F470695

General Info

Members Datasets Scaffolds Average Seq Length
628 333 1256 197

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2802429296|2804846272
Length 229
Sequence QGGGSPGAATAGQRGRGAGRAPRSGRDTYTPQTLLSVAVRVFNERGYDGTSMEHLSQAAGISKSSIYHHVSSKEELLRRAVSRAIDGLFAVLDEEGAVTGRPLERAQYVTRRTVEVLVAELPYVTLLLRVRGNTDTERWALERRREFDHRVAGLFAAAVREGELRGDVEVRMATRLLFGMINSVVEWYRPDGVRQGDGGSPYEEGPLGSGAEIADAVVRIAFSGLRAQG

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
14 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
15 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
16 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
17 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
18 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
22 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
25 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
29 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
30 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
31 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
32 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
33 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
34 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
35 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
47 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
48 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
49 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
50 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
51 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
52 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
53 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
56 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
57 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
58 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
59 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
60 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
61 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
68 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
69 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
70 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
71 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
72 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
73 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
74 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
75 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
76 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
77 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
78 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
79 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
80 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
81 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
82 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
83 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
84 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
85 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
86 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
87 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
101 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
104 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
118 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
133 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
138 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
141 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
160 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
161 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
172 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
175 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
181 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
185 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
206 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
211 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
212 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
215 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
216 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
219 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
220 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
221 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
222 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
223 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
224 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
225 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
226 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
227 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
228 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
229 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
230 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
231 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
232 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
235 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
236 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
237 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
238 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
241 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
242 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
243 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
244 2558860280 Kutzneria sp. 744 Isolate Unclassified
245 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
246 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
247 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
248 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
249 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
250 2643221546 Microbacterium sp. Root53 Isolate Unclassified
251 2643221548 Streptomyces sp. Root55 Isolate Unclassified
252 2643221578 Streptomyces sp. Root63 Isolate Unclassified
253 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
254 2643221647 Streptomyces sp. Root369 Isolate Unclassified
255 2643221670 Streptomyces sp. Root431 Isolate Unclassified
256 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
257 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
258 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
259 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
260 2643221714 Streptomyces sp. Root264 Isolate Unclassified
261 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
262 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
263 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
264 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
265 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
266 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
267 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
268 2808606448 Streptomyces sp. 193411 Isolate Unclassified
269 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
270 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
271 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
272 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
273 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
274 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
275 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
276 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
277 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
278 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
279 2862574272 Streptomyces sp. AcE210 Isolate Nodule
280 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
281 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
282 2867369537 Streptomyces sp. Z26 Isolate Unclassified
