F470703

General Info

Members Datasets Scaffolds Average Seq Length
629 221 1242 251

Family's Representative Sequence

Representative Sequence 3300001977|JGI24746J21847_1000548|JGI24746J21847_10005484
Length 259
Sequence LDIAAADLVTIGLLVVLEGLLSADNALVMAIMVLGLPRRDHQKALRYGLLGGFAFRAAATALAAYLIQVGWVKVLGGVYLLYLTYSHFWGREEEGEDRHQAPKAKGMLGLSPFWATVVRVEVINLAFSIDSILVAVAMSPKLWVVIIGGILGIVAMRLVAGRLIALVQRXPPLVDGAFIIIAWVGVKLCLEYLHDTDIIGLEIPRWLSLGLVVVIFLIALIYAKMQGAVEAGDALTEECESMLAGEDNLVPKVDPDATK

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
157 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
161 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
162 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
167 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
168 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
169 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
201 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 0.48
Rhizosphere 98.73
Stem 0
Stem Tuber 0
Unclassified 11.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000548 3300001977 Bacteria 5652
2 JGI25406J46586_10000102 3300003203 Bacteria 37824
3 rootH1_10012193 3300003316 Bacteria 1210
4 Ga0065714_10114844 3300005288 Bacteria 1389
5 Ga0065704_10019942 3300005289 Bacteria 1437
6 Ga0065712_10072891 3300005290 Bacteria 4578
7 Ga0065712_10164792 3300005290 Bacteria 1279
8 Ga0065715_10114422 3300005293 Unclassified 2444
9 Ga0065707_10006174 3300005295 Bacteria 3789
10 Ga0065707_10008070 3300005295 Bacteria 2903
11 Ga0065707_10041987 3300005295 Bacteria 1198
12 Ga0065707_10099207 3300005295 Bacteria 3024
13 Ga0065707_10220833 3300005295 Bacteria 1225
14 Ga0070658_10700273 3300005327 Bacteria 879
15 Ga0070676_10001876 3300005328 Bacteria 10691
16 Ga0070676_10148970 3300005328 Bacteria 1496
17 Ga0070676_10157483 3300005328 Bacteria 1459
18 Ga0070690_100023097 3300005330 Bacteria 3812
19 Ga0070690_100209133 3300005330 Bacteria 1361
20 Ga0070690_100349028 3300005330 Bacteria 1073
21 Ga0070690_100429974 3300005330 Bacteria 975
22 Ga0070670_100012270 3300005331 Bacteria 7333
23 Ga0070670_100106578 3300005331 Bacteria 2415
24 Ga0070670_100317497 3300005331 Bacteria 1364
25 Ga0070670_100335361 3300005331 Archaea 1327
26 Ga0070677_10004226 3300005333 Bacteria 4680
27 Ga0070677_10043198 3300005333 Bacteria 1789
28 Ga0070677_10062912 3300005333 Bacteria 1536
29 Ga0070677_10086432 3300005333 Bacteria 1355
30 Ga0070677_10118048 3300005333 Bacteria 1194
31 Ga0070677_10148555 3300005333 Bacteria 1088
32 Ga0068869_100004898 3300005334 Bacteria 8377
33 Ga0068869_100007556 3300005334 Bacteria 6956
34 Ga0070666_10015486 3300005335 Bacteria 4865
35 Ga0070666_10024195 3300005335 Bacteria 3955
36 Ga0068868_100020829 3300005338 Bacteria 4934
37 Ga0068868_100089008 3300005338 Bacteria 2485
38 Ga0070689_100006452 3300005340 Bacteria 8118
39 Ga0070689_100183765 3300005340 Bacteria 1700
40 Ga0070689_100400097 3300005340 Unclassified 1161
41 Ga0070689_100422656 3300005340 Unclassified 1130
42 Ga0070689_100545370 3300005340 Bacteria 998
43 Ga0070687_100009442 3300005343 Bacteria 4181
44 Ga0070687_100174472 3300005343 Bacteria 1282
45 Ga0070661_100085893 3300005344 Unclassified 2325
46 Ga0070692_10127801 3300005345 Unclassified 1425
47 Ga0070668_100119991 3300005347 Bacteria 2101
48 Ga0070668_100462429 3300005347 Bacteria 1093
49 Ga0070669_100002066 3300005353 Bacteria 14517
50 Ga0070669_100013181 3300005353 Bacteria 5876
51 Ga0070669_100025346 3300005353 Bacteria 4259
52 Ga0070669_100038714 3300005353 Bacteria 3462
53 Ga0070669_100050484 3300005353 Bacteria 3039
54 Ga0070669_100124653 3300005353 Bacteria 1970
55 Ga0070669_100124733 3300005353 Bacteria 1969
56 Ga0070669_100336606 3300005353 Bacteria 1222
57 Ga0070669_100466381 3300005353 Bacteria 1043
58 Ga0070675_100009578 3300005354 Bacteria 7539
59 Ga0070675_100013391 3300005354 Bacteria 6445
60 Ga0070675_100027481 3300005354 Bacteria 4571
61 Ga0070675_100058629 3300005354 Bacteria 3176
62 Ga0070675_100109657 3300005354 Bacteria 2333
63 Ga0070675_100256013 3300005354 Bacteria 1533
64 Ga0070671_100059753 3300005355 Bacteria 3173
65 Ga0070671_100076112 3300005355 Bacteria 2804
66 Ga0070671_100255466 3300005355 Unclassified 1489
67 Ga0070674_100016179 3300005356 Bacteria 4675
68 Ga0070674_100038589 3300005356 Bacteria 3220
69 Ga0070674_100127245 3300005356 Bacteria 1894
70 Ga0070674_100141876 3300005356 Bacteria 1804
71 Ga0070673_100023191 3300005364 Bacteria 4532
72 Ga0070673_100040635 3300005364 Bacteria 3570
73 Ga0070673_100100825 3300005364 Unclassified 2378
74 Ga0070673_100129077 3300005364 Bacteria 2118
75 Ga0070688_100016105 3300005365 Bacteria 4267
76 Ga0070688_100044907 3300005365 Bacteria 2727
77 Ga0070688_100050572 3300005365 Bacteria 2590
78 Ga0070688_100140281 3300005365 Bacteria 1641
79 Ga0070659_100024734 3300005366 Bacteria 4605
80 Ga0070667_100014199 3300005367 Bacteria 6579
81 Ga0070667_100240028 3300005367 Bacteria 1618
82 Ga0070709_10238906 3300005434 Bacteria 1304
83 Ga0070701_10058551 3300005438 Bacteria 2023
84 Ga0070701_10066989 3300005438 Unclassified 1910
85 Ga0070700_100012378 3300005441 Bacteria 4757
86 Ga0070700_100018084 3300005441 Bacteria 4046
87 Ga0070700_100225982 3300005441 Bacteria 1329
88 Ga0070694_100070552 3300005444 Bacteria 2406
89 Ga0070694_100116931 3300005444 Bacteria 1908
90 Ga0070678_100066256 3300005456 Bacteria 2684
91 Ga0070678_100162004 3300005456 Bacteria 1813
92 Ga0070678_100226662 3300005456 Bacteria 1556
93 Ga0070678_100270543 3300005456 Bacteria 1433
94 Ga0070662_100001424 3300005457 Bacteria 14756
95 Ga0070662_100099511 3300005457 Bacteria 2198
96 Ga0070662_100103672 3300005457 Bacteria 2157
97 Ga0070662_100114695 3300005457 Bacteria 2057
98 Ga0070681_10244918 3300005458 Bacteria 1706
99 Ga0068867_100002331 3300005459 Bacteria 13365
100 Ga0068867_100053584 3300005459 Bacteria 2980
101 Ga0070685_10003749 3300005466 Bacteria 7688
102 Ga0070685_10055943 3300005466 Bacteria 2293
