F470686

General Info

Members Datasets Scaffolds Average Seq Length
628 357 1256 138

Family's Representative Sequence

Representative Sequence 3300049758|Ga0501241_001829|Ga0501241_001829_2550_3002
Length 150
Sequence MMEETAARPALELDQMDLKASLGVSASGLRAQSLRMRVIAENLANQDSVAQTPGGDPYRRRIASFKAQVDSATGATEVKVQSIENDKSDFTRVYQPGHPAADGEGYVLKPNVNGLVESADMKAAQRSYEANLNAIEAAKSLTMRTIDLLK

Samples

Sample ID Description Type Environment
1 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
87 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
88 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
136 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
137 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
138 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
150 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
151 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
152 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
182 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
183 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
184 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
185 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
186 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
187 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
188 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
189 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
190 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
191 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
192 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
193 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
194 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
195 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
196 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
197 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
201 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
202 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
215 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
218 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
222 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
228 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
229 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
233 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
236 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
237 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
246 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
251 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
254 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
261 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
264 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
267 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
276 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
277 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
278 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
279 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
280 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
281 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
286 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
302 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
303 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
304 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
305 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
306 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
307 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
308 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
309 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
310 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
311 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
312 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
313 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
316 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
317 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
318 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
319 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
320 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
321 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
322 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
323 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
324 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
325 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
326 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
327 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
328 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
329 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
330 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
331 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
332 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
333 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
334 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
335 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
336 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
337 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
338 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
339 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
340 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
341 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
342 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
343 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
344 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
345 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
346 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
347 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
348 2643221651 Afipia sp. Root123D2 Isolate Unclassified
349 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
350 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
351 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
352 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
353 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
354 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
355 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
356 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
357 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.45
Metatranscriptomes 0.16
Isolates 2.39

Biome Distribution

Category Percentage (%)
Aerial Root 0.32
Bulb 0
Endosphere 10.19
Nodule 0.48
Rhizoplane 2.07
Rhizosphere 78.66
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501241_001829 3300049758 Bacteria 4189
2 SwRhRL2b_contig_459402 2162886007 Bacteria 1339
3 ARcpr5oldR_c013989 3300000041 Bacteria 691
4 ARcpr5yngRDRAFT_c012840 3300000043 Bacteria 705
5 ARCol0yngRDRAFT_1009473 3300000652 Bacteria 706
6 JGI24740J21852_10005412 3300001979 Bacteria 5402
7 JGI24739J22299_10044741 3300001989 Bacteria 1456
8 JGI24737J22298_10002139 3300001990 Bacteria 7044
9 JGI24735J21928_10037418 3300002067 Bacteria 1423
10 JGI25152J39213_1008613 3300002773 Bacteria 2515
11 JGI25150J39212_1000116 3300002774 Bacteria 45393
12 JGI25150J39212_1000212 3300002774 Bacteria 31550
13 JGI25406J46586_10001544 3300003203 Bacteria 10875
14 JGI25153J46596_10000342 3300003215 Bacteria 32966
15 JGI25153J46596_10001139 3300003215 Bacteria 16092
16 Ga0055526_1006476 3300003771 Bacteria 6346
17 Ga0055537_1000510 3300003773 Bacteria 23185
18 Ga0055537_1014340 3300003773 Bacteria 1444
19 Ga0055524_1001053 3300003775 Bacteria 17032
20 Ga0055536_1009833 3300003781 Bacteria 3891
21 Ga0055530_10000625 3300003791 Bacteria 30581
22 Ga0055530_10008286 3300003791 Bacteria 4194
23 Ga0055530_10098772 3300003791 Bacteria 588
24 Ga0055540_1000629 3300003792 Bacteria 24978
25 Ga0055531_10000648 3300003794 Bacteria 30031
26 Ga0055531_10010772 3300003794 Bacteria 4501
27 Ga0055543_1040295 3300004625 Bacteria 790
28 Ga0065165_1009220 3300005262 Bacteria 4463
29 Ga0065165_1011698 3300005262 Bacteria 3628
30 Ga0065165_1086745 3300005262 Bacteria 804
31 Ga0065165_1086928 3300005262 Bacteria 802
32 Ga0065704_10079224 3300005289 Bacteria 4223
33 Ga0070683_100428526 3300005329 Bacteria 1262
34 Ga0070683_100902761 3300005329 Bacteria 847