283 2867428634 Streptomyces sp. RP5T Isolate Unclassified
284 2867475112 Streptomyces sp. TM32 Isolate Unclassified
285 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
286 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
287 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
288 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
289 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
290 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
291 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
292 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
293 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
294 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
295 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
296 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
297 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
298 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
299 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
300 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
301 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
302 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
303 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
304 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
305 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
306 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
307 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
308 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
309 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
310 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
311 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
312 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
313 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
314 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
315 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
316 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
317 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
318 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
319 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
320 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
321 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
322 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
323 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
324 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
325 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
326 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
327 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
328 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
329 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
330 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
331 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
332 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
333 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.08
Metatranscriptomes 0.96
Isolates 14.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.37
Nodule 0.48
Rhizoplane 0.64
Rhizosphere 79.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10016353 3300003320 Bacteria 7819
2 rootL2_10007048 3300003322 Bacteria 6486
3 rootL2_10174572 3300003322 Bacteria 1380
4 rootH1_10003675 3300003323 Bacteria 6040
5 rootH1_10003677 3300003323 Bacteria 7386
6 JGI25160J50197_1020809 3300003354 Bacteria 1968
7 Ga0006562J51391_1054860 3300003578 Bacteria 2410
8 Ga0006562J51391_1060782 3300003578 Bacteria 6102
9 Ga0006562J51391_1060783 3300003578 Bacteria 6150
10 Ga0006562J51391_1092963 3300003578 Bacteria 2140
11 Ga0006562J51391_1092964 3300003578 Bacteria 2230
12 Ga0070658_10031076 3300005327 Bacteria 4287
13 Ga0070658_10481763 3300005327 Bacteria 1071
14 Ga0070713_100044405 3300005436 Bacteria 3638
15 Ga0068867_100560299 3300005459 Bacteria 991
16 Ga0070679_100146288 3300005530 Bacteria 2341
17 Ga0070672_100766076 3300005543 Bacteria 848
18 Ga0068855_100964990 3300005563 Bacteria 897
19 Ga0081455_10092971 3300005937 Bacteria 2439
20 Ga0075363_100007729 3300006048 Bacteria 4964
21 Ga0075367_10002634 3300006178 Bacteria 8253
22 Ga0075370_10070792 3300006353 Bacteria 1995
23 Ga0099826_10127522 3300006948 Bacteria 1489
24 Ga0105251_10004396 3300009011 Bacteria 9603
25 Ga0105251_10133944 3300009011 Bacteria 1123
26 Ga0105250_10186993 3300009092 Bacteria 871
27 Ga0105240_10411771 3300009093 Bacteria 1520
28 Ga0105245_10439724 3300009098 Bacteria 1310
29 Ga0105247_10831045 3300009101 Bacteria 707
30 Ga0105035_111005 3300009988 Bacteria 798
31 Ga0105239_10968340 3300010375 Bacteria 978
32 Ga0105246_10025025 3300011119 Bacteria 3888
33 Ga0105246_10079426 3300011119 Bacteria 2333
34 Ga0105246_10204768 3300011119 Bacteria 1536
35 Ga0105246_10317502 3300011119 Bacteria 1264
36 Ga0157313_1002461 3300012503 Bacteria 1111
37 Ga0157370_10130689 3300013104 Bacteria 2342
38 Ga0157369_10480470 3300013105 Bacteria 1286
39 Ga0157515_134646 3300013875 Bacteria 798
40 Ga0182007_10001652 3300015262 Bacteria 11807
41 Ga0183367_1008 3300015688 Bacteria 490626
42 Ga0163161_10641490 3300017792 Bacteria 879
43 Ga0213875_10012840 3300021388 Bacteria 4127
44 Ga0209758_1007437 3300025297 Bacteria 7451
45 Ga0207426_1000975 3300025302 Bacteria 28256
46 Ga0207426_1021328 3300025302 Bacteria 2240
47 Ga0207426_1024873 3300025302 Bacteria 2025
48 Ga0207426_1026996 3300025302 Bacteria 1918
49 Ga0207696_1091194 3300025711 Bacteria 835
50 Ga0207713_1020149 3300025735 Bacteria 3240
51 Ga0207681_10586831 3300025923 Bacteria 920
52 Ga0207687_10671206 3300025927 Bacteria 878
53 Ga0207700_10154801 3300025928 Bacteria 1898
54 Ga0207709_10051289 3300025935 Bacteria 2529
55 Ga0207691_10272566 3300025940 Bacteria 1457
56 Ga0207667_10027174 3300025949 Bacteria 6236
57 Ga0207678_10912600 3300026067 Bacteria 777
58 Ga0207683_11111485 3300026121 Bacteria 733
59 Ga0207698_10703126 3300026142 Bacteria 1006
60 Ga0209813_10001157 3300027866 Bacteria 5888
61 Ga0307517_10002268 3300028786 Bacteria 31003
62 Ga0307517_10072935 3300028786 Bacteria 3052
63 Ga0307515_10003050 3300028794 Bacteria 35485
64 Ga0307515_10151071 3300028794 Bacteria 2427
65 Ga0268256_1024409 3300030500 Bacteria 1552
66 Ga0268256_1054508 3300030500 Bacteria 827
67 Ga0307512_10001246 3300030522 Bacteria 36723
68 Ga0307512_10016208 3300030522 Bacteria 6881
69 Ga0307512_10088373 3300030522 Bacteria 2176
70 Ga0265340_10012284 3300031247 Bacteria 4525
71 Ga0307513_10002997 3300031456 Bacteria 23028
72 Ga0307509_10106096 3300031507 Bacteria 2829
73 Ga0307509_10115679 3300031507 Bacteria 2673
74 Ga0307408_101196956 3300031548 Bacteria 709
75 Ga0307508_10012247 3300031616 Bacteria 7841
76 Ga0307508_10030071 3300031616 Bacteria 4908
77 Ga0307508_10035024 3300031616 Bacteria 4524
78 Ga0307508_10112857 3300031616 Bacteria 2318
79 Ga0307508_10186095 3300031616 Bacteria 1678
80 Ga0307514_10009095 3300031649 Bacteria 8386
81 Ga0307514_10165322 3300031649 Bacteria 1456
82 Ga0307514_10238488 3300031649 Bacteria 1092
83 Ga0307516_10002653 3300031730 Bacteria 23673
84 Ga0307516_10098834 3300031730 Bacteria 2736
85 Ga0307518_10094003 3300031838 Bacteria 2154
86 Ga0307518_10130674 3300031838 Bacteria 1765
87 Ga0307518_10143665 3300031838 Bacteria 1660
88 Ga0307410_10118495 3300031852 Bacteria 1927
89 Ga0307411_11087435 3300032005 Bacteria 720
90 Ga0307507_10041836 3300033179 Bacteria 4578
91 Ga0307507_10101203 3300033179 Bacteria 2410
92 Ga0307507_10172071 3300033179 Bacteria 1571
93 Ga0395900_0147242 3300037418 Bacteria 2408
94 Ga0395898_0003641 3300037466 Bacteria 17130
95 Ga0395898_0013698 3300037466 Bacteria 8341
96 Ga0395898_0176806 3300037466 Bacteria 2040