103 Ga0070685_10110141 3300005466 Bacteria 1695
104 Ga0070685_10279521 3300005466 Unclassified 1117
105 Ga0070706_100620730 3300005467 Bacteria 1004
106 Ga0070698_100050483 3300005471 Bacteria 4241
107 Ga0070698_100267590 3300005471 Bacteria 1641
108 Ga0070698_100590227 3300005471 Bacteria 1051
109 Ga0070699_100147448 3300005518 Bacteria 2079
110 Ga0070699_100161137 3300005518 Bacteria 1985
111 Ga0070672_100004794 3300005543 Bacteria 8877
112 Ga0070672_100017119 3300005543 Bacteria 5210
113 Ga0070672_100019114 3300005543 Bacteria 4966
114 Ga0070672_100023745 3300005543 Bacteria 4524
115 Ga0070672_100036752 3300005543 Bacteria 3733
116 Ga0070672_100081303 3300005543 Bacteria 2597
117 Ga0070686_100004091 3300005544 Bacteria 8025
118 Ga0070686_100054917 3300005544 Bacteria 2549
119 Ga0070686_100102290 3300005544 Bacteria 1938
120 Ga0070686_100216942 3300005544 Bacteria 1380
121 Ga0070695_100228958 3300005545 Bacteria 1343
122 Ga0070695_100346949 3300005545 Unclassified 1111
123 Ga0070665_100019909 3300005548 Bacteria 6738
124 Ga0070704_100028036 3300005549 Bacteria 3741
125 Ga0070704_100059712 3300005549 Bacteria 2722
126 Ga0070664_100007285 3300005564 Bacteria 8919
127 Ga0070664_100026170 3300005564 Bacteria 4838
128 Ga0070664_100200471 3300005564 Bacteria 1781
129 Ga0068857_100325275 3300005577 Bacteria 1421
130 Ga0068854_100630415 3300005578 Unclassified 918
131 Ga0070702_100416966 3300005615 Unclassified 965
132 Ga0068859_100003962 3300005617 Bacteria 15104
133 Ga0068859_100078455 3300005617 Bacteria 3343
134 Ga0068859_100099012 3300005617 Bacteria 2970
135 Ga0068859_100495002 3300005617 Unclassified 1318
136 Ga0068859_100563276 3300005617 Bacteria 1233
137 Ga0068859_100564803 3300005617 Unclassified 1232
138 Ga0068864_100027494 3300005618 Unclassified 4805
139 Ga0068864_100074814 3300005618 Bacteria 2956
140 Ga0068861_100014982 3300005719 Bacteria 5453
141 Ga0068861_100116352 3300005719 Bacteria 2150
142 Ga0068861_100143014 3300005719 Bacteria 1954
143 Ga0068861_100311501 3300005719 Bacteria 1368
144 Ga0068870_10002003 3300005840 Bacteria 8432
145 Ga0068870_10027742 3300005840 Bacteria 2835
146 Ga0068870_10046014 3300005840 Bacteria 2287
147 Ga0068870_10085458 3300005840 Bacteria 1754
148 Ga0068863_100008949 3300005841 Bacteria 9776
149 Ga0068863_100483892 3300005841 Bacteria 1217
150 Ga0068863_100609557 3300005841 Unclassified 1081
151 Ga0068858_100012273 3300005842 Bacteria 8080
152 Ga0068858_100055944 3300005842 Bacteria 3646
153 Ga0068858_100059871 3300005842 Bacteria 3520
154 Ga0068858_100066115 3300005842 Bacteria 3347
155 Ga0068858_100273536 3300005842 Bacteria 1607
156 Ga0068860_100071577 3300005843 Bacteria 3295
157 Ga0068862_100003466 3300005844 Bacteria 13572
158 Ga0068862_100019865 3300005844 Bacteria 5610
159 Ga0068862_100195662 3300005844 Bacteria 1821
160 Ga0068862_100257822 3300005844 Bacteria 1591
161 Ga0068862_100261799 3300005844 Bacteria 1579
162 Ga0068862_100419937 3300005844 Bacteria 1255
163 Ga0068862_100667877 3300005844 Unclassified 1004
164 Ga0081455_10049836 3300005937 Bacteria 3607
165 Ga0081539_10000056 3300005985 Bacteria 256522
166 Ga0081539_10001024 3300005985 Bacteria 51459
167 Ga0070717_10325037 3300006028 Bacteria 1371
168 Ga0075368_10054379 3300006042 Bacteria 1595
169 Ga0070712_100073395 3300006175 Bacteria 2454
170 Ga0075367_10046089 3300006178 Bacteria 2561
171 Ga0097621_100011055 3300006237 Bacteria 6636
172 Ga0097621_100257010 3300006237 Bacteria 1531
173 Ga0097621_100389526 3300006237 Bacteria 1246
174 Ga0068871_100603973 3300006358 Unclassified 998
175 Ga0075428_100002647 3300006844 Bacteria 19458
176 Ga0075428_100003050 3300006844 Bacteria 18265
177 Ga0075428_100037268 3300006844 Bacteria 5355
178 Ga0075428_100098564 3300006844 Bacteria 3186
179 Ga0075428_100134394 3300006844 Bacteria 2690
180 Ga0075428_100145041 3300006844 Unclassified 2580
181 Ga0075428_100460463 3300006844 Bacteria 1362
182 Ga0075430_100000715 3300006846 Bacteria 25371
183 Ga0075430_100004633 3300006846 Bacteria 11568
184 Ga0075430_100061650 3300006846 Bacteria 3151
185 Ga0075430_100068359 3300006846 Bacteria 2980
186 Ga0075430_100259336 3300006846 Bacteria 1440
187 Ga0075431_100001165 3300006847 Bacteria 23680
188 Ga0075431_100020272 3300006847 Bacteria 6790
189 Ga0075431_100026622 3300006847 Bacteria 5932
190 Ga0075431_100133301 3300006847 Bacteria 2562
191 Ga0075431_100221641 3300006847 Bacteria 1929
192 Ga0075431_100320493 3300006847 Unclassified 1563
193 Ga0075431_100562926 3300006847 Bacteria 1126
194 Ga0075433_10000046 3300006852 Bacteria 50848
195 Ga0075433_10002971 3300006852 Bacteria 13022
196 Ga0075433_10048736 3300006852 Bacteria 3685
197 Ga0075433_10079195 3300006852 Bacteria 2896
198 Ga0075433_10238546 3300006852 Bacteria 1614
199 Ga0075433_10434922 3300006852 Bacteria 1157
200 Ga0075434_100001157 3300006871 Bacteria 21808
201 Ga0075434_100010107 3300006871 Bacteria 8838
202 Ga0075434_100025046 3300006871 Bacteria 5836
203 Ga0075434_100708583 3300006871 Bacteria 1024
204 Ga0075429_100002491 3300006880 Bacteria 15478
205 Ga0075429_100047313 3300006880 Bacteria 3742
206 Ga0075429_100139986 3300006880 Bacteria 2118
207 Ga0075429_100280850 3300006880 Bacteria 1458
208 Ga0075429_100467786 3300006880 Unclassified 1105
209 Ga0075429_100699491 3300006880 Unclassified 888
210 Ga0068865_100004636 3300006881 Bacteria 8301
211 Ga0075436_100002450 3300006914 Bacteria 12775
212 Ga0075436_100075213 3300006914 Bacteria 2339
213 Ga0075436_100183484 3300006914 Bacteria 1479
214 Ga0097620_100003962 3300006931 Bacteria 15104
215 Ga0097620_100078456 3300006931 Bacteria 3343
216 Ga0097620_100099014 3300006931 Bacteria 2970
217 Ga0097620_100287760 3300006931 Bacteria 1736
218 Ga0097620_100494979 3300006931 Unclassified 1318
219 Ga0097620_100563281 3300006931 Bacteria 1233
220 Ga0097620_100564810 3300006931 Unclassified 1232
221 Ga0075435_100000028 3300007076 Bacteria 82360
222 Ga0075435_100115513 3300007076 Bacteria 2235
223 Ga0075435_100157332 3300007076 Bacteria 1913