35 Ga0070680_100118353 3300005336 Bacteria 2210
36 Ga0070680_100153911 3300005336 Bacteria 1931
37 Ga0070680_100187104 3300005336 Bacteria 1744
38 Ga0070682_101161269 3300005337 Bacteria 650
39 Ga0070682_101633808 3300005337 Bacteria 558
40 Ga0070660_101605388 3300005339 Bacteria 553
41 Ga0070691_10140137 3300005341 Bacteria 1232
42 Ga0070691_10141826 3300005341 Bacteria 1225
43 Ga0070661_100784079 3300005344 Bacteria 781
44 Ga0070668_100012915 3300005347 Bacteria 6221
45 Ga0070674_101662778 3300005356 Bacteria 577
46 Ga0070673_100657274 3300005364 Bacteria 960
47 Ga0070659_100033145 3300005366 Bacteria 4010
48 Ga0070709_10083283 3300005434 Bacteria 2092
49 Ga0070709_10435786 3300005434 Bacteria 985
50 Ga0070709_10657895 3300005434 Bacteria 812
51 Ga0070714_100131534 3300005435 Bacteria 2237
52 Ga0070713_100115771 3300005436 Bacteria 2343
53 Ga0070713_100167710 3300005436 Bacteria 1965
54 Ga0070713_100215625 3300005436 Bacteria 1740
55 Ga0070710_10353810 3300005437 Bacteria 973
56 Ga0070710_10387962 3300005437 Bacteria 933
57 Ga0070711_100557033 3300005439 Bacteria 952
58 Ga0070663_100901716 3300005455 Bacteria 764
59 Ga0070681_10431585 3300005458 Bacteria 1230
60 Ga0070681_10842425 3300005458 Bacteria 835
61 Ga0070698_100901686 3300005471 Bacteria 830
62 Ga0070679_100043036 3300005530 Bacteria 4498
63 Ga0070679_100097251 3300005530 Bacteria 2931
64 Ga0070679_100574574 3300005530 Bacteria 1071
65 Ga0070679_100631109 3300005530 Bacteria 1014
66 Ga0070684_100008465 3300005535 Bacteria 8044
67 Ga0070684_100066654 3300005535 Bacteria 3160
68 Ga0068853_100011497 3300005539 Bacteria 7196
69 Ga0068853_100054398 3300005539 Bacteria 3449
70 Ga0068853_100112437 3300005539 Bacteria 2420
71 Ga0068853_100193328 3300005539 Bacteria 1849
72 Ga0068853_100287995 3300005539 Bacteria 1516
73 Ga0068853_101015699 3300005539 Bacteria 799
74 Ga0068853_101046036 3300005539 Bacteria 787
75 Ga0070693_100600178 3300005547 Bacteria 795
76 Ga0070693_100685786 3300005547 Bacteria 749
77 Ga0070665_100046514 3300005548 Bacteria 4359
78 Ga0070665_102091081 3300005548 Bacteria 571
79 Ga0068855_100182776 3300005563 Bacteria 2370
80 Ga0068855_100359853 3300005563 Bacteria 1601
81 Ga0068855_100504337 3300005563 Bacteria 1314
82 Ga0068855_100665101 3300005563 Bacteria 1117
83 Ga0068855_100920006 3300005563 Bacteria 923
84 Ga0070664_101244202 3300005564 Bacteria 703
85 Ga0068857_100007696 3300005577 Bacteria 9282
86 Ga0068857_100081078 3300005577 Bacteria 2897
87 Ga0068854_100013536 3300005578 Bacteria 5357
88 Ga0068854_100126088 3300005578 Bacteria 1950
89 Ga0068854_100320168 3300005578 Bacteria 1260
90 Ga0068856_100008347 3300005614 Bacteria 10091
91 Ga0068856_100127185 3300005614 Bacteria 2552
92 Ga0068856_100642962 3300005614 Bacteria 1081
93 Ga0068852_100123913 3300005616 Bacteria 2370
94 Ga0068851_10000399 3300005834 Bacteria 19667
95 Ga0068858_100081784 3300005842 Bacteria 3002
96 Ga0081455_10002644 3300005937 Bacteria 21228
97 Ga0081538_10025001 3300005981 Bacteria 4233
98 Ga0081540_1058936 3300005983 Bacteria 1846
99 Ga0081540_1183405 3300005983 Bacteria 780
100 Ga0070717_10030643 3300006028 Bacteria 4321
101 Ga0070717_10659617 3300006028 Bacteria 950
102 Ga0070717_11297077 3300006028 Bacteria 662
103 Ga0070716_100074497 3300006173 Bacteria 2006
104 Ga0070712_100261853 3300006175 Bacteria 1386
105 Ga0070712_100418076 3300006175 Bacteria 1111
106 Ga0075434_100069935 3300006871 Bacteria 3500
107 Ga0075434_100905837 3300006871 Bacteria 897
108 Ga0075436_101311635 3300006914 Bacteria 548
109 Ga0099826_10247422 3300006948 Bacteria 942
110 Ga0099795_10441530 3300007788 Bacteria 598
111 Ga0105240_10016608 3300009093 Bacteria 9957
112 Ga0105240_10031769 3300009093 Bacteria 6841
113 Ga0105240_10049504 3300009093 Bacteria 5303
114 Ga0105240_10187520 3300009093 Bacteria 2435
115 Ga0105240_10302438 3300009093 Bacteria 1830
116 Ga0105240_10384682 3300009093 Bacteria 1584
117 Ga0105247_10727119 3300009101 Bacteria 750
118 Ga0105241_10002407 3300009174 Bacteria 14054
119 Ga0105241_10055320 3300009174 Bacteria 3040
120 Ga0105241_11167480 3300009174 Bacteria 728