97 Ga0395905_0201643 3300037471 Bacteria 1865
98 Ga0395905_0316767 3300037471 Bacteria 1449
99 Ga0436364_1070783 3300037853 Bacteria 4149
100 Ga0395901_0123950 3300038443 Bacteria 2715
101 Ga0395901_0306660 3300038443 Bacteria 1645
102 Ga0439436_0002798 3300041404 Bacteria 5281
103 Ga0439436_0015067 3300041404 Bacteria 2326
104 Ga0439439_0007933 3300041406 Bacteria 2495
105 Ga0451791_0454466 3300041451 Bacteria 1114
106 Ga0451837_0559510 3300041494 Bacteria 3819
107 Ga0451853_0963314 3300041512 Bacteria 2349
108 Ga0451853_2457929 3300041512 Bacteria 1511
109 Ga0451853_2609685 3300041512 Bacteria 1359
110 Ga0439433_0000050 3300041999 Bacteria 14628
111 Ga0439448_0009839 3300042005 Bacteria 2824
112 Ga0439432_053269 3300042006 Bacteria 1259
113 Ga0439449_0002413 3300042007 Bacteria 7300
114 Ga0439449_0009514 3300042007 Bacteria 3682
115 Ga0439449_0016863 3300042007 Bacteria 2743
116 Ga0439449_0186114 3300042007 Bacteria 777
117 Ga0439457_000139 3300042014 Bacteria 18414
118 Ga0439457_000515 3300042014 Bacteria 11206
119 Ga0450894_000206 3300042131 Bacteria 10605
120 Ga0450898_000259 3300042134 Bacteria 5837
121 Ga0450899_000184 3300042135 Bacteria 6292
122 Ga0450903_001430 3300042138 Bacteria 4451
123 Ga0450906_000949 3300042145 Bacteria 6353
124 Ga0450910_021766 3300042147 Bacteria 972
125 Ga0439458_0001921 3300042157 Bacteria 5147
126 Ga0450901_014600 3300042533 Bacteria 824
127 Ga0466969_0015402 3300044656 Bacteria 4008
128 Ga0466972_0002928 3300044658 Bacteria 8463
129 Ga0466972_0010873 3300044658 Bacteria 4566
130 Ga0466972_0026830 3300044658 Bacteria 2853
131 Ga0466972_0090073 3300044658 Bacteria 1455
132 Ga0466965_0000060 3300044683 Bacteria 34483
133 Ga0466965_0042234 3300044683 Bacteria 2248
134 Ga0466965_0236800 3300044683 Bacteria 976
135 Ga0466965_0241330 3300044683 Bacteria 967
136 Ga0466966_0005326 3300044684 Bacteria 8462
137 Ga0466966_0006954 3300044684 Bacteria 7491
138 Ga0466961_0002088 3300044693 Bacteria 12452
139 Ga0466961_0007127 3300044693 Bacteria 7113
140 Ga0466961_0007347 3300044693 Bacteria 7010
141 Ga0466961_0067736 3300044693 Bacteria 2267
142 Ga0466961_0260963 3300044693 Bacteria 1062
143 Ga0466963_0000553 3300044694 Bacteria 17596
144 Ga0466963_0034396 3300044694 Bacteria 3296
145 Ga0466963_0102376 3300044694 Bacteria 1961
146 Ga0466964_0001119 3300044706 Bacteria 9012
147 Ga0466964_0034034 3300044706 Bacteria 2032
148 Ga0466971_0039028 3300044719 Bacteria 2131
149 Ga0466971_0115342 3300044719 Bacteria 1241
150 Ga0466971_0158249 3300044719 Bacteria 1059
151 Ga0466968_0255524 3300044735 Bacteria 833
152 Ga0466970_0001501 3300044765 Bacteria 11233
153 Ga0466970_0007548 3300044765 Bacteria 5454
154 Ga0466970_0010783 3300044765 Bacteria 4647
155 Ga0466970_0071676 3300044765 Bacteria 1864
156 Ga0466957_0001608 3300044842 Bacteria 11845
157 Ga0466957_0668842 3300044842 Bacteria 731
158 Ga0466960_0004666 3300044901 Bacteria 5372
159 Ga0466959_0002534 3300045049 Bacteria 11720
160 Ga0466959_0060201 3300045049 Bacteria 2763
161 Ga0466958_0000503 3300045836 Bacteria 16423
162 Ga0466958_0128465 3300045836 Bacteria 1590
163 Ga0466958_0247520 3300045836 Bacteria 1140
164 Ga0466967_0000426 3300045976 Bacteria 20050
165 Ga0466967_0103350 3300045976 Bacteria 2607
166 Ga0466967_0267080 3300045976 Bacteria 1638
167 Ga0466967_1393540 3300045976 Bacteria 698
168 Ga0495617_015765 3300046452 Bacteria 2557
169 Ga0495627_026009 3300046453 Bacteria 1892
170 Ga0495592_0050811 3300046454 Bacteria 3080
171 Ga0495592_0083001 3300046454 Bacteria 2314
172 Ga0495592_0215649 3300046454 Bacteria 1286
173 Ga0495603_0000510 3300046455 Bacteria 21610
174 Ga0495603_0002666 3300046455 Bacteria 10531
175 Ga0495603_0005036 3300046455 Bacteria 7898
176 Ga0495603_0009049 3300046455 Bacteria 6022
177 Ga0495603_0021566 3300046455 Bacteria 3901
178 Ga0495603_0053325 3300046455 Bacteria 2399
179 Ga0495603_0084851 3300046455 Bacteria 1854
180 Ga0495603_0183933 3300046455 Bacteria 1209
181 Ga0495590_0062426 3300046457 Bacteria 1304
182 Ga0495590_0122306 3300046457 Bacteria 933
183 Ga0495629_0000991 3300046459 Bacteria 22750
184 Ga0495629_0007654 3300046459 Bacteria 7955
185 Ga0495629_0014658 3300046459 Bacteria 5638
186 Ga0495629_0036881 3300046459 Bacteria 3448
187 Ga0495629_0048424 3300046459 Bacteria 2979
188 Ga0495629_0196886 3300046459 Bacteria 1393
189 Ga0495638_0032013 3300046460 Bacteria 3375
190 Ga0495638_0156580 3300046460 Bacteria 1317
191 Ga0495651_0004401 3300046462 Bacteria 10788
192 Ga0495651_0005575 3300046462 Bacteria 9593
193 Ga0495651_0008075 3300046462 Bacteria 8071
194 Ga0495653_0004385 3300046463 Bacteria 11406
195 Ga0495653_0091743 3300046463 Bacteria 2220
196 Ga0495580_0018588 3300046472 Bacteria 5173
197 Ga0495580_0230643 3300046472 Bacteria 1271
198 Ga0495582_0009367 3300046473 Bacteria 5395
199 Ga0495605_0044123 3300046474 Bacteria 2206
200 Ga0495639_0347015 3300046475 Bacteria 745
201 Ga0495662_0001413 3300046476 Bacteria 11894
202 Ga0495662_0001652 3300046476 Bacteria 11104
203 Ga0495662_0011324 3300046476 Bacteria 4358
204 Ga0495662_0413132 3300046476 Bacteria 663
205 Ga0495664_0000984 3300046477 Bacteria 14646
206 Ga0495664_0073439 3300046477 Bacteria 2045
207 Ga0495664_0131708 3300046477 Bacteria 1514
208 Ga0495585_0008583 3300046492 Bacteria 6187
209 Ga0495585_0053497 3300046492 Bacteria 2234
210 Ga0495585_0055199 3300046492 Bacteria 2195
211 Ga0495585_0233515 3300046492 Bacteria 923
212 Ga0495594_0004401 3300046499 Bacteria 7249
213 Ga0495594_0011968 3300046499 Bacteria 4513
214 Ga0495594_0135901 3300046499 Bacteria 1393
215 Ga0495607_0024559 3300046501 Bacteria 3756
216 Ga0495583_0090535 3300046506 Bacteria 1317
217 Ga0495606_0022436 3300046507 Bacteria 4599
218 Ga0495608_0001016 3300046511 Bacteria 19759
219 Ga0495608_0016487 3300046511 Bacteria 5113
220 Ga0495608_0278592 3300046511 Bacteria 1038
221 Ga0495610_0019001 3300046512 Bacteria 3860
222 Ga0495616_0047079 3300046513 Bacteria 2173
223 Ga0495618_0092516 3300046514 Bacteria 1933
224 Ga0495618_0175127 3300046514 Bacteria 1364
225 Ga0495620_0026198 3300046515 Bacteria 2744
226 Ga0495620_0201869 3300046515 Bacteria 764
227 Ga0495628_0004745 3300046516 Bacteria 11988
228 Ga0495628_0048299 3300046516 Bacteria 3374
229 Ga0495628_0161994 3300046516 Bacteria 1699
230 Ga0495628_0307391 3300046516 Bacteria 1172
231 Ga0495630_0002881 3300046517 Bacteria 11951
232 Ga0495630_0091472 3300046517 Bacteria 2298
233 Ga0495631_0009586 3300046518 Bacteria 4830
234 Ga0495643_0003170 3300046522 Bacteria 12235
235 Ga0495643_0012516 3300046522 Bacteria 5115
236 Ga0495648_0113610 3300046524 Bacteria 1468
237 Ga0495648_0333671 3300046524 Bacteria 698
238 Ga0495666_0008143 3300046526 Bacteria 5256
239 Ga0495666_0016992 3300046526 Bacteria 3621
240 Ga0495652_0090246 3300046529 Bacteria 2507
241 Ga0495652_0123721 3300046529 Bacteria 2058
242 Ga0495652_0146858 3300046529 Bacteria 1847
243 Ga0495652_0152284 3300046529 Bacteria 1805
244 Ga0495654_0050642 3300046530 Bacteria 2028
245 Ga0495665_0017613 3300046531 Bacteria 3842
246 Ga0495640_0002592 3300046533 Bacteria 14530
247 Ga0495640_0013557 3300046533 Bacteria 6194
248 Ga0495640_0023315 3300046533 Bacteria 4511
249 Ga0495640_0083248 3300046533 Bacteria 2123
250 Ga0495640_0232893 3300046533 Bacteria 1158
251 Ga0495586_0007371 3300046535 Bacteria 5871
252 Ga0495586_0017909 3300046535 Bacteria 3768
253 Ga0495587_0006290 3300046536 Bacteria 7748
254 Ga0495587_0046335 3300046536 Bacteria 2581
255 Ga0495609_0007834 3300046538 Bacteria 5283
256 Ga0495597_0017892 3300046542 Bacteria 3328
257 Ga0495645_0004974 3300046543 Bacteria 9101
258 Ga0495645_0026392 3300046543 Bacteria 4216