224 Ga0111539_10000294 3300009094 Bacteria 60290
225 Ga0111539_10000355 3300009094 Bacteria 56433
226 Ga0111539_10000510 3300009094 Bacteria 49338
227 Ga0111539_10004120 3300009094 Bacteria 19077
228 Ga0111539_10005502 3300009094 Bacteria 16389
229 Ga0111539_10008718 3300009094 Bacteria 12865
230 Ga0111539_10015747 3300009094 Bacteria 9395
231 Ga0111539_10044001 3300009094 Bacteria 5351
232 Ga0111539_10051646 3300009094 Bacteria 4896
233 Ga0111539_10531373 3300009094 Bacteria 1370
234 Ga0111539_10618261 3300009094 Bacteria 1262
235 Ga0111539_10716004 3300009094 Unclassified 1165
236 Ga0111539_10893249 3300009094 Bacteria 1033
237 Ga0105245_10097874 3300009098 Bacteria 2710
238 Ga0114129_10000515 3300009147 Bacteria 47361
239 Ga0114129_10002584 3300009147 Bacteria 25152
240 Ga0114129_10006081 3300009147 Bacteria 17110
241 Ga0114129_10017475 3300009147 Bacteria 10213
242 Ga0114129_10027676 3300009147 Bacteria 8027
243 Ga0114129_10040155 3300009147 Bacteria 6597
244 Ga0114129_10083664 3300009147 Bacteria 4432
245 Ga0114129_10090498 3300009147 Bacteria 4242
246 Ga0114129_10103471 3300009147 Bacteria 3937
247 Ga0114129_10154532 3300009147 Bacteria 3139
248 Ga0114129_10197406 3300009147 Bacteria 2728
249 Ga0114129_10282103 3300009147 Bacteria 2219
250 Ga0114129_10305589 3300009147 Bacteria 2119
251 Ga0114129_10563971 3300009147 Unclassified 1479
252 Ga0114129_10788997 3300009147 Bacteria 1213
253 Ga0105243_10029620 3300009148 Bacteria 4211
254 Ga0105243_11062260 3300009148 Unclassified 816
255 Ga0105241_10048966 3300009174 Bacteria 3217
256 Ga0105241_10418519 3300009174 Bacteria 1179
257 Ga0105242_10002840 3300009176 Bacteria 13570
258 Ga0105248_10003974 3300009177 Bacteria 16346
259 Ga0105248_10031117 3300009177 Bacteria 5964
260 Ga0105248_10074460 3300009177 Bacteria 3816
261 Ga0105248_10074461 3300009177 Bacteria 3816
262 Ga0105248_10148856 3300009177 Bacteria 2641
263 Ga0105248_10861354 3300009177 Unclassified 1023
264 Ga0105238_10019002 3300009551 Bacteria 6999
265 Ga0105249_10006629 3300009553 Bacteria 10074
266 Ga0105249_10239851 3300009553 Bacteria 1792
267 Ga0105249_10304799 3300009553 Bacteria 1599
268 Ga0105246_10009339 3300011119 Bacteria 6041
269 Ga0105246_10289334 3300011119 Archaea 1318
270 Ga0157339_1007327 3300012505 Unclassified 923
271 Ga0157374_10032891 3300013296 Unclassified 4727
272 Ga0157378_10501975 3300013297 Bacteria 1212
273 Ga0163162_10003950 3300013306 Bacteria 14222
274 Ga0163162_10051718 3300013306 Bacteria 4123
275 Ga0157375_10053356 3300013308 Bacteria 3977
276 Ga0157375_10476152 3300013308 Bacteria 1414
277 Ga0163163_10009798 3300014325 Bacteria 8583
278 Ga0163163_10011233 3300014325 Bacteria 8115
279 Ga0163163_10021746 3300014325 Bacteria 6059
280 Ga0157380_10005204 3300014326 Bacteria 9090
281 Ga0157380_10012660 3300014326 Bacteria 6122
282 Ga0157380_10014097 3300014326 Bacteria 5842
283 Ga0157380_10065272 3300014326 Bacteria 2925
284 Ga0157380_10131523 3300014326 Bacteria 2136
285 Ga0157380_10245099 3300014326 Bacteria 1618
286 Ga0157380_10714460 3300014326 Bacteria 1009
287 Ga0157377_10039131 3300014745 Bacteria 2621
288 Ga0157379_10007884 3300014968 Bacteria 9229
289 Ga0157379_10009533 3300014968 Bacteria 8454
290 Ga0157379_10038499 3300014968 Bacteria 4266
291 Ga0163161_10025096 3300017792 Bacteria 4216
292 Ga0163161_10311271 3300017792 Bacteria 1242
293 Ga0163161_10584944 3300017792 Bacteria 919
294 Ga0207697_10000401 3300025315 Bacteria 24402
295 Ga0207697_10160338 3300025315 Bacteria 981
296 Ga0207682_10000835 3300025893 Bacteria 14244
297 Ga0207682_10006642 3300025893 Bacteria 4649
298 Ga0207682_10048235 3300025893 Bacteria 1755
299 Ga0207642_10149728 3300025899 Bacteria 1241
300 Ga0207642_10395564 3300025899 Bacteria 826
301 Ga0207642_10421310 3300025899 Bacteria 803
302 Ga0207710_10231874 3300025900 Bacteria 919
303 Ga0207688_10069250 3300025901 Bacteria 1999
304 Ga0207680_10128497 3300025903 Bacteria 1667
305 Ga0207680_10132119 3300025903 Unclassified 1646
306 Ga0207680_10160466 3300025903 Bacteria 1507
307 Ga0207699_10188505 3300025906 Bacteria 1390
308 Ga0207645_10002384 3300025907 Bacteria 14794
309 Ga0207645_10008837 3300025907 Bacteria 7001
310 Ga0207645_10026853 3300025907 Bacteria 3720
311 Ga0207645_10075450 3300025907 Bacteria 2158
312 Ga0207643_10003689 3300025908 Bacteria 8237
313 Ga0207643_10105877 3300025908 Bacteria 1653
314 Ga0207643_10136100 3300025908 Bacteria 1465
315 Ga0207705_10031187 3300025909 Bacteria 3803
316 Ga0207684_10372237 3300025910 Bacteria 1229
317 Ga0207662_10002786 3300025918 Bacteria 8842
318 Ga0207662_10086059 3300025918 Bacteria 1926
319 Ga0207662_10290978 3300025918 Bacteria 1083
320 Ga0207649_10479464 3300025920 Unclassified 943
321 Ga0207681_10004603 3300025923 Bacteria 8484
322 Ga0207681_10100330 3300025923 Bacteria 2086
323 Ga0207681_10113262 3300025923 Bacteria 1977
324 Ga0207681_10115704 3300025923 Bacteria 1958
325 Ga0207681_10116479 3300025923 Bacteria 1952
326 Ga0207681_10147560 3300025923 Unclassified 1759
327 Ga0207681_10293837 3300025923 Bacteria 1283
328 Ga0207650_10014896 3300025925 Bacteria 5410
329 Ga0207650_10138522 3300025925 Bacteria 1911
330 Ga0207659_10015211 3300025926 Bacteria 4980
331 Ga0207659_10038859 3300025926 Unclassified 3313
332 Ga0207659_10039694 3300025926 Bacteria 3286
333 Ga0207659_10111054 3300025926 Bacteria 2084
334 Ga0207659_10225883 3300025926 Bacteria 1508
335 Ga0207659_10260446 3300025926 Unclassified 1411
336 Ga0207659_10284083 3300025926 Archaea 1354
337 Ga0207687_10344686 3300025927 Bacteria 1212
338 Ga0207687_10416922 3300025927 Unclassified 1107
339 Ga0207700_10066422 3300025928 Bacteria 2757
340 Ga0207644_10021615 3300025931 Bacteria 4387
341 Ga0207644_10083577 3300025931 Unclassified 2365
342 Ga0207644_10169411 3300025931 Bacteria 1704
343 Ga0207644_10215181 3300025931 Unclassified 1521
344 Ga0207690_10030287 3300025932 Bacteria 3449
345 Ga0207706_10001495 3300025933 Bacteria 23216
