035648
1051 Ga0207687_10599584
1052 Ga0207644_10030532
1053 Ga0207644_11010967
1054 Ga0207690_10024150
1055 Ga0207706_10071016
1056 Ga0207686_10000082
1057 Ga0207686_10128924
1058 Ga0207709_10000219
1059 Ga0207709_10005273
1060 Ga0207709_10220740
1061 Ga0207709_10489851
1062 Ga0207709_11095246
1063 Ga0207670_10000378
1064 Ga0207670_10022435
1065 Ga0207669_10086991
1066 Ga0207669_10474246
1067 Ga0207704_10018112
1068 Ga0207691_10008635
1069 Ga0207691_10579616
1070 Ga0207711_10011396
1071 Ga0207711_10134706
1072 Ga0207711_10234157
1073 Ga0207711_10870472
1074 Ga0207689_10008668
1075 Ga0207689_10193452
1076 Ga0207689_10234313
1077 Ga0207689_10691433
1078 Ga0207689_10812690
1079 Ga0207689_10828377
1080 Ga0207679_10062943
1081 Ga0207679_10116644
1082 Ga0207651_10003153
1083 Ga0207651_10008941
1084 Ga0207651_10079288
1085 Ga0207651_10296903
1086 Ga0207651_10435710
1087 Ga0207712_10000333
1088 Ga0207712_10095737
1089 Ga0207712_10369491
1090 Ga0207712_10507856
1091 Ga0207712_10660233
1092 Ga0207712_11111853
1093 Ga0207668_10032473
1094 Ga0207640_10020605
1095 Ga0207640_10375170
1096 Ga0207640_10520814
1097 Ga0207703_10200495
1098 Ga0207703_10274942
1099 Ga0207703_10283442
1100 Ga0207703_10330622
1101 Ga0207703_10430636
1102 Ga0207639_10140730
1103 Ga0207639_10185992
1104 Ga0207639_11372329
1105 Ga0207708_10021734
1106 Ga0207708_10105185
1107 Ga0207708_10275431
1108 Ga0207708_10569364
1109 Ga0207641_10072352
1110 Ga0207641_10560683
1111 Ga0207641_10738436
1112 Ga0207641_10748907
1113 Ga0207648_10046741
1114 Ga0207648_10166795
1115 Ga0207648_10401183
1116 Ga0207648_10483676
1117 Ga0207676_10008762
1118 Ga0207676_10010489
1119 Ga0207676_10457515
1120 Ga0207676_10947680
1121 Ga0207674_10002461
1122 Ga0207674_10078894
1123 Ga0207674_10089695
1124 Ga0207674_10304801
1125 Ga0207674_10338825
1126 Ga0207674_10536152
1127 Ga0207674_11059392
1128 Ga0207674_11269088
1129 Ga0207675_100005424
1130 Ga0207675_100012571
1131 Ga0207675_100026551
1132 Ga0207675_100053479
1133 Ga0207683_10062587
1134 Ga0207683_10077910
1135 Ga0207698_10482391
1136 Ga0209971_1070382
1137 Ga0207428_10008064
1138 Ga0207428_10025210
1139 Ga0207428_10168168
1140 Ga0207428_10871363
1141 Ga0268265_10082726
1142 Ga0268265_10389220
1143 Ga0268265_10593486
1144 Ga0268265_11007900
1145 Ga0268265_11354066
1146 Ga0268264_10049576
1147 Ga0268264_10080575
1148 Ga0268264_10398311
1149 Ga0268264_10628691
1150 Ga0307513_10004416
1151 Ga0307413_10013437
1152 Ga0307413_10269347
1153 Ga0307410_10018839
1154 Ga0307410_10058773
1155 Ga0307406_10509833
1156 Ga0307412_10734388
1157 Ga0307409_100059788
1158 Ga0307416_100569729
1159 Ga0307416_101387954
1160 Ga0307414_10246796
1161 Ga0307411_10023463
1162 Ga0307415_100249576
1163 Ga0307415_100541344
1164 Ga0373959_0020250
1165 Ga0373940_0230227
1166 Ga0373942_0014977
1167 Ga0373931_0670425
1168 Ga0395899_0257887
1169 Ga0395900_0165134
1170 Ga0395905_0012340
1171 Ga0395905_0272768
1172 Ga0395905_0866628
1173 Ga0436364_1554593
1174 Ga0395901_0371621
1175 Ga0395901_0639649
1176 Ga0395901_1167912
1177 Ga0242422_01800
1178 Ga0436365_0012893
1179 Ga0436365_0740107
1180 Ga0436365_1009534
1181 Ga0439446_0112803
1182 Ga0439458_0002212
1183 Ga0439434_0028057
1184 Ga0439434_0255144
1185 Ga0451576_0832338
1186 Ga0495632_0007785
1187 Ga0495640_0256820
1188 Ga0495672_0054942
1189 Ga0496102_0848195
1190 Ga0496102_1290043
1191 Ga0496106_0304087
1192 Ga0496108_0106274
1193 Ga0496109_0000171
1194 Ga0496112_0155335
1195 Ga0501074_0774361
1196 Ga0501198_063121
1197 Ga0501208_002000
1198 Ga0501216_015835
1199 Ga0501217_009935
1200 Ga0501217_044187
1201 Ga0501223_017737
1202 Ga0501224_028822
1203 Ga0501227_005738
1204 Ga0501227_131783
1205 Ga0501230_051300
1206 Ga0501233_030667
1207 Ga0501233_083154
1208 Ga0501235_034490
1209 Ga0501235_051031
1210 Ga0501240_009218
1211 Ga0501249_095048
1212 Ga0501257_035077
1213 Ga0501225_0022787
1214 Ga0501081_0754259
1215 Ga0501283_069545
1216 Ga0501212_016843
1217 nmdc:mga05p37_248089_c1
1218 nmdc:mga05p37_311923_c1
1219 nmdc:mga05p37_468703_c1
1220 nmdc:mga05p37_479962_c1
1221 nmdc:mga05p37_590800_c1
1222 nmdc:mga05p37_733965_c1
1223 nmdc:mga05p37_793361_c1
1224 nmdc:mga09592_311318_c1
1225 nmdc:mga09592_391213_c1
1226 nmdc:mga09592_929649_c1
1227 nmdc:mga0qj67_1294903_c1
1228 nmdc:mga06r32_115087_c1
1229 nmdc:mga06r32_182240_c1
1230 nmdc:mga06r32_22460_c1
1231 nmdc:mga06r32_51729_c1
1232 nmdc:mga06r32_793966_c1
1233 nmdc:mga06r32_859339_c1
1234 nmdc:mga08y16_1221153_c1
1235 nmdc:mga08y16_20152_c1
1236 nmdc:mga08y16_259724_c1
1237 nmdc:mga08y16_366311_c1
1238 nmdc:mga08y16_438331_c1
1239 nmdc:mga0n895_152586_c1
1240 nmdc:mga0n895_311668_c1
1241 nmdc:mga0n895_444306_c1
1242 nmdc:mga0n895_54427_c1
1243 nmdc:mga0n895_726597_c1
1244 nmdc:mga0n895_761926_c1
1245 nmdc:mga0n895_771479_c1
1246 nmdc:mga0rr50_514615_c1
1247 nmdc:mga0a205_11844_c2
1248 nmdc:mga0a205_15063_c1
1249 nmdc:mga0a205_19333_c1
1250 nmdc:mga0a205_25226_c1
1251 nmdc:mga0a205_264223_c1
1252 nmdc:mga0a205_408264_c1
1253 nmdc:mga0a205_811238_c1
1254 Ga0500616_0001009
1255 Ga0501084_0114637
1256 Ga0501084_0153246
1257 Ga0501082_1008711
1258 Ga0530510_0300190