259 Ga0495645_0034113 3300046543 Bacteria 3714
260 Ga0495622_0149637 3300046557 Bacteria 1057
261 Ga0495622_0152964 3300046557 Bacteria 1043
262 Ga0495633_0046575 3300046558 Bacteria 2051
263 Ga0495667_0047747 3300046559 Bacteria 2827
264 Ga0495667_0189297 3300046559 Bacteria 1319
265 Ga0495656_0016433 3300046615 Bacteria 2808
266 Ga0495668_0017356 3300046616 Bacteria 4175
267 Ga0495668_0171716 3300046616 Bacteria 1188
268 Ga0495634_0002279 3300046642 Bacteria 16055
269 Ga0495634_0007524 3300046642 Bacteria 8164
270 Ga0495634_0017207 3300046642 Bacteria 5162
271 Ga0495611_0042284 3300046648 Bacteria 2034
272 Ga0495611_0076988 3300046648 Bacteria 1529
273 Ga0495625_0034657 3300046660 Bacteria 3724
274 Ga0495625_0040758 3300046660 Bacteria 3383
275 Ga0495625_0056875 3300046660 Bacteria 2783
276 Ga0495625_0074232 3300046660 Bacteria 2382
277 Ga0495625_0093345 3300046660 Bacteria 2078
278 Ga0495635_0008560 3300046663 Bacteria 7144
279 Ga0495635_0027663 3300046663 Bacteria 3943
280 Ga0495635_0075170 3300046663 Bacteria 2314
281 Ga0495635_0080769 3300046663 Bacteria 2225
282 Ga0495661_0006781 3300046665 Bacteria 8028
283 Ga0495661_0104445 3300046665 Bacteria 1589
284 Ga0495588_0001271 3300046674 Bacteria 10818
285 Ga0495588_0004977 3300046674 Bacteria 5901
286 Ga0495588_0010506 3300046674 Bacteria 4306
287 Ga0495588_0122635 3300046674 Bacteria 1370
288 Ga0495588_0279304 3300046674 Bacteria 880
289 Ga0495657_0017510 3300046675 Bacteria 5199
290 Ga0495657_0041640 3300046675 Bacteria 3141
291 Ga0495657_0058221 3300046675 Bacteria 2566
292 Ga0495657_0077556 3300046675 Bacteria 2155
293 Ga0495657_0091966 3300046675 Bacteria 1944
294 Ga0495657_0305749 3300046675 Bacteria 947
295 Ga0495599_0026109 3300046678 Bacteria 3659
296 Ga0495599_0051328 3300046678 Bacteria 2584
297 Ga0495623_0026747 3300046679 Bacteria 3712
298 Ga0495623_0121860 3300046679 Bacteria 1569
299 Ga0495646_0004567 3300046680 Bacteria 8724
300 Ga0495646_0006503 3300046680 Bacteria 7413
301 Ga0495658_0160497 3300046683 Bacteria 1386
302 Ga0495613_0004215 3300046689 Bacteria 10766
303 Ga0495613_0005432 3300046689 Bacteria 9574
304 Ga0495613_0009374 3300046689 Bacteria 7263
305 Ga0495613_0019229 3300046689 Bacteria 5092
306 Ga0495613_0029956 3300046689 Bacteria 4043
307 Ga0495613_0044874 3300046689 Bacteria 3269
308 Ga0495613_0051383 3300046689 Bacteria 3038
309 Ga0495613_0071665 3300046689 Bacteria 2525
310 Ga0495613_0174471 3300046689 Bacteria 1524
311 Ga0495624_0294704 3300046690 Bacteria 978
312 Ga0495624_0300499 3300046690 Bacteria 968
313 Ga0495670_0003522 3300046691 Bacteria 7684
314 Ga0495670_0012346 3300046691 Bacteria 4199
315 Ga0495671_0024157 3300046692 Bacteria 3169
316 Ga0495671_0034981 3300046692 Bacteria 2553
317 Ga0495649_0180745 3300046694 Bacteria 1100
318 Ga0495589_0023307 3300046794 Bacteria 3155
319 Ga0495589_0031830 3300046794 Bacteria 2654
320 Ga0495589_0122693 3300046794 Bacteria 1250
321 Ga0495600_0003553 3300046809 Bacteria 9177
322 Ga0495600_0014634 3300046809 Bacteria 4945
323 Ga0495600_0159868 3300046809 Bacteria 1456
324 Ga0495660_0081563 3300046810 Bacteria 1695
325 Ga0495660_0183378 3300046810 Bacteria 1011
326 Ga0495581_0005227 3300047315 Bacteria 7510
327 Ga0495581_0043261 3300047315 Bacteria 2605
328 Ga0495581_0049256 3300047315 Bacteria 2432
329 Ga0495581_0190531 3300047315 Bacteria 1199
330 Ga0495581_0371175 3300047315 Bacteria 835
331 Ga0495604_0000211 3300047317 Bacteria 53509
332 Ga0495604_0001159 3300047317 Bacteria 21787
333 Ga0495604_0008612 3300047317 Bacteria 8065
334 Ga0495604_0109466 3300047317 Bacteria 2016
335 Ga0495604_0280207 3300047317 Bacteria 1126
336 Ga0495636_0000900 3300047318 Bacteria 11038
337 Ga0495636_0008155 3300047318 Bacteria 4128
338 Ga0495636_0042236 3300047318 Bacteria 1894
339 Ga0495636_0047674 3300047318 Bacteria 1789
340 Ga0495636_0067873 3300047318 Bacteria 1518
341 Ga0495674_0032121 3300047319 Bacteria 4764
342 Ga0495672_0043181 3300047320 Bacteria 2712
343 Ga0495676_0000599 3300047321 Bacteria 29838
344 Ga0495676_0001886 3300047321 Bacteria 18381
345 Ga0495676_0003611 3300047321 Bacteria 14038
346 Ga0495676_0004226 3300047321 Bacteria 13116
347 Ga0495676_0006088 3300047321 Bacteria 11095
348 Ga0495676_0088943 3300047321 Bacteria 2314
349 Ga0495676_0185857 3300047321 Bacteria 1453
350 Ga0495680_0057024 3300047322 Bacteria 3023
351 Ga0495683_0046455 3300047323 Bacteria 2179
352 Ga0495683_0211942 3300047323 Bacteria 868
353 Ga0495687_001906 3300047443 Bacteria 17911
354 Ga0495687_007165 3300047443 Bacteria 6641
355 Ga0495687_030845 3300047443 Bacteria 2465
356 Ga0495687_096165 3300047443 Bacteria 1121
357 Ga0495687_144659 3300047443 Bacteria 821
358 Ga0495675_0004301 3300047444 Bacteria 8616
359 Ga0495675_0026934 3300047444 Bacteria 3664
360 Ga0495685_001686 3300047447 Bacteria 6811
361 Ga0495685_006326 3300047447 Bacteria 3870
362 Ga0495685_007597 3300047447 Bacteria 3585
363 Ga0495685_024334 3300047447 Bacteria 2083
364 Ga0495685_135794 3300047447 Bacteria 803
365 Ga0495681_0001653 3300047470 Bacteria 16549
366 Ga0495681_0002300 3300047470 Bacteria 13739
367 Ga0495681_0013050 3300047470 Bacteria 4848
368 Ga0495684_0022079 3300047471 Bacteria 4899
369 Ga0495684_0189322 3300047471 Bacteria 1522
370 Ga0495686_0032661 3300047472 Bacteria 3366
371 Ga0495686_0063147 3300047472 Bacteria 2296
372 Ga0495686_0102752 3300047472 Bacteria 1722
373 Ga0495686_0153802 3300047472 Bacteria 1349
374 Ga0495686_0283216 3300047472 Bacteria 920
375 Ga0495593_0001619 3300047673 Bacteria 13317
376 Ga0495593_0002687 3300047673 Bacteria 10697
377 Ga0495593_0021808 3300047673 Bacteria 3573
378 Ga0495593_0041431 3300047673 Bacteria 2475
379 Ga0495602_0027195 3300048088 Bacteria 5503
380 Ga0495602_0058354 3300048088 Bacteria 3378
381 Ga0495614_0000179 3300048089 Bacteria 23615
382 Ga0495614_0023627 3300048089 Bacteria 2653
383 Ga0495626_0011395 3300048091 Bacteria 4705
384 Ga0496106_0043092 3300048909 Bacteria 3386
385 Ga0496109_0215427 3300048912 Bacteria 1806
386 Ga0495682_0009713 3300049460 Bacteria 3749
387 Ga0501318_043771 3300049534 Bacteria 648
388 Ga0501031_0007014 3300049568 Bacteria 7355
389 Ga0501031_0115687 3300049568 Bacteria 1752
390 Ga0501031_0226727 3300049568 Bacteria 1216
391 Ga0501031_0266443 3300049568 Bacteria 1113
392 Ga0501031_0315609 3300049568 Bacteria 1013
393 Ga0501031_0416914 3300049568 Bacteria 868
394 Ga0501032_0010483 3300049569 Bacteria 6684
395 Ga0501032_0011822 3300049569 Bacteria 6252
396 Ga0501032_0090177 3300049569 Bacteria 2034
397 Ga0501032_0128358 3300049569 Bacteria 1674
398 Ga0501032_0165162 3300049569 Bacteria 1453
399 Ga0501032_0263636 3300049569 Bacteria 1117
400 Ga0501033_0001480 3300049570 Bacteria 20793
401 Ga0501033_0001506 3300049570 Bacteria 20631
402 Ga0501033_0050675 3300049570 Bacteria 3078
403 Ga0501033_0144712 3300049570 Bacteria 1717
404 Ga0501033_0221575 3300049570 Bacteria 1346
405 Ga0501033_0266112 3300049570 Bacteria 1212
406 Ga0501033_0341645 3300049570 Bacteria 1049
407 Ga0501034_0006298 3300049571 Bacteria 12772
408 Ga0501034_0026657 3300049571 Bacteria 5881
409 Ga0501034_0030753 3300049571 Bacteria 5457
410 Ga0501034_0041983 3300049571 Bacteria 4629
411 Ga0501034_0042321 3300049571 Bacteria 4611
412 Ga0501034_0068437 3300049571 Bacteria 3560
413 Ga0501034_0069191 3300049571 Bacteria 3540
414 Ga0501034_0104680 3300049571 Bacteria 2823
415 Ga0501034_0126626 3300049571 Bacteria 2539
416 Ga0501034_0372716 3300049571 Bacteria 1353
417 Ga0501036_0002034 3300049572 Bacteria 15749
418 Ga0501036_0012527 3300049572 Bacteria 7032
419 Ga0501036_0017003 3300049572 Bacteria 6078
420 Ga0501036_0026404 3300049572 Bacteria 4902