346 Ga0207706_10020332 3300025933 Bacteria 5967
347 Ga0207706_10096692 3300025933 Bacteria 2597
348 Ga0207706_10163931 3300025933 Bacteria 1953
349 Ga0207706_10537832 3300025933 Bacteria 1007
350 Ga0207709_10046331 3300025935 Bacteria 2638
351 Ga0207670_10066713 3300025936 Bacteria 2473
352 Ga0207669_10001382 3300025937 Bacteria 10322
353 Ga0207669_10030661 3300025937 Bacteria 2991
354 Ga0207704_10078976 3300025938 Bacteria 2119
355 Ga0207704_10314043 3300025938 Bacteria 1206
356 Ga0207704_10448003 3300025938 Unclassified 1030
357 Ga0207665_10581497 3300025939 Bacteria 873
358 Ga0207691_10000953 3300025940 Bacteria 28656
359 Ga0207691_10050863 3300025940 Bacteria 3791
360 Ga0207691_10063455 3300025940 Bacteria 3350
361 Ga0207691_10074101 3300025940 Bacteria 3070
362 Ga0207691_10084852 3300025940 Bacteria 2843
363 Ga0207711_10011469 3300025941 Bacteria 7368
364 Ga0207711_10045112 3300025941 Bacteria 3766
365 Ga0207711_10061098 3300025941 Bacteria 3248
366 Ga0207711_10180864 3300025941 Bacteria 1918
367 Ga0207689_10000609 3300025942 Bacteria 34221
368 Ga0207689_10004205 3300025942 Bacteria 13090
369 Ga0207689_10068933 3300025942 Bacteria 2907
370 Ga0207689_10129150 3300025942 Bacteria 2080
371 Ga0207679_10105420 3300025945 Bacteria 2214
372 Ga0207679_10156539 3300025945 Bacteria 1861
373 Ga0207651_10013645 3300025960 Bacteria 4659
374 Ga0207651_10101133 3300025960 Bacteria 2139
375 Ga0207651_10185560 3300025960 Bacteria 1654
376 Ga0207651_10289913 3300025960 Bacteria 1356
377 Ga0207651_10328651 3300025960 Unclassified 1280
378 Ga0207712_10004844 3300025961 Bacteria 8505
379 Ga0207668_10332730 3300025972 Bacteria 1264
380 Ga0207658_10083287 3300025986 Bacteria 2458
381 Ga0207658_10171896 3300025986 Bacteria 1786
382 Ga0207658_10185085 3300025986 Bacteria 1727
383 Ga0207658_10198484 3300025986 Bacteria 1673
384 Ga0207677_10043721 3300026023 Bacteria 2980
385 Ga0207677_10065852 3300026023 Bacteria 2530
386 Ga0207677_10121936 3300026023 Bacteria 1963
387 Ga0207703_10097963 3300026035 Bacteria 2479
388 Ga0207703_10259775 3300026035 Bacteria 1569
389 Ga0207703_10290715 3300026035 Bacteria 1487
390 Ga0207678_10012389 3300026067 Bacteria 7485
391 Ga0207708_10009968 3300026075 Bacteria 7056
392 Ga0207708_10010604 3300026075 Bacteria 6841
393 Ga0207708_10304386 3300026075 Bacteria 1297
394 Ga0207641_10001284 3300026088 Bacteria 25006
395 Ga0207641_10017851 3300026088 Bacteria 5812
396 Ga0207641_10034192 3300026088 Bacteria 4227
397 Ga0207641_10289099 3300026088 Bacteria 1545
398 Ga0207648_10000427 3300026089 Bacteria 46398
399 Ga0207648_10034013 3300026089 Bacteria 4495
400 Ga0207648_10045954 3300026089 Bacteria 3828
401 Ga0207648_10272798 3300026089 Bacteria 1511
402 Ga0207648_10398550 3300026089 Bacteria 1247
403 Ga0207648_10466313 3300026089 Bacteria 1152
404 Ga0207676_10015654 3300026095 Bacteria 5478
405 Ga0207676_10105722 3300026095 Bacteria 2344
406 Ga0207674_10061808 3300026116 Bacteria 3784
407 Ga0207674_10211913 3300026116 Bacteria 1886
408 Ga0207675_100009732 3300026118 Bacteria 8998
409 Ga0207675_100103942 3300026118 Bacteria 2677
410 Ga0207675_100208971 3300026118 Unclassified 1877
411 Ga0207675_100380189 3300026118 Bacteria 1389
412 Ga0207683_10097781 3300026121 Bacteria 2618
413 Ga0207683_10223664 3300026121 Bacteria 1715
414 Ga0207683_10255251 3300026121 Bacteria 1600
415 Ga0207683_10363707 3300026121 Bacteria 1329
416 Ga0209974_10023259 3300027876 Bacteria 2051
417 Ga0207428_10000654 3300027907 Bacteria 40562
418 Ga0207428_10005786 3300027907 Bacteria 11474
419 Ga0207428_10008299 3300027907 Bacteria 9388
420 Ga0207428_10011984 3300027907 Bacteria 7631
421 Ga0207428_10017722 3300027907 Bacteria 6108
422 Ga0207428_10034199 3300027907 Bacteria 4167
423 Ga0207428_10059613 3300027907 Bacteria 3026
424 Ga0207428_10412859 3300027907 Unclassified 987
425 Ga0268265_10021622 3300028380 Bacteria 4509
426 Ga0268265_10037229 3300028380 Bacteria 3569
427 Ga0268265_10243317 3300028380 Bacteria 1589
428 Ga0268265_10256653 3300028380 Bacteria 1552
429 Ga0268265_10625733 3300028380 Unclassified 1032
430 Ga0268264_10039270 3300028381 Bacteria 3910
431 Ga0268264_10789861 3300028381 Unclassified 948
432 Ga0307408_100123455 3300031548 Bacteria 2010
433 Ga0307408_100164496 3300031548 Bacteria 1765
434 Ga0307408_100259163 3300031548 Bacteria 1438
435 Ga0307405_10005960 3300031731 Bacteria 5947
436 Ga0307410_10072111 3300031852 Bacteria 2397
437 Ga0307410_10088257 3300031852 Bacteria 2195
438 Ga0307406_10007043 3300031901 Bacteria 6226
439 Ga0307407_10054542 3300031903 Bacteria 2306
440 Ga0307407_10223315 3300031903 Bacteria 1275
441 Ga0307412_10017308 3300031911 Bacteria 4313
442 Ga0307412_10031365 3300031911 Bacteria 3356
443 Ga0307409_100016572 3300031995 Bacteria 4880
444 Ga0307416_100020140 3300032002 Bacteria 4752
445 Ga0307416_100034068 3300032002 Bacteria 3870
446 Ga0307414_10130689 3300032004 Bacteria 1949
447 Ga0307411_10007114 3300032005 Bacteria 5666
448 Ga0307415_100017939 3300032126 Unclassified 4259
449 Ga0373932_0011385 3300035112 Bacteria 2172
450 Ga0373962_0002893 3300035242 Bacteria 4113
451 Ga0373937_0006141 3300036401 Bacteria 10343
452 Ga0451853_4124532 3300041512 Bacteria 1536
453 Ga0439450_003270 3300042008 Bacteria 2659
454 Ga0439435_0022943 3300042436 Bacteria 1634
455 Ga0439440_0023963 3300042993 Unclassified 1396
456 Ga0495580_0120973 3300046472 Bacteria 1818
457 Ga0495594_0006315 3300046499 Bacteria 6095
458 Ga0495586_0461793 3300046535 Bacteria 732
459 Ga0495598_0009136 3300046537 Bacteria 2333
460 Ga0495598_0017867 3300046537 Bacteria 1835
461 Ga0495621_0062376 3300046539 Bacteria 1356
462 Ga0495633_0073454 3300046558 Bacteria 1594
463 Ga0495656_0227201 3300046615 Unclassified 935
464 Ga0495634_0071446 3300046642 Bacteria 2285
465 Ga0495658_0521220 3300046683 Bacteria 761
466 Ga0496109_0277969 3300048912 Bacteria 1578
467 Ga0496112_0639648 3300048915 Unclassified 994
468 Ga0496114_0297281 3300048917 Bacteria 1425
469 Ga0501031_0006256 3300049568 Bacteria 7763