121 Ga0105241_11372260 3300009174 Bacteria 676
122 Ga0105248_10346030 3300009177 Bacteria 1674
123 Ga0105237_10002971 3300009545 Bacteria 20505
124 Ga0105237_10241631 3300009545 Bacteria 1807
125 Ga0105237_10327985 3300009545 Bacteria 1534
126 Ga0105237_11383074 3300009545 Bacteria 710
127 Ga0105238_10001762 3300009551 Bacteria 21717
128 Ga0105238_10034779 3300009551 Bacteria 5124
129 Ga0105238_10262150 3300009551 Bacteria 1708
130 Ga0105238_10728051 3300009551 Bacteria 1005
131 Ga0105238_10918215 3300009551 Bacteria 894
132 Ga0105238_11269606 3300009551 Bacteria 762
133 Ga0105238_12925935 3300009551 Bacteria 513
134 Ga0105249_10815802 3300009553 Bacteria 997
135 Ga0105239_10019793 3300010375 Bacteria 7429
136 Ga0105239_10107385 3300010375 Bacteria 3093
137 Ga0105239_10694267 3300010375 Bacteria 1163
138 Ga0105239_10745026 3300010375 Bacteria 1121
139 Ga0105239_10776221 3300010375 Bacteria 1097
140 Ga0105239_11529125 3300010375 Bacteria 771
141 Ga0105246_12481771 3300011119 Bacteria 510
142 Ga0157373_10412108 3300013100 Bacteria 969
143 Ga0157370_10167695 3300013104 Bacteria 2041
144 Ga0157369_10047815 3300013105 Bacteria 4643
145 Ga0157369_10122427 3300013105 Bacteria 2759
146 Ga0157369_10189875 3300013105 Bacteria 2159
147 Ga0157369_10335695 3300013105 Bacteria 1570
148 Ga0157369_11795955 3300013105 Bacteria 623
149 Ga0163162_10446664 3300013306 Bacteria 1425
150 Ga0163162_10497826 3300013306 Bacteria 1349
151 Ga0157372_10145662 3300013307 Bacteria 2731
152 Ga0157372_10363355 3300013307 Bacteria 1687
153 Ga0157372_10472563 3300013307 Bacteria 1462
154 Ga0157372_10776375 3300013307 Bacteria 1114
155 Ga0157372_11314889 3300013307 Bacteria 834
156 Ga0157375_12905596 3300013308 Bacteria 572
157 Ga0163163_10030111 3300014325 Bacteria 5225
158 Ga0157380_11709440 3300014326 Bacteria 687
159 Ga0157379_10860335 3300014968 Bacteria 858
160 Ga0213873_10080411 3300021358 Bacteria 911
161 Ga0213872_10059312 3300021361 Bacteria 1732
162 Ga0213876_10192768 3300021384 Bacteria 1084
163 Ga0213871_10022259 3300021441 Bacteria 1587
164 Ga0213871_10047965 3300021441 Bacteria 1163
165 Ga0213871_10127976 3300021441 Bacteria 761
166 Ga0209436_122427 3300025208 Bacteria 814
167 Ga0207425_1000088 3300025245 Bacteria 91367
168 Ga0209129_1000802 3300025258 Bacteria 19849
169 Ga0209565_1000030 3300025263 Bacteria 325058
170 Ga0209565_1000568 3300025263 Bacteria 25331
171 Ga0209565_1034450 3300025263 Bacteria 970
172 Ga0209673_1002924 3300025273 Bacteria 10767
173 Ga0209673_1007891 3300025273 Bacteria 4815
174 Ga0209675_1005882 3300025291 Bacteria 5034
175 Ga0209676_1004987 3300025292 Bacteria 7117
176 Ga0209025_1001214 3300025294 Bacteria 36013
177 Ga0209564_1000769 3300025295 Bacteria 44684
178 Ga0209758_1000009 3300025297 Bacteria 1123483
179 Ga0209050_1000005 3300025298 Bacteria 1557793
180 Ga0209050_1000039 3300025298 Bacteria 410069
181 Ga0209050_1005658 3300025298 Bacteria 7738
182 Ga0209050_1042235 3300025298 Bacteria 1246
183 Ga0209256_1000046 3300025299 Bacteria 325040
184 Ga0207426_1007605 3300025302 Bacteria 4508
185 Ga0209051_1001266 3300025303 Bacteria 22555
186 Ga0209257_1000051 3300025304 Bacteria 434166
187 Ga0209257_1002508 3300025304 Bacteria 18077
188 Ga0209257_1005370 3300025304 Bacteria 9045
189 Ga0209257_1023998 3300025304 Bacteria 2125
190 Ga0207656_10006526 3300025321 Bacteria 4200
191 Ga0207680_10703761 3300025903 Bacteria 724
192 Ga0207647_10019393 3300025904 Bacteria 4575
193 Ga0207647_10033151 3300025904 Bacteria 3310
194 Ga0207699_10044824 3300025906 Bacteria 2577
195 Ga0207699_10649788 3300025906 Bacteria 770
196 Ga0207705_10703759 3300025909 Bacteria 785
197 Ga0207654_10000123 3300025911 Bacteria 50130
198 Ga0207654_10027451 3300025911 Bacteria 3094
199 Ga0207707_10002187 3300025912 Bacteria 17712
200 Ga0207707_10124348 3300025912 Bacteria 2256
201 Ga0207695_10001299 3300025913 Bacteria 42408
202 Ga0207695_10022857 3300025913 Bacteria 7083
203 Ga0207695_10088520 3300025913 Bacteria 3116
204 Ga0207695_10234765 3300025913 Bacteria 1737
205 Ga0207695_10238557 3300025913 Bacteria 1720
206 Ga0207671_10149057 3300025914 Bacteria 1807