421 Ga0501036_0029586 3300049572 Bacteria 4626
422 Ga0501036_0046987 3300049572 Bacteria 3656
423 Ga0501036_0156735 3300049572 Bacteria 1920
424 Ga0501037_0001923 3300049573 Bacteria 15061
425 Ga0501037_0045364 3300049573 Bacteria 3227
426 Ga0501037_0057516 3300049573 Bacteria 2839
427 Ga0501037_0344991 3300049573 Bacteria 1028
428 Ga0501037_0346121 3300049573 Bacteria 1026
429 Ga0501038_0005683 3300049574 Bacteria 11570
430 Ga0501038_0010160 3300049574 Bacteria 8616
431 Ga0501038_0011098 3300049574 Bacteria 8226
432 Ga0501038_0020289 3300049574 Bacteria 5978
433 Ga0501038_0029661 3300049574 Bacteria 4845
434 Ga0501038_0037323 3300049574 Bacteria 4260
435 Ga0501038_0045094 3300049574 Bacteria 3828
436 Ga0501038_0183296 3300049574 Bacteria 1688
437 Ga0501038_0423789 3300049574 Bacteria 1026
438 Ga0501039_0003937 3300049575 Bacteria 11160
439 Ga0501039_0038963 3300049575 Bacteria 3671
440 Ga0501039_0094967 3300049575 Bacteria 2324
441 Ga0501039_0581659 3300049575 Bacteria 878
442 Ga0501041_0420317 3300049577 Bacteria 848
443 Ga0501042_0010820 3300049578 Bacteria 6134
444 Ga0501043_0001557 3300049579 Bacteria 19966
445 Ga0501043_0021420 3300049579 Bacteria 5067
446 Ga0501043_0040875 3300049579 Bacteria 3644
447 Ga0501043_0073639 3300049579 Bacteria 2683
448 Ga0501043_0121901 3300049579 Bacteria 2045
449 Ga0501046_0003702 3300049580 Bacteria 14000
450 Ga0501047_0000075 3300049581 Bacteria 124995
451 Ga0501047_0007963 3300049581 Bacteria 9993
452 Ga0501047_0016028 3300049581 Bacteria 7146
453 Ga0501047_0017101 3300049581 Bacteria 6935
454 Ga0501047_0025302 3300049581 Bacteria 5704
455 Ga0501047_0081836 3300049581 Bacteria 3104
456 Ga0501047_0085009 3300049581 Bacteria 3040
457 Ga0501047_0088934 3300049581 Bacteria 2966
458 Ga0501047_0599381 3300049581 Bacteria 923
459 Ga0501048_0006364 3300049582 Bacteria 8975
460 Ga0501048_0323987 3300049582 Bacteria 1098
461 Ga0501069_0648350 3300049585 Bacteria 635
462 Ga0501070_0006480 3300049586 Bacteria 9964
463 Ga0501070_0017821 3300049586 Bacteria 5962
464 Ga0501070_0018816 3300049586 Bacteria 5794
465 Ga0501070_0275190 3300049586 Bacteria 1374
466 Ga0501070_0403087 3300049586 Bacteria 1106
467 Ga0501074_0000911 3300049590 Bacteria 18917
468 Ga0501074_0032063 3300049590 Bacteria 3809
469 Ga0501225_0130928 3300049705 Bacteria 752
470 Ga0501080_0605030 3300049742 Bacteria 973
471 Ga0501080_0643372 3300049742 Bacteria 939
472 Ga0501266_015936 3300049763 Bacteria 996
473 Ga0501282_007779 3300049778 Bacteria 1146
474 Ga0501035_0015067 3300049822 Bacteria 7133
475 Ga0501035_0047701 3300049822 Bacteria 3843
476 Ga0501035_0049999 3300049822 Bacteria 3747
477 Ga0501035_0074955 3300049822 Bacteria 2992
478 Ga0501035_0233434 3300049822 Bacteria 1567
479 Ga0501035_0562217 3300049822 Bacteria 933
480 Ga0501035_0726315 3300049822 Bacteria 799
481 Ga0501044_0011088 3300049823 Bacteria 9777
482 Ga0501044_0011456 3300049823 Bacteria 9606
483 Ga0501044_0016513 3300049823 Bacteria 7924
484 Ga0501044_0031335 3300049823 Bacteria 5597
485 Ga0501044_0055110 3300049823 Bacteria 4084
486 Ga0501044_0058110 3300049823 Bacteria 3967
487 Ga0501044_0165257 3300049823 Bacteria 2187
488 Ga0501044_0173311 3300049823 Bacteria 2127
489 Ga0501044_0224110 3300049823 Bacteria 1830
490 Ga0501044_0259589 3300049823 Bacteria 1676
491 Ga0501044_0517965 3300049823 Bacteria 1092
492 Ga0501044_0599098 3300049823 Bacteria 995
493 Ga0501045_0081155 3300049824 Bacteria 2391
494 Ga0501045_0261973 3300049824 Bacteria 1287
495 Ga0501045_0841148 3300049824 Bacteria 675
496 nmdc:mga06z11_1981_c1 3300050494 Bacteria 7744
497 nmdc:mga04h51_4079_c1 3300050495 Bacteria 3600
498 nmdc:mga07m45_55120_c1 3300050496 Bacteria 2247
499 Ga0495601_0012628 3300053077 Bacteria 5066
500 Ga0495601_0411023 3300053077 Bacteria 877
501 Ga0495612_0065949 3300053078 Bacteria 1504
502 Ga0500610_0095063 3300053079 Bacteria 1546
503 Ga0495655_0008427 3300053083 Bacteria 1958
504 Ga0495619_0024797 3300053085 Bacteria 3848
505 Ga0495619_0042602 3300053085 Bacteria 2974
506 Ga0500578_0061538 3300053086 Bacteria 2396
507 Ga0500651_0214514 3300053093 Bacteria 1131
508 Ga0500640_103106 3300053095 Bacteria 1175
509 Ga0500553_015273 3300053101 Bacteria 3897
510 Ga0500553_076027 3300053101 Bacteria 1528
511 Ga0500553_108697 3300053101 Bacteria 1173
512 Ga0500560_001863 3300053107 Bacteria 3832
513 Ga0500560_050141 3300053107 Bacteria 1337
514 Ga0500569_002778 3300053109 Bacteria 3489
515 Ga0500614_043629 3300053123 Bacteria 1150
516 Ga0500628_000714 3300053129 Bacteria 5917
517 Ga0500652_001077 3300053131 Bacteria 8841
518 Ga0500658_0018414 3300053134 Bacteria 2617
519 Ga0500559_0179989 3300053136 Bacteria 996
520 Ga0500561_0003513 3300053137 Bacteria 2754
521 Ga0500573_0008555 3300053140 Bacteria 5640
522 Ga0500573_0032919 3300053140 Bacteria 2991
523 Ga0500573_0095744 3300053140 Bacteria 1674
524 Ga0500579_029336 3300053143 Bacteria 3537
525 Ga0500600_0028759 3300053149 Bacteria 3286
526 Ga0500616_0031948 3300053153 Bacteria 2879
527 Ga0500624_010645 3300053157 Bacteria 1329
528 Ga0500633_0004536 3300053160 Bacteria 3200
529 Ga0500584_157733 3300053726 Bacteria 835
530 Ga0500656_000789 3300053732 Bacteria 2504
531 Ga0500587_002317 3300053739 Bacteria 2707
532 Ga0501084_0455342 3300054114 Bacteria 1082
533 Ga0466962_0002713 3300061719 Bacteria 8414
534 Ga0466962_0239429 3300061719 Bacteria 890
535 2804846272 2802429296 Bacteria 7227771
536 2547406178 2547132111 Bacteria 8013147
537 2554257444 2554235005 Bacteria 6457341
538 2559425558 2558860280 Bacteria 11429938
539 2585298376 2582581312 Bacteria 7308206
540 2585305680 2582581313 Bacteria 10042643
541 2585312618 2582581314 Bacteria 11452267
542 2616702744 2616644814 Bacteria 11555299
543 2616904121 2616644941 Bacteria 8510691
544 2643753320 2643221546 Bacteria 2910897
545 2643763220 2643221548 Bacteria 8053412
546 2643900263 2643221578 Bacteria 9213798
547 2643948006 2643221587 Bacteria 7586415
548 2644262795 2643221647 Bacteria 10741251
549 2644390572 2643221670 Bacteria 6497041
550 2644405513 2643221673 Bacteria 9196637
551 2644433872 2643221677 Bacteria 7584031
552 2644443006 2643221678 Bacteria 9540101
553 2644463910 2643221682 Bacteria 6743283
554 2644628379 2643221714 Bacteria 9015452
555 2784589103 2784132148 Bacteria 8627943
556 2785342745 2784746763 Bacteria 9783172
557 2785370170 2784746768 Bacteria 10036182
558 2786671136 2786546132 Bacteria 10419719
559 2793983636 2791355406 Bacteria 11364898
560 2808842571 2808606359 Bacteria 9866990
561 2808921077 2808606375 Bacteria 9466072
562 2809232705 2808606448 Bacteria 8656184
563 2811845663 2808606982 Bacteria 7791042
564 2812357544 2811994879 Bacteria 9313447
565 2812480054 2811994917 Bacteria 7761064
566 2819697464 2818991463 Bacteria 7948711
567 2852637382 2852635781 Bacteria 8251373
568 2862178867 2862178590 Bacteria 8583590
569 2862286164 2862281513 Bacteria 9621493
570 2862292032 2862290372 Bacteria 7471434
571 2862389715 2862382967 Bacteria 10317375
572 2862516405 2862507626 Bacteria 9425308
573 2862578751 2862574272 Bacteria 10567477
574 2863412639 2863404153 Bacteria 9672205
575 2867347575 2867346516 Bacteria 7608576
576 2867372389 2867369537 Bacteria 6501581
577 2867432665 2867428634 Bacteria 9590268
578 2867475291 2867475112 Bacteria 6909112
579 2873155247 2873151551 Bacteria 8625867
580 2875395098 2875391855 Bacteria 7600475
581 2877680566 2877676314 Bacteria 9512378
582 2912719217 2912715099 Bacteria 9460473
583 2912724034 2912723979 Bacteria 8557534
584 2912731495 2912723979 Bacteria 8557534
585 2912761417 2912757875 Bacteria 7940295
586 2918504997 2918501144 Bacteria 8668083
587 2919475527 2919468124 Bacteria 9133025