470 Ga0501031_0097680 3300049568 Bacteria 1917
471 Ga0501031_0100896 3300049568 Bacteria 1883
472 Ga0501032_0007162 3300049569 Bacteria 8165
473 Ga0501032_0012895 3300049569 Bacteria 5959
474 Ga0501032_0023540 3300049569 Bacteria 4252
475 Ga0501033_0032866 3300049570 Bacteria 3895
476 Ga0501033_0074184 3300049570 Unclassified 2497
477 Ga0501033_0090650 3300049570 Bacteria 2236
478 Ga0501034_0002066 3300049571 Bacteria 25080
479 Ga0501034_0007781 3300049571 Bacteria 11402
480 Ga0501036_0002233 3300049572 Bacteria 15139
481 Ga0501036_0011154 3300049572 Bacteria 7434
482 Ga0501036_0117997 3300049572 Bacteria 2241
483 Ga0501036_0172538 3300049572 Unclassified 1822
484 Ga0501037_0002861 3300049573 Bacteria 12516
485 Ga0501037_0006859 3300049573 Bacteria 8319
486 Ga0501037_0223060 3300049573 Bacteria 1325
487 Ga0501038_0007195 3300049574 Bacteria 10288
488 Ga0501038_0253061 3300049574 Bacteria 1394
489 Ga0501038_0295166 3300049574 Bacteria 1273
490 Ga0501039_0007163 3300049575 Bacteria 8495
491 Ga0501039_0020408 3300049575 Bacteria 5078
492 Ga0501039_0035940 3300049575 Bacteria 3822
493 Ga0501039_0063604 3300049575 Bacteria 2859
494 Ga0501039_0579035 3300049575 Bacteria 880
495 Ga0501040_0019433 3300049576 Bacteria 4518
496 Ga0501040_0024883 3300049576 Bacteria 4022
497 Ga0501040_0284532 3300049576 Bacteria 1181
498 Ga0501041_0019511 3300049577 Bacteria 4049
499 Ga0501042_0020309 3300049578 Bacteria 4622
500 Ga0501042_0033572 3300049578 Bacteria 3638
501 Ga0501042_0088625 3300049578 Bacteria 2220
502 Ga0501042_0186700 3300049578 Bacteria 1495
503 Ga0501042_0449120 3300049578 Unclassified 935
504 Ga0501043_0015067 3300049579 Bacteria 6052
505 Ga0501043_0032528 3300049579 Bacteria 4101
506 Ga0501046_0019158 3300049580 Bacteria 5676
507 Ga0501046_0036447 3300049580 Bacteria 3958
508 Ga0501046_0047540 3300049580 Bacteria 3401
509 Ga0501046_0052533 3300049580 Bacteria 3211
510 Ga0501047_0010575 3300049581 Bacteria 8726
511 Ga0501048_0001033 3300049582 Bacteria 20838
512 Ga0501048_0085590 3300049582 Bacteria 2223
513 Ga0501067_0000440 3300049583 Bacteria 22761
514 Ga0501067_0010605 3300049583 Bacteria 5099
515 Ga0501068_0002561 3300049584 Bacteria 9644
516 Ga0501068_0041395 3300049584 Bacteria 2768
517 Ga0501068_0080826 3300049584 Unclassified 1994
518 Ga0501069_0001453 3300049585 Bacteria 11651
519 Ga0501069_0081532 3300049585 Bacteria 1822
520 Ga0501069_0321914 3300049585 Bacteria 909
521 Ga0501070_0007051 3300049586 Bacteria 9560
522 Ga0501070_0031864 3300049586 Bacteria 4415
523 Ga0501071_0005370 3300049587 Bacteria 8227
524 Ga0501071_0026207 3300049587 Bacteria 4090
525 Ga0501072_0004696 3300049588 Bacteria 10409
526 Ga0501072_0021914 3300049588 Bacteria 4957
527 Ga0501072_0088300 3300049588 Bacteria 2460
528 Ga0501072_0165522 3300049588 Unclassified 1764
529 Ga0501073_0006457 3300049589 Bacteria 8724
530 Ga0501073_0130128 3300049589 Unclassified 1744
531 Ga0501074_0004576 3300049590 Bacteria 9905
532 Ga0501074_0122797 3300049590 Unclassified 1857
533 Ga0501075_0005504 3300049591 Bacteria 8664
534 Ga0501075_0025518 3300049591 Bacteria 4342
535 Ga0501076_0008756 3300049592 Bacteria 7434
536 Ga0501076_0471034 3300049592 Unclassified 1035
537 Ga0501223_007276 3300049663 Bacteria 2270
538 Ga0501233_008959 3300049668 Bacteria 1943
539 Ga0501079_0003819 3300049741 Bacteria 11131
540 Ga0501079_0009242 3300049741 Bacteria 7467
541 Ga0501079_0015606 3300049741 Bacteria 5800
542 Ga0501079_0026030 3300049741 Bacteria 4486
543 Ga0501080_0010189 3300049742 Bacteria 8594
544 Ga0501080_0073057 3300049742 Bacteria 3191
545 Ga0501080_0376497 3300049742 Bacteria 1279
546 Ga0501081_0021575 3300049743 Unclassified 4299
547 Ga0501081_0377449 3300049743 Bacteria 1047
548 Ga0501083_0056975 3300049744 Unclassified 2617
549 Ga0501083_0156888 3300049744 Bacteria 1489
550 Ga0501035_0004470 3300049822 Bacteria 13271
551 Ga0501035_0007627 3300049822 Bacteria 10107
552 Ga0501035_0238217 3300049822 Unclassified 1548
553 Ga0501044_0012599 3300049823 Bacteria 9157
554 Ga0501044_0274220 3300049823 Bacteria 1621
555 Ga0501044_0399797 3300049823 Unclassified 1286
556 Ga0501045_0002302 3300049824 Bacteria 12944
557 Ga0501045_0008346 3300049824 Bacteria 7216
558 Ga0501045_0036689 3300049824 Bacteria 3560
559 Ga0501045_0037061 3300049824 Bacteria 3544
560 nmdc:mga06z11_72882_c1 3300050494 Bacteria 1822
561 nmdc:mga05p37_12459_c1 3300050507 Bacteria 10156
562 nmdc:mga05p37_125125_c1 3300050507 Bacteria 3157
563 nmdc:mga05p37_177885_c1 3300050507 Bacteria 2591
564 nmdc:mga05p37_19114_c1 3300050507 Bacteria 8286
565 nmdc:mga05p37_20064_c1 3300050507 Bacteria 8088
566 nmdc:mga05p37_24274_c1 3300050507 Bacteria 7367
567 nmdc:mga05p37_305974_c1 3300050507 Bacteria 1886
568 nmdc:mga05p37_398303_c1 3300050507 Unclassified 1608
569 nmdc:mga05p37_55_c1 3300050507 Bacteria 98735
570 nmdc:mga05p37_74558_c1 3300050507 Bacteria 4176
571 nmdc:mga05p37_94031_c1 3300050507 Bacteria 3693
572 nmdc:mga09592_115819_c1 3300050508 Bacteria 2300
573 nmdc:mga09592_15373_c1 3300050508 Bacteria 6250
574 nmdc:mga09592_169228_c1 3300050508 Unclassified 1889
575 nmdc:mga09592_19105_c1 3300050508 Bacteria 5624
576 nmdc:mga09592_695628_c1 3300050508 Bacteria 865
577 nmdc:mga09592_905_c1 3300050508 Bacteria 23310
578 nmdc:mga09592_96772_c1 3300050508 Bacteria 2525
579 nmdc:mga0qj67_1639_c1 3300050509 Bacteria 15752
580 nmdc:mga0qj67_198334_c1 3300050509 Unclassified 1631
581 nmdc:mga0qj67_23715_c1 3300050509 Bacteria 4722
582 nmdc:mga0qj67_545981_c1 3300050509 Unclassified 930
583 nmdc:mga0qj67_61985_c1 3300050509 Bacteria 2971
584 nmdc:mga0qj67_9329_c1 3300050509 Bacteria 7296
585 nmdc:mga06r32_160614_c1 3300050510 Bacteria 2230
586 nmdc:mga06r32_370113_c1 3300050510 Unclassified 1416
587 nmdc:mga06r32_4004_c1 3300050510 Bacteria 13203
588 nmdc:mga06r32_52951_c1 3300050510 Bacteria 3888
589 nmdc:mga06r32_76191_c2 3300050510 Bacteria 2843
590 nmdc:mga06r32_769134_c1 3300050510 Unclassified 925