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08282

Hydrolase_3

haloacid dehalogenase-like hydrolase

62

158

0.86

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

48

125

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ij5-assembly1.cif.gz_A 1.95 angstrom resolution crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from yersinia pestis 0.9806 3 170
3nrj-assembly3.cif.gz_I crystal structure of probable yrbi family phosphatase from pseudomonas syringae pv.phaseolica 1448a complexed with magnesium 0.9735 5 177
3hyc-assembly3.cif.gz_E crystal structure of e. coli phosphatase yrbi, with mg, tetragonal form 0.9731 2 170
3n07-assembly1.cif.gz_A-1 structure of putative 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from vibrio cholerae 0.9683 3 167
2p9j-assembly1.cif.gz_D crystal structure of aq2171 from aquifex aeolicus 0.9678 7 166
ID Description Score Start End Superfamily
3ij5D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9761 3 170 3.40.50.1000
4um7A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9684 5 175 3.40.50.1000
4navA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9551 1 177 3.40.50.1000
4hgnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9429 10 168 3.40.50.1000
af_P06685_706_1023_1.20.1110.10 Mainly Alpha;Up-down Bundle;Calcium-transporting ATPase, transmembrane domain;Calcium-transporting ATPase, transmembrane domain 0.9416 108 144 1.20.1110.10
ID Description Score Start End GO Terms
AF-A0A2H5VZP5-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) 0.9917 3 176 GO:0008781
GO:0009103
GO:0019143
GO:0046872
AF-A0A1G1KIZ4-F1-model_v4 Phenylphosphate carboxylase subunit delta 0.9897 45 177 GO:0008781
GO:0009103
GO:0016788
GO:0046872
AF-A0A523EBF3-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) (KDO 8-P phosphatase) 0.9892 3 177 GO:0008781
GO:0009103
GO:0016788
GO:0046872
AF-A0A4U8YSB7-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) (KDO 8-P phosphatase) 0.988 8 177 GO:0008781
GO:0009103
GO:0019143
GO:0046872
AF-A0A2M7FJF4-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) (KDO 8-P phosphatase) 0.9856 62 177 GO:0008781
GO:0009103
GO:0019143

Map