588 2928146593 2928142448 Bacteria 5288925
589 2935390705 2935390628 Bacteria 7043367
590 2946049399 2946045630 Bacteria 8527308
591 2946068331 2946064051 Bacteria 8957905
592 2947228576 2947224130 Bacteria 9938529
593 2954006947 2954002825 Bacteria 9173742
594 2954385682 2954380949 Bacteria 10050426
595 2954677468 2954673503 Bacteria 9685905
596 2954686686 2954682443 Bacteria 9862841
597 2954696332 2954691527 Bacteria 10720516
598 2954711495 2954701450 Bacteria 10834262
599 2954715698 2954711539 Bacteria 10867210
600 2954725635 2954721474 Bacteria 10456478
601 2954736177 2954731030 Bacteria 10243860
602 2954744574 2954740390 Bacteria 10229294
603 2954755024 2954749733 Bacteria 10366972
604 2954763557 2954759201 Bacteria 9358192
605 2966602186 2966598605 Bacteria 7676064
606 2990061549 2990059506 Bacteria 9321252
607 2990094386 2990088156 Bacteria 6657676
608 2995468827 2995463766 Bacteria 8577691
609 2997458951 2997451912 Bacteria 8492419
610 2997604577 2997600082 Bacteria 9896405
611 3006398090 3006393351 Bacteria 6615579
612 3006425825 3006425503 Bacteria 6491253
613 3006488553 3006486233 Bacteria 8157040
614 3006499485 3006493962 Bacteria 8825450
615 8008578402 8008574985 Bacteria 7815457
616 8025416090 8025413630 Bacteria 7014048
617 8025534518 8025530807 Bacteria 8495698
618 8033687003 8033684223 Bacteria 6906479
619 8047897505 8047893842 Bacteria 11723082
620 8048127907 8048127548 Bacteria 11053136
621 8048361365 8048356638 Bacteria 11044339
622 8048374492 8048369669 Bacteria 11666822
623 8048383730 8048379754 Bacteria 11877923
624 8048410303 8048406513 Bacteria 8936924
625 8054160957 8054160619 Bacteria 7783213
626 8055072228 8055066027 Bacteria 9479577
627 8056452890 8056447290 Bacteria 7680491
628 8056837960 8056829672 Bacteria 9045328
629 rootH2_10016353
630 rootL2_10007048
631 rootL2_10174572
632 rootH1_10003675
633 rootH1_10003677
634 JGI25160J50197_1020809
635 Ga0006562J51391_1054860
636 Ga0006562J51391_1060782
637 Ga0006562J51391_1060783
638 Ga0006562J51391_1092963
639 Ga0006562J51391_1092964
640 Ga0070658_10031076
641 Ga0070658_10481763
642 Ga0070713_100044405
643 Ga0068867_100560299
644 Ga0070679_100146288
645 Ga0070672_100766076
646 Ga0068855_100964990
647 Ga0081455_10092971
648 Ga0075363_100007729
649 Ga0075367_10002634
650 Ga0075370_10070792
651 Ga0099826_10127522
652 Ga0105251_10004396
653 Ga0105251_10133944
654 Ga0105250_10186993
655 Ga0105240_10411771
656 Ga0105245_10439724
657 Ga0105247_10831045
658 Ga0105035_111005
659 Ga0105239_10968340
660 Ga0105246_10025025
661 Ga0105246_10079426
662 Ga0105246_10204768
663 Ga0105246_10317502
664 Ga0157313_1002461
665 Ga0157370_10130689
666 Ga0157369_10480470
667 Ga0157515_134646
668 Ga0182007_10001652
669 Ga0183367_1008
670 Ga0163161_10641490
671 Ga0213875_10012840
672 Ga0209758_1007437
673 Ga0207426_1000975
674 Ga0207426_1021328
675 Ga0207426_1024873
676 Ga0207426_1026996
677 Ga0207696_1091194
678 Ga0207713_1020149
679 Ga0207681_10586831
680 Ga0207687_10671206
681 Ga0207700_10154801
682 Ga0207709_10051289
683 Ga0207691_10272566
684 Ga0207667_10027174
685 Ga0207678_10912600
686 Ga0207683_11111485
687 Ga0207698_10703126
688 Ga0209813_10001157
689 Ga0307517_10002268
690 Ga0307517_10072935
691 Ga0307515_10003050
692 Ga0307515_10151071
693 Ga0268256_1024409
694 Ga0268256_1054508
695 Ga0307512_10001246
696 Ga0307512_10016208
697 Ga0307512_10088373
698 Ga0265340_10012284
699 Ga0307513_10002997
700 Ga0307509_10106096
701 Ga0307509_10115679
702 Ga0307408_101196956
703 Ga0307508_10012247
704 Ga0307508_10030071
705 Ga0307508_10035024
706 Ga0307508_10112857
707 Ga0307508_10186095
708 Ga0307514_10009095
709 Ga0307514_10165322
710 Ga0307514_10238488
711 Ga0307516_10002653
712 Ga0307516_10098834
713 Ga0307518_10094003
714 Ga0307518_10130674
715 Ga0307518_10143665
716 Ga0307410_10118495
717 Ga0307411_11087435
718 Ga0307507_10041836
719 Ga0307507_10101203
720 Ga0307507_10172071
721 Ga0395900_0147242
722 Ga0395898_0003641
723 Ga0395898_0013698
724 Ga0395898_0176806
725 Ga0395905_0201643
726 Ga0395905_0316767
727 Ga0436364_1070783
728 Ga0395901_0123950
729 Ga0395901_0306660
730 Ga0439436_0002798
731 Ga0439436_0015067
732 Ga0439439_0007933
733 Ga0451791_0454466
734 Ga0451837_0559510
735 Ga0451853_0963314
736 Ga0451853_2457929
737 Ga0451853_2609685
738 Ga0439433_0000050
739 Ga0439448_0009839
740 Ga0439432_053269
741 Ga0439449_0002413
742 Ga0439449_0009514
743 Ga0439449_0016863
744 Ga0439449_0186114
745 Ga0439457_000139
746 Ga0439457_000515
747 Ga0450894_000206
748 Ga0450898_000259
749 Ga0450899_000184
750 Ga0450903_001430
751 Ga0450906_000949
752 Ga0450910_021766
753 Ga0439458_0001921
754 Ga0450901_014600
755 Ga0466969_0015402
756 Ga0466972_0002928
757 Ga0466972_0010873
758 Ga0466972_0026830
759 Ga0466972_0090073
760 Ga0466965_0000060
761 Ga0466965_0042234
762 Ga0466965_0236800
763 Ga0466965_0241330
764 Ga0466966_0005326
765 Ga0466966_0006954
766 Ga0466961_0002088
767 Ga0466961_0007127
768 Ga0466961_0007347
769 Ga0466961_0067736
770 Ga0466961_0260963
771 Ga0466963_0000553
772 Ga0466963_0034396
773 Ga0466963_0102376
774 Ga0466964_0001119
775 Ga0466964_0034034
776 Ga0466971_0039028
777 Ga0466971_0115342
778 Ga0466971_0158249
779 Ga0466968_0255524
780 Ga0466970_0001501
781 Ga0466970_0007548
782 Ga0466970_0010783
783 Ga0466970_0071676
784 Ga0466957_0001608
785 Ga0466957_0668842
786 Ga0466960_0004666
787 Ga0466959_0002534
788 Ga0466959_0060201
789 Ga0466958_0000503
790 Ga0466958_0128465
791 Ga0466958_0247520
792 Ga0466967_0000426
793 Ga0466967_0103350
794 Ga0466967_0267080
795 Ga0466967_1393540
796 Ga0495617_015765
797 Ga0495627_026009
798 Ga0495592_0050811
799 Ga0495592_0083001
800 Ga0495592_0215649
801 Ga0495603_0000510
802 Ga0495603_0002666
803 Ga0495603_0005036
804 Ga0495603_0009049
805 Ga0495603_0021566
806 Ga0495603_0053325
807 Ga0495603_0084851
808 Ga0495603_0183933
809 Ga0495590_0062426
810 Ga0495590_0122306
811 Ga0495629_0000991
812 Ga0495629_0007654
813 Ga0495629_0014658
814 Ga0495629_0036881
815 Ga0495629_0048424
816 Ga0495629_0196886
817 Ga0495638_0032013
818 Ga0495638_0156580
819 Ga0495651_0004401
820 Ga0495651_0005575
821 Ga0495651_0008075
822 Ga0495653_0004385
823 Ga0495653_0091743
824 Ga0495580_0018588
825 Ga0495580_0230643
826 Ga0495582_0009367
827 Ga0495605_0044123
828 Ga0495639_0347015
829 Ga0495662_0001413
830 Ga0495662_0001652
831 Ga0495662_0011324
832 Ga0495662_0413132
833 Ga0495664_0000984
834 Ga0495664_0073439
835 Ga0495664_0131708
836 Ga0495585_0008583
837 Ga0495585_0053497
838 Ga0495585_0055199
839 Ga0495585_0233515
840 Ga0495594_0004401
841 Ga0495594_0011968
842 Ga0495594_0135901
843 Ga0495607_0024559
844 Ga0495583_0090535
845 Ga0495606_0022436
846 Ga0495608_0001016
847 Ga0495608_0016487
848 Ga0495608_0278592
849 Ga0495610_0019001
850 Ga0495616_0047079
851 Ga0495618_0092516
852 Ga0495618_0175127
853 Ga0495620_0026198
854 Ga0495620_0201869
855 Ga0495628_0004745
856 Ga0495628_0048299
857 Ga0495628_0161994
858 Ga0495628_0307391
859 Ga0495630_0002881
860 Ga0495630_0091472
861 Ga0495631_0009586
862 Ga0495643_0003170
863 Ga0495643_0012516
864 Ga0495648_0113610
865 Ga0495648_0333671
866 Ga0495666_0008143
867 Ga0495666_0016992
868 Ga0495652_0090246
869 Ga0495652_0123721
870 Ga0495652_0146858
871 Ga0495652_0152284
872 Ga0495654_0050642
873 Ga0495665_0017613
874 Ga0495640_0002592
875 Ga0495640_0013557
876 Ga0495640_0023315
877 Ga0495640_0083248
878 Ga0495640_0232893
879 Ga0495586_0007371
880 Ga0495586_0017909
881 Ga0495587_0006290
882 Ga0495587_0046335
883 Ga0495609_0007834
884 Ga0495597_0017892
885 Ga0495645_0004974
886 Ga0495645_0026392
887 Ga0495645_0034113
888 Ga0495622_0149637
889 Ga0495622_0152964
890 Ga0495633_0046575
891 Ga0495667_0047747