591 nmdc:mga06r32_802276_c1 3300050510 Unclassified 902
592 nmdc:mga08y16_116_c1 3300050511 Bacteria 68538
593 nmdc:mga08y16_19124_c1 3300050511 Bacteria 7217
594 nmdc:mga08y16_238_c1 3300050511 Bacteria 49219
595 nmdc:mga08y16_292002_c1 3300050511 Bacteria 1681
596 nmdc:mga08y16_565_c1 3300050511 Bacteria 34380
597 nmdc:mga08y16_871_c1 3300050511 Bacteria 29077
598 nmdc:mga0n895_125670_c1 3300050512 Unclassified 2588
599 nmdc:mga0n895_155439_c1 3300050512 Bacteria 2318
600 nmdc:mga0n895_1933_c1 3300050512 Bacteria 15889
601 nmdc:mga0n895_24022_c1 3300050512 Bacteria 5738
602 nmdc:mga0n895_35707_c1 3300050512 Bacteria 4794
603 nmdc:mga0n895_583487_c1 3300050512 Bacteria 1121
604 nmdc:mga0rr50_100434_c1 3300050513 Bacteria 2272
605 nmdc:mga0rr50_300809_c1 3300050513 Unclassified 1342
606 nmdc:mga0rr50_43174_c1 3300050513 Bacteria 3297
607 nmdc:mga08x19_284348_c1 3300050514 Bacteria 1147
608 nmdc:mga0a205_265212_c1 3300050515 Bacteria 1595
609 nmdc:mga0a205_266656_c1 3300050515 Bacteria 1590
610 nmdc:mga0a205_32719_c1 3300050515 Bacteria 4985
611 nmdc:mga0a205_45000_c1 3300050515 Bacteria 4256
612 nmdc:mga0a205_474295_c1 3300050515 Bacteria 1110
613 nmdc:mga0a205_7834_c1 3300050515 Bacteria 9703
614 nmdc:mga0a205_92979_c1 3300050515 Bacteria 2914
615 Ga0495601_0271802 3300053077 Bacteria 1106
616 Ga0501084_0015887 3300054114 Bacteria 6244
617 Ga0501084_0023137 3300054114 Bacteria 5187
618 Ga0501084_0027006 3300054114 Bacteria 4796
619 Ga0501084_0298723 3300054114 Bacteria 1360
620 Ga0501082_0031356 3300060353 Bacteria 4582
621 Ga0501082_0357147 3300060353 Unclassified 1274
622 JGI24746J21847_1000548
623 JGI25406J46586_10000102
624 rootH1_10012193
625 Ga0065714_10114844
626 Ga0065704_10019942
627 Ga0065712_10072891
628 Ga0065712_10164792
629 Ga0065715_10114422
630 Ga0065707_10006174
631 Ga0065707_10008070
632 Ga0065707_10041987
633 Ga0065707_10099207
634 Ga0065707_10220833
635 Ga0070658_10700273
636 Ga0070676_10001876
637 Ga0070676_10148970
638 Ga0070676_10157483
639 Ga0070690_100023097
640 Ga0070690_100209133
641 Ga0070690_100349028
642 Ga0070690_100429974
643 Ga0070670_100012270
644 Ga0070670_100106578
645 Ga0070670_100317497
646 Ga0070670_100335361
647 Ga0070677_10004226
648 Ga0070677_10043198
649 Ga0070677_10062912
650 Ga0070677_10086432
651 Ga0070677_10118048
652 Ga0070677_10148555
653 Ga0068869_100004898
654 Ga0068869_100007556
655 Ga0070666_10015486
656 Ga0070666_10024195
657 Ga0068868_100020829
658 Ga0068868_100089008
659 Ga0070689_100006452
660 Ga0070689_100183765
661 Ga0070689_100400097
662 Ga0070689_100422656
663 Ga0070689_100545370
664 Ga0070687_100009442
665 Ga0070687_100174472
666 Ga0070661_100085893
667 Ga0070692_10127801
668 Ga0070668_100119991
669 Ga0070668_100462429
670 Ga0070669_100002066
671 Ga0070669_100013181
672 Ga0070669_100025346
673 Ga0070669_100038714
674 Ga0070669_100050484
675 Ga0070669_100124653
676 Ga0070669_100124733
677 Ga0070669_100336606
678 Ga0070669_100466381
679 Ga0070675_100009578
680 Ga0070675_100013391
681 Ga0070675_100027481
682 Ga0070675_100058629
683 Ga0070675_100109657
684 Ga0070675_100256013
685 Ga0070671_100059753
686 Ga0070671_100076112
687 Ga0070671_100255466
688 Ga0070674_100016179
689 Ga0070674_100038589
690 Ga0070674_100127245
691 Ga0070674_100141876
692 Ga0070673_100023191
693 Ga0070673_100040635
694 Ga0070673_100100825
695 Ga0070673_100129077
696 Ga0070688_100016105
697 Ga0070688_100044907
698 Ga0070688_100050572
699 Ga0070688_100140281
700 Ga0070659_100024734
701 Ga0070667_100014199
702 Ga0070667_100240028
703 Ga0070709_10238906
704 Ga0070701_10058551
705 Ga0070701_10066989
706 Ga0070700_100012378
707 Ga0070700_100018084
708 Ga0070700_100225982
709 Ga0070694_100070552
710 Ga0070694_100116931
711 Ga0070678_100066256
712 Ga0070678_100162004
713 Ga0070678_100226662
714 Ga0070678_100270543
715 Ga0070662_100001424
716 Ga0070662_100099511
717 Ga0070662_100103672
718 Ga0070662_100114695
719 Ga0070681_10244918
720 Ga0068867_100002331
721 Ga0068867_100053584
722 Ga0070685_10003749
723 Ga0070685_10055943
724 Ga0070685_10110141
725 Ga0070685_10279521
726 Ga0070706_100620730
727 Ga0070698_100050483
728 Ga0070698_100267590
729 Ga0070698_100590227
730 Ga0070699_100147448
731 Ga0070699_100161137
732 Ga0070672_100004794
733 Ga0070672_100017119
734 Ga0070672_100019114
735 Ga0070672_100023745
736 Ga0070672_100036752
737 Ga0070672_100081303
738 Ga0070686_100004091
739 Ga0070686_100054917
740 Ga0070686_100102290
741 Ga0070686_100216942
742 Ga0070695_100228958
743 Ga0070695_100346949
744 Ga0070665_100019909
745 Ga0070704_100028036
746 Ga0070704_100059712
747 Ga0070664_100007285
748 Ga0070664_100026170
749 Ga0070664_100200471
750 Ga0068857_100325275
751 Ga0068854_100630415
752 Ga0070702_100416966
753 Ga0068859_100003962
754 Ga0068859_100078455
755 Ga0068859_100099012
756 Ga0068859_100495002
757 Ga0068859_100563276
758 Ga0068859_100564803
759 Ga0068864_100027494
760 Ga0068864_100074814
761 Ga0068861_100014982
762 Ga0068861_100116352
763 Ga0068861_100143014
764 Ga0068861_100311501
765 Ga0068870_10002003
766 Ga0068870_10027742
767 Ga0068870_10046014
768 Ga0068870_10085458
769 Ga0068863_100008949
770 Ga0068863_100483892
771 Ga0068863_100609557
772 Ga0068858_100012273
773 Ga0068858_100055944
774 Ga0068858_100059871
775 Ga0068858_100066115
776 Ga0068858_100273536
777 Ga0068860_100071577
778 Ga0068862_100003466
779 Ga0068862_100019865
780 Ga0068862_100195662
781 Ga0068862_100257822
782 Ga0068862_100261799
783 Ga0068862_100419937
784 Ga0068862_100667877
785 Ga0081455_10049836
786 Ga0081539_10000056
787 Ga0081539_10001024
788 Ga0070717_10325037
789 Ga0075368_10054379
790 Ga0070712_100073395
791 Ga0075367_10046089
792 Ga0097621_100011055
793 Ga0097621_100257010
794 Ga0097621_100389526
795 Ga0068871_100603973
796 Ga0075428_100002647
797 Ga0075428_100003050
798 Ga0075428_100037268
799 Ga0075428_100098564
800 Ga0075428_100134394
801 Ga0075428_100145041
802 Ga0075428_100460463
803 Ga0075430_100000715
804 Ga0075430_100004633