892 Ga0495667_0189297
893 Ga0495656_0016433
894 Ga0495668_0017356
895 Ga0495668_0171716
896 Ga0495634_0002279
897 Ga0495634_0007524
898 Ga0495634_0017207
899 Ga0495611_0042284
900 Ga0495611_0076988
901 Ga0495625_0034657
902 Ga0495625_0040758
903 Ga0495625_0056875
904 Ga0495625_0074232
905 Ga0495625_0093345
906 Ga0495635_0008560
907 Ga0495635_0027663
908 Ga0495635_0075170
909 Ga0495635_0080769
910 Ga0495661_0006781
911 Ga0495661_0104445
912 Ga0495588_0001271
913 Ga0495588_0004977
914 Ga0495588_0010506
915 Ga0495588_0122635
916 Ga0495588_0279304
917 Ga0495657_0017510
918 Ga0495657_0041640
919 Ga0495657_0058221
920 Ga0495657_0077556
921 Ga0495657_0091966
922 Ga0495657_0305749
923 Ga0495599_0026109
924 Ga0495599_0051328
925 Ga0495623_0026747
926 Ga0495623_0121860
927 Ga0495646_0004567
928 Ga0495646_0006503
929 Ga0495658_0160497
930 Ga0495613_0004215
931 Ga0495613_0005432
932 Ga0495613_0009374
933 Ga0495613_0019229
934 Ga0495613_0029956
935 Ga0495613_0044874
936 Ga0495613_0051383
937 Ga0495613_0071665
938 Ga0495613_0174471
939 Ga0495624_0294704
940 Ga0495624_0300499
941 Ga0495670_0003522
942 Ga0495670_0012346
943 Ga0495671_0024157
944 Ga0495671_0034981
945 Ga0495649_0180745
946 Ga0495589_0023307
947 Ga0495589_0031830
948 Ga0495589_0122693
949 Ga0495600_0003553
950 Ga0495600_0014634
951 Ga0495600_0159868
952 Ga0495660_0081563
953 Ga0495660_0183378
954 Ga0495581_0005227
955 Ga0495581_0043261
956 Ga0495581_0049256
957 Ga0495581_0190531
958 Ga0495581_0371175
959 Ga0495604_0000211
960 Ga0495604_0001159
961 Ga0495604_0008612
962 Ga0495604_0109466
963 Ga0495604_0280207
964 Ga0495636_0000900
965 Ga0495636_0008155
966 Ga0495636_0042236
967 Ga0495636_0047674
968 Ga0495636_0067873
969 Ga0495674_0032121
970 Ga0495672_0043181
971 Ga0495676_0000599
972 Ga0495676_0001886
973 Ga0495676_0003611
974 Ga0495676_0004226
975 Ga0495676_0006088
976 Ga0495676_0088943
977 Ga0495676_0185857
978 Ga0495680_0057024
979 Ga0495683_0046455
980 Ga0495683_0211942
981 Ga0495687_001906
982 Ga0495687_007165
983 Ga0495687_030845
984 Ga0495687_096165
985 Ga0495687_144659
986 Ga0495675_0004301
987 Ga0495675_0026934
988 Ga0495685_001686
989 Ga0495685_006326
990 Ga0495685_007597
991 Ga0495685_024334
992 Ga0495685_135794
993 Ga0495681_0001653
994 Ga0495681_0002300
995 Ga0495681_0013050
996 Ga0495684_0022079
997 Ga0495684_0189322
998 Ga0495686_0032661
999 Ga0495686_0063147
1000 Ga0495686_0102752
1001 Ga0495686_0153802
1002 Ga0495686_0283216
1003 Ga0495593_0001619
1004 Ga0495593_0002687
1005 Ga0495593_0021808
1006 Ga0495593_0041431
1007 Ga0495602_0027195
1008 Ga0495602_0058354
1009 Ga0495614_0000179
1010 Ga0495614_0023627
1011 Ga0495626_0011395
1012 Ga0496106_0043092
1013 Ga0496109_0215427
1014 Ga0495682_0009713
1015 Ga0501318_043771
1016 Ga0501031_0007014
1017 Ga0501031_0115687
1018 Ga0501031_0226727
1019 Ga0501031_0266443
1020 Ga0501031_0315609
1021 Ga0501031_0416914
1022 Ga0501032_0010483
1023 Ga0501032_0011822
1024 Ga0501032_0090177
1025 Ga0501032_0128358
1026 Ga0501032_0165162
1027 Ga0501032_0263636
1028 Ga0501033_0001480
1029 Ga0501033_0001506
1030 Ga0501033_0050675
1031 Ga0501033_0144712
1032 Ga0501033_0221575
1033 Ga0501033_0266112
1034 Ga0501033_0341645
1035 Ga0501034_0006298
1036 Ga0501034_0026657
1037 Ga0501034_0030753
1038 Ga0501034_0041983
1039 Ga0501034_0042321
1040 Ga0501034_0068437
1041 Ga0501034_0069191
1042 Ga0501034_0104680
1043 Ga0501034_0126626
1044 Ga0501034_0372716
1045 Ga0501036_0002034
1046 Ga0501036_0012527
1047 Ga0501036_0017003
1048 Ga0501036_0026404
1049 Ga0501036_0029586
1050 Ga0501036_0046987
1051 Ga0501036_0156735
1052 Ga0501037_0001923
1053 Ga0501037_0045364
1054 Ga0501037_0057516
1055 Ga0501037_0344991
1056 Ga0501037_0346121
1057 Ga0501038_0005683
1058 Ga0501038_0010160
1059 Ga0501038_0011098
1060 Ga0501038_0020289
1061 Ga0501038_0029661
1062 Ga0501038_0037323
1063 Ga0501038_0045094
1064 Ga0501038_0183296
1065 Ga0501038_0423789
1066 Ga0501039_0003937
1067 Ga0501039_0038963
1068 Ga0501039_0094967
1069 Ga0501039_0581659
1070 Ga0501041_0420317
1071 Ga0501042_0010820
1072 Ga0501043_0001557
1073 Ga0501043_0021420
1074 Ga0501043_0040875
1075 Ga0501043_0073639
1076 Ga0501043_0121901
1077 Ga0501046_0003702
1078 Ga0501047_0000075
1079 Ga0501047_0007963
1080 Ga0501047_0016028
1081 Ga0501047_0017101
1082 Ga0501047_0025302
1083 Ga0501047_0081836
1084 Ga0501047_0085009
1085 Ga0501047_0088934
1086 Ga0501047_0599381
1087 Ga0501048_0006364
1088 Ga0501048_0323987
1089 Ga0501069_0648350
1090 Ga0501070_0006480
1091 Ga0501070_0017821
1092 Ga0501070_0018816
1093 Ga0501070_0275190
1094 Ga0501070_0403087
1095 Ga0501074_0000911
1096 Ga0501074_0032063
1097 Ga0501225_0130928
1098 Ga0501080_0605030
1099 Ga0501080_0643372
1100 Ga0501266_015936
1101 Ga0501282_007779
1102 Ga0501035_0015067
1103 Ga0501035_0047701
1104 Ga0501035_0049999
1105 Ga0501035_0074955
1106 Ga0501035_0233434
1107 Ga0501035_0562217
1108 Ga0501035_0726315
1109 Ga0501044_0011088
1110 Ga0501044_0011456
1111 Ga0501044_0016513
1112 Ga0501044_0031335
1113 Ga0501044_0055110
1114 Ga0501044_0058110
1115 Ga0501044_0165257
1116 Ga0501044_0173311
1117 Ga0501044_0224110
1118 Ga0501044_0259589
1119 Ga0501044_0517965
1120 Ga0501044_0599098
1121 Ga0501045_0081155
1122 Ga0501045_0261973
1123 Ga0501045_0841148
1124 nmdc:mga06z11_1981_c1
1125 nmdc:mga04h51_4079_c1
1126 nmdc:mga07m45_55120_c1
1127 Ga0495601_0012628
1128 Ga0495601_0411023
1129 Ga0495612_0065949
1130 Ga0500610_0095063
1131 Ga0495655_0008427
1132 Ga0495619_0024797
1133 Ga0495619_0042602
1134 Ga0500578_0061538
1135 Ga0500651_0214514
1136 Ga0500640_103106
1137 Ga0500553_015273
1138 Ga0500553_076027
1139 Ga0500553_108697
1140 Ga0500560_001863
1141 Ga0500560_050141
1142 Ga0500569_002778
1143 Ga0500614_043629
1144 Ga0500628_000714
1145 Ga0500652_001077
1146 Ga0500658_0018414
1147 Ga0500559_0179989
1148 Ga0500561_0003513
1149 Ga0500573_0008555
1150 Ga0500573_0032919
1151 Ga0500573_0095744
1152 Ga0500579_029336
1153 Ga0500600_0028759
1154 Ga0500616_0031948
1155 Ga0500624_010645
1156 Ga0500633_0004536
1157 Ga0500584_157733
1158 Ga0500656_000789
1159 Ga0500587_002317
1160 Ga0501084_0455342
1161 Ga0466962_0002713
1162 Ga0466962_0239429
1163 2804846272
1164 2547406178
1165 2554257444
1166 2559425558
1167 2585298376
1168 2585305680
1169 2585312618
1170 2616702744
1171 2616904121
1172 2643753320
1173 2643763220
1174 2643900263
1175 2643948006
1176 2644262795
1177 2644390572
1178 2644405513
1179 2644433872
1180 2644443006
1181 2644463910
1182 2644628379
1183 2784589103
1184 2785342745
1185 2785370170
1186 2786671136
1187 2793983636
1188 2808842571
1189 2808921077
1190 2809232705
1191 2811845663
1192 2812357544
1193 2812480054
1194 2819697464
1195 2852637382
1196 2862178867
1197 2862286164
1198 2862292032
1199 2862389715
1200 2862516405
1201 2862578751
1202 2863412639
1203 2867347575
1204 2867372389
1205 2867432665
1206 2867475291
1207 2873155247
1208 2875395098
1209 2877680566
1210 2912719217
1211 2912724034
1212 2912731495
1213 2912761417
1214 2918504997
1215 2919475527
1216 2928146593
1217 2935390705
1218 2946049399
1219 2946068331
1220 2947228576
1221 2954006947
1222 2954385682
1223 2954677468
1224 2954686686
1225 2954696332
1226 2954711495
1227 2954715698
1228 2954725635
1229 2954736177
1230 2954744574
1231 2954755024
1232 2954763557
1233 2966602186
1234 2990061549
1235 2990094386
1236 2995468827
1237 2997458951
1238 2997604577
1239 3006398090
1240 3006425825
1241 3006488553
1242 3006499485
1243 8008578402
1244 8025416090
1245 8025534518
1246 8033687003
1247 8047897505
1248 8048127907
1249 8048361365
1250 8048374492
1251 8048383730
1252 8048410303
1253 8054160957
1254 8055072228
1255 8056452890
1256 8056837960