805 Ga0075430_100061650
806 Ga0075430_100068359
807 Ga0075430_100259336
808 Ga0075431_100001165
809 Ga0075431_100020272
810 Ga0075431_100026622
811 Ga0075431_100133301
812 Ga0075431_100221641
813 Ga0075431_100320493
814 Ga0075431_100562926
815 Ga0075433_10000046
816 Ga0075433_10002971
817 Ga0075433_10048736
818 Ga0075433_10079195
819 Ga0075433_10238546
820 Ga0075433_10434922
821 Ga0075434_100001157
822 Ga0075434_100010107
823 Ga0075434_100025046
824 Ga0075434_100708583
825 Ga0075429_100002491
826 Ga0075429_100047313
827 Ga0075429_100139986
828 Ga0075429_100280850
829 Ga0075429_100467786
830 Ga0075429_100699491
831 Ga0068865_100004636
832 Ga0075436_100002450
833 Ga0075436_100075213
834 Ga0075436_100183484
835 Ga0097620_100003962
836 Ga0097620_100078456
837 Ga0097620_100099014
838 Ga0097620_100287760
839 Ga0097620_100494979
840 Ga0097620_100563281
841 Ga0097620_100564810
842 Ga0075435_100000028
843 Ga0075435_100115513
844 Ga0075435_100157332
845 Ga0111539_10000294
846 Ga0111539_10000355
847 Ga0111539_10000510
848 Ga0111539_10004120
849 Ga0111539_10005502
850 Ga0111539_10008718
851 Ga0111539_10015747
852 Ga0111539_10044001
853 Ga0111539_10051646
854 Ga0111539_10531373
855 Ga0111539_10618261
856 Ga0111539_10716004
857 Ga0111539_10893249
858 Ga0105245_10097874
859 Ga0114129_10000515
860 Ga0114129_10002584
861 Ga0114129_10006081
862 Ga0114129_10017475
863 Ga0114129_10027676
864 Ga0114129_10040155
865 Ga0114129_10083664
866 Ga0114129_10090498
867 Ga0114129_10103471
868 Ga0114129_10154532
869 Ga0114129_10197406
870 Ga0114129_10282103
871 Ga0114129_10305589
872 Ga0114129_10563971
873 Ga0114129_10788997
874 Ga0105243_10029620
875 Ga0105243_11062260
876 Ga0105241_10048966
877 Ga0105241_10418519
878 Ga0105242_10002840
879 Ga0105248_10003974
880 Ga0105248_10031117
881 Ga0105248_10074460
882 Ga0105248_10074461
883 Ga0105248_10148856
884 Ga0105248_10861354
885 Ga0105238_10019002
886 Ga0105249_10006629
887 Ga0105249_10239851
888 Ga0105249_10304799
889 Ga0105246_10009339
890 Ga0105246_10289334
891 Ga0157339_1007327
892 Ga0157374_10032891
893 Ga0157378_10501975
894 Ga0163162_10003950
895 Ga0163162_10051718
896 Ga0157375_10053356
897 Ga0157375_10476152
898 Ga0163163_10009798
899 Ga0163163_10011233
900 Ga0163163_10021746
901 Ga0157380_10005204
902 Ga0157380_10012660
903 Ga0157380_10014097
904 Ga0157380_10065272
905 Ga0157380_10131523
906 Ga0157380_10245099
907 Ga0157380_10714460
908 Ga0157377_10039131
909 Ga0157379_10007884
910 Ga0157379_10009533
911 Ga0157379_10038499
912 Ga0163161_10025096
913 Ga0163161_10311271
914 Ga0163161_10584944
915 Ga0207697_10000401
916 Ga0207697_10160338
917 Ga0207682_10000835
918 Ga0207682_10006642
919 Ga0207682_10048235
920 Ga0207642_10149728
921 Ga0207642_10395564
922 Ga0207642_10421310
923 Ga0207710_10231874
924 Ga0207688_10069250
925 Ga0207680_10128497
926 Ga0207680_10132119
927 Ga0207680_10160466
928 Ga0207699_10188505
929 Ga0207645_10002384
930 Ga0207645_10008837
931 Ga0207645_10026853
932 Ga0207645_10075450
933 Ga0207643_10003689
934 Ga0207643_10105877
935 Ga0207643_10136100
936 Ga0207705_10031187
937 Ga0207684_10372237
938 Ga0207662_10002786
939 Ga0207662_10086059
940 Ga0207662_10290978
941 Ga0207649_10479464
942 Ga0207681_10004603
943 Ga0207681_10100330
944 Ga0207681_10113262
945 Ga0207681_10115704
946 Ga0207681_10116479
947 Ga0207681_10147560
948 Ga0207681_10293837
949 Ga0207650_10014896
950 Ga0207650_10138522
951 Ga0207659_10015211
952 Ga0207659_10038859
953 Ga0207659_10039694
954 Ga0207659_10111054
955 Ga0207659_10225883
956 Ga0207659_10260446
957 Ga0207659_10284083
958 Ga0207687_10344686
959 Ga0207687_10416922
960 Ga0207700_10066422
961 Ga0207644_10021615
962 Ga0207644_10083577
963 Ga0207644_10169411
964 Ga0207644_10215181
965 Ga0207690_10030287
966 Ga0207706_10001495
967 Ga0207706_10020332
968 Ga0207706_10096692
969 Ga0207706_10163931
970 Ga0207706_10537832
971 Ga0207709_10046331
972 Ga0207670_10066713
973 Ga0207669_10001382
974 Ga0207669_10030661
975 Ga0207704_10078976
976 Ga0207704_10314043
977 Ga0207704_10448003
978 Ga0207665_10581497
979 Ga0207691_10000953
980 Ga0207691_10050863
981 Ga0207691_10063455
982 Ga0207691_10074101
983 Ga0207691_10084852
984 Ga0207711_10011469
985 Ga0207711_10045112
986 Ga0207711_10061098
987 Ga0207711_10180864
988 Ga0207689_10000609
989 Ga0207689_10004205
990 Ga0207689_10068933
991 Ga0207689_10129150
992 Ga0207679_10105420
993 Ga0207679_10156539
994 Ga0207651_10013645
995 Ga0207651_10101133
996 Ga0207651_10185560
997 Ga0207651_10289913
998 Ga0207651_10328651
999 Ga0207712_10004844
1000 Ga0207668_10332730
1001 Ga0207658_10083287
1002 Ga0207658_10171896
1003 Ga0207658_10185085
1004 Ga0207658_10198484
1005 Ga0207677_10043721
1006 Ga0207677_10065852
1007 Ga0207677_10121936
1008 Ga0207703_10097963
1009 Ga0207703_10259775
1010 Ga0207703_10290715
1011 Ga0207678_10012389
1012 Ga0207708_10009968
1013 Ga0207708_10010604
1014 Ga0207708_10304386
1015 Ga0207641_10001284
1016 Ga0207641_10017851
1017 Ga0207641_10034192
1018 Ga0207641_10289099
1019 Ga0207648_10000427
1020 Ga0207648_10034013
1021 Ga0207648_10045954
1022 Ga0207648_10272798
1023 Ga0207648_10398550
1024 Ga0207648_10466313
1025 Ga0207676_10015654
1026 Ga0207676_10105722
1027 Ga0207674_10061808
1028 Ga0207674_10211913
1029 Ga0207675_100009732
1030 Ga0207675_100103942
1031 Ga0207675_100208971
1032 Ga0207675_100380189
1033 Ga0207683_10097781
1034 Ga0207683_10223664
1035 Ga0207683_10255251
1036 Ga0207683_10363707
1037 Ga0209974_10023259
1038 Ga0207428_10000654
1039 Ga0207428_10005786
1040 Ga0207428_10008299
1041 Ga0207428_10011984
1042 Ga0207428_10017722
1043 Ga0207428_10034199
1044 Ga0207428_10059613
1045 Ga0207428_10412859
1046 Ga0268265_10021622
1047 Ga0268265_10037229
1048 Ga0268265_10243317
1049 Ga0268265_10256653
1050 Ga0268265_10625733
1051 Ga0268264_10039270
1052 Ga0268264_10789861
1053 Ga0307408_100123455
1054 Ga0307408_100164496
1055 Ga0307408_100259163
1056 Ga0307405_10005960
1057 Ga0307410_10072111
1058 Ga0307410_10088257
1059 Ga0307406_10007043
1060 Ga0307407_10054542
1061 Ga0307407_10223315
1062 Ga0307412_10017308
1063 Ga0307412_10031365
1064 Ga0307409_100016572
1065 Ga0307416_100020140
1066 Ga0307416_100034068
1067 Ga0307414_10130689
1068 Ga0307411_10007114
1069 Ga0307415_100017939
1070 Ga0373932_0011385
1071 Ga0373962_0002893
1072 Ga0373937_0006141
1073 Ga0451853_4124532
1074 Ga0439450_003270
1075 Ga0439435_0022943
1076 Ga0439440_0023963
1077 Ga0495580_0120973
1078 Ga0495594_0006315
1079 Ga0495586_0461793
1080 Ga0495598_0009136
1081 Ga0495598_0017867
1082 Ga0495621_0062376
1083 Ga0495633_0073454
1084 Ga0495656_0227201
1085 Ga0495634_0071446
1086 Ga0495658_0521220
1087 Ga0496109_0277969
1088 Ga0496112_0639648
1089 Ga0496114_0297281
1090 Ga0501031_0006256
1091 Ga0501031_0097680
1092 Ga0501031_0100896
1093 Ga0501032_0007162
1094 Ga0501032_0012895
1095 Ga0501032_0023540
1096 Ga0501033_0032866
1097 Ga0501033_0074184
1098 Ga0501033_0090650
1099 Ga0501034_0002066
1100 Ga0501034_0007781
1101 Ga0501036_0002233
1102 Ga0501036_0011154
1103 Ga0501036_0117997
1104 Ga0501036_0172538
1105 Ga0501037_0002861
1106 Ga0501037_0006859
1107 Ga0501037_0223060
1108 Ga0501038_0007195
1109 Ga0501038_0253061
1110 Ga0501038_0295166
1111 Ga0501039_0007163
1112 Ga0501039_0020408
1113 Ga0501039_0035940
1114 Ga0501039_0063604
1115 Ga0501039_0579035
1116 Ga0501040_0019433
1117 Ga0501040_0024883
1118 Ga0501040_0284532
1119 Ga0501041_0019511
1120 Ga0501042_0020309
1121 Ga0501042_0033572
1122 Ga0501042_0088625
1123 Ga0501042_0186700
1124 Ga0501042_0449120
1125 Ga0501043_0015067
1126 Ga0501043_0032528
1127 Ga0501046_0019158
1128 Ga0501046_0036447
1129 Ga0501046_0047540
1130 Ga0501046_0052533
1131 Ga0501047_0010575
1132 Ga0501048_0001033
1133 Ga0501048_0085590
1134 Ga0501067_0000440
1135 Ga0501067_0010605
1136 Ga0501068_0002561
1137 Ga0501068_0041395
1138 Ga0501068_0080826
1139 Ga0501069_0001453
1140 Ga0501069_0081532
1141 Ga0501069_0321914
1142 Ga0501070_0007051
1143 Ga0501070_0031864
1144 Ga0501071_0005370
1145 Ga0501071_0026207
1146 Ga0501072_0004696
1147 Ga0501072_0021914
1148 Ga0501072_0088300
1149 Ga0501072_0165522
1150 Ga0501073_0006457
1151 Ga0501073_0130128
1152 Ga0501074_0004576
1153 Ga0501074_0122797
1154 Ga0501075_0005504
1155 Ga0501075_0025518
1156 Ga0501076_0008756
1157 Ga0501076_0471034
1158 Ga0501223_007276
1159 Ga0501233_008959
1160 Ga0501079_0003819
1161 Ga0501079_0009242
1162 Ga0501079_0015606
1163 Ga0501079_0026030
1164 Ga0501080_0010189
1165 Ga0501080_0073057
1166 Ga0501080_0376497
1167 Ga0501081_0021575
1168 Ga0501081_0377449
1169 Ga0501083_0056975
1170 Ga0501083_0156888
1171 Ga0501035_0004470
1172 Ga0501035_0007627
1173 Ga0501035_0238217
1174 Ga0501044_0012599
1175 Ga0501044_0274220
1176 Ga0501044_0399797
1177 Ga0501045_0002302
1178 Ga0501045_0008346
1179 Ga0501045_0036689
1180 Ga0501045_0037061
1181 nmdc:mga06z11_72882_c1
1182 nmdc:mga05p37_12459_c1
1183 nmdc:mga05p37_125125_c1
1184 nmdc:mga05p37_177885_c1
1185 nmdc:mga05p37_19114_c1
1186 nmdc:mga05p37_20064_c1
1187 nmdc:mga05p37_24274_c1
1188 nmdc:mga05p37_305974_c1
1189 nmdc:mga05p37_398303_c1
1190 nmdc:mga05p37_55_c1
1191 nmdc:mga05p37_74558_c1
1192 nmdc:mga05p37_94031_c1
1193 nmdc:mga09592_115819_c1
1194 nmdc:mga09592_15373_c1
1195 nmdc:mga09592_169228_c1
1196 nmdc:mga09592_19105_c1
1197 nmdc:mga09592_695628_c1
1198 nmdc:mga09592_905_c1
1199 nmdc:mga09592_96772_c1
1200 nmdc:mga0qj67_1639_c1
1201 nmdc:mga0qj67_198334_c1
1202 nmdc:mga0qj67_23715_c1
1203 nmdc:mga0qj67_545981_c1
1204 nmdc:mga0qj67_61985_c1
1205 nmdc:mga0qj67_9329_c1
1206 nmdc:mga06r32_160614_c1
1207 nmdc:mga06r32_370113_c1
1208 nmdc:mga06r32_4004_c1
1209 nmdc:mga06r32_52951_c1
1210 nmdc:mga06r32_76191_c2
1211 nmdc:mga06r32_769134_c1
1212 nmdc:mga06r32_802276_c1
1213 nmdc:mga08y16_116_c1
1214 nmdc:mga08y16_19124_c1
1215 nmdc:mga08y16_238_c1
1216 nmdc:mga08y16_292002_c1
1217 nmdc:mga08y16_565_c1
1218 nmdc:mga08y16_871_c1
1219 nmdc:mga0n895_125670_c1
1220 nmdc:mga0n895_155439_c1
1221 nmdc:mga0n895_1933_c1
1222 nmdc:mga0n895_24022_c1
1223 nmdc:mga0n895_35707_c1
1224 nmdc:mga0n895_583487_c1
1225 nmdc:mga0rr50_100434_c1
1226 nmdc:mga0rr50_300809_c1
1227 nmdc:mga0rr50_43174_c1
1228 nmdc:mga08x19_284348_c1
1229 nmdc:mga0a205_265212_c1
1230 nmdc:mga0a205_266656_c1
1231 nmdc:mga0a205_32719_c1
1232 nmdc:mga0a205_45000_c1
1233 nmdc:mga0a205_474295_c1
1234 nmdc:mga0a205_7834_c1
1235 nmdc:mga0a205_92979_c1
1236 Ga0495601_0271802
1237 Ga0501084_0015887
1238 Ga0501084_0023137
1239 Ga0501084_0027006
1240 Ga0501084_0298723
1241 Ga0501082_0031356
1242 Ga0501082_0357147

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03741

TerC

Integral membrane protein TerC family

12

192

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.3918 9 223
6g9x-assembly2.cif.gz_B crystal structure of a mfs transporter at 2.54 angstroem resolution 0.3897 9 223
4qiq-assembly1.cif.gz_A crystal structure of d-xylose-proton symporter 0.3577 8 224
6rw3-assembly2.cif.gz_B the molecular basis for sugar import in malaria parasites. 0.3374 7 254
6rw3-assembly1.cif.gz_A the molecular basis for sugar import in malaria parasites. 0.3334 4 249
ID Description Score Start End Superfamily
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5129 14 190 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4827 14 190 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4742 13 190 1.20.1250.20
af_Q9SB41_277_479_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.471 2 194 1.20.1250.20
af_Q9Y7Q9_337_572_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4567 5 186 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A843RWC7-F1-model_v4 DUF475 domain-containing protein 0.9303 1 246 GO:0016020
AF-A0A843RWC7-F1-model_v4 DUF475 domain-containing protein 0.8888 1 246 GO:0016020
AF-A0A3N5XSW7-F1-model_v4 TerC family protein 0.8849 1 232 GO:0016020
AF-A0A7V7X4T7-F1-model_v4 DUF475 domain-containing protein 0.8773 1 241 GO:0016020
AF-A0A7V7X4T7-F1-model_v4 DUF475 domain-containing protein 0.8665 1 241 GO:0016020

Map