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

34

80

0.97

PF17932

TetR_C_24

Tetracyclin repressor-like, C-terminal domain

99

197

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2iai-assembly1.cif.gz_A-2 crystal structure of sco3833, a member of the tetr transcriptional regulator family from streptomyces coelicolor a3 0.9218 9 194
2iai-assembly1.cif.gz_A-2 crystal structure of sco3833, a member of the tetr transcriptional regulator family from streptomyces coelicolor a3 0.8717 9 194
2ibd-assembly1.cif.gz_B crystal structure of probable transcriptional regulatory protein rha5900 0.8511 12 194
4w97-assembly1.cif.gz_A structure of ketosteroid transcriptional regulator kstr2 of mycobacterium tuberculosis 0.8422 12 194
2ibd-assembly1.cif.gz_B crystal structure of probable transcriptional regulatory protein rha5900 0.8266 12 194
ID Description Score Start End Superfamily
2ibdB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9822 12 50 1.10.10.60
4w1uA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9739 12 50 1.10.10.60
5k7fA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9624 12 50 1.10.10.60
3whcD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9441 14 52 1.10.10.60
3vprB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9175 9 50 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A522BXQ0-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9904 9 149 GO:0000976
GO:0003700
AF-A0A4Q3P0D7-F1-model_v4 deleted 0.9767 9 156
AF-A0A0N0SM52-F1-model_v4 TetR family transcriptional regulator 0.9607 15 196 GO:0000976
GO:0003700
AF-A0A8A6AMJ9-F1-model_v4 deleted 0.9581 16 194
AF-A0A291GJW9-F1-model_v4 TetR family transcriptional regulator 0.9563 12 196 GO:0000976
GO:0003700

Map