207 Ga0207671_10301646 3300025914 Bacteria 1266
208 Ga0207693_10140055 3300025915 Bacteria 1902
209 Ga0207693_10663335 3300025915 Bacteria 810
210 Ga0207693_10776221 3300025915 Bacteria 739
211 Ga0207663_10074868 3300025916 Bacteria 2195
212 Ga0207663_10184891 3300025916 Bacteria 1491
213 Ga0207663_11191177 3300025916 Bacteria 613
214 Ga0207660_10113648 3300025917 Bacteria 2041
215 Ga0207660_10207386 3300025917 Bacteria 1533
216 Ga0207660_10467064 3300025917 Bacteria 1022
217 Ga0207657_10054323 3300025919 Bacteria 3464
218 Ga0207657_11082224 3300025919 Bacteria 613
219 Ga0207649_10855451 3300025920 Bacteria 712
220 Ga0207649_10943675 3300025920 Bacteria 677
221 Ga0207652_10027423 3300025921 Bacteria 4747
222 Ga0207652_10302150 3300025921 Bacteria 1444
223 Ga0207652_10695581 3300025921 Bacteria 907
224 Ga0207652_11156127 3300025921 Bacteria 675
225 Ga0207681_10221479 3300025923 Bacteria 1464
226 Ga0207694_10000810 3300025924 Bacteria 27944
227 Ga0207694_10006589 3300025924 Bacteria 8823
228 Ga0207694_10454373 3300025924 Bacteria 1069
229 Ga0207694_10921148 3300025924 Bacteria 739
230 Ga0207694_11434106 3300025924 Bacteria 583
231 Ga0207659_10748229 3300025926 Bacteria 838
232 Ga0207700_10044410 3300025928 Bacteria 3271
233 Ga0207700_10546096 3300025928 Bacteria 1028
234 Ga0207700_10710785 3300025928 Bacteria 897
235 Ga0207664_10709147 3300025929 Bacteria 905
236 Ga0207690_10243672 3300025932 Bacteria 1386
237 Ga0207669_10164913 3300025937 Bacteria 1570
238 Ga0207665_10095941 3300025939 Bacteria 2062
239 Ga0207661_10000576 3300025944 Bacteria 23427
240 Ga0207661_10022604 3300025944 Bacteria 4739
241 Ga0207667_10004941 3300025949 Bacteria 16283
242 Ga0207667_10013218 3300025949 Bacteria 9465
243 Ga0207667_10183889 3300025949 Bacteria 2146
244 Ga0207667_10331620 3300025949 Bacteria 1553
245 Ga0207667_11182210 3300025949 Bacteria 745
246 Ga0207668_10041631 3300025972 Bacteria 3107
247 Ga0207640_10016792 3300025981 Bacteria 4267
248 Ga0207640_10023559 3300025981 Bacteria 3701
249 Ga0207640_10055969 3300025981 Bacteria 2586
250 Ga0207640_10133243 3300025981 Bacteria 1799
251 Ga0207703_10101219 3300026035 Bacteria 2443
252 Ga0207639_10063070 3300026041 Bacteria 2868
253 Ga0207639_10101620 3300026041 Bacteria 2325
254 Ga0207639_10654282 3300026041 Bacteria 972
255 Ga0207639_10709756 3300026041 Bacteria 933
256 Ga0207639_11365229 3300026041 Bacteria 665
257 Ga0207678_10033399 3300026067 Bacteria 4483
258 Ga0207678_10066758 3300026067 Bacteria 3088
259 Ga0207702_10000005 3300026078 Bacteria 420296
260 Ga0207702_10163668 3300026078 Bacteria 2033
261 Ga0207702_10400178 3300026078 Bacteria 1324
262 Ga0207674_10007959 3300026116 Bacteria 12298
263 Ga0207674_10012174 3300026116 Bacteria 9630
264 Ga0207674_10179282 3300026116 Bacteria 2070
265 Ga0265338_10753718 3300028800 Bacteria 669
266 Ga0307511_10069156 3300030521 Bacteria 2598
267 Ga0316176_1128291 3300030732 Bacteria 1143
268 Ga0314311_1136470 3300030733 Bacteria 2793
269 Ga0265765_1016672 3300030879 Bacteria 862
270 Ga0265332_10293539 3300031238 Bacteria 671
271 Ga0265339_10108761 3300031249 Bacteria 1436
272 Ga0265331_10306433 3300031250 Bacteria 711
273 Ga0307509_10255413 3300031507 Bacteria 1532
274 Ga0307508_10047425 3300031616 Bacteria 3832
275 Ga0307508_10263496 3300031616 Bacteria 1317
276 Ga0307508_10302223 3300031616 Bacteria 1193
277 Ga0265314_10134268 3300031711 Bacteria 1539
278 Ga0265314_10303763 3300031711 Bacteria 894
279 Ga0265342_10004564 3300031712 Bacteria 10832
280 Ga0307405_10289742 3300031731 Bacteria 1237
281 Ga0307412_10595867 3300031911 Bacteria 935
282 Ga0307416_100047483 3300032002 Bacteria 3399
283 Ga0307416_102418270 3300032002 Bacteria 625
284 Ga0307507_10132748 3300033179 Bacteria 1941
285 Ga0373926_0028758 3300035083 Bacteria 1952
286 Ga0373934_0011245 3300035086 Bacteria 3368
287 Ga0373934_0033729 3300035086 Bacteria 2010
288 Ga0373944_0033918 3300035089 Bacteria 1549
289 Ga0373944_0441702 3300035089 Bacteria 506
290 Ga0373923_0002543 3300035111 Bacteria 5641
291 Ga0373932_0127159 3300035112 Bacteria 855
292 Ga0373936_0000545 3300035113 Bacteria 12908
293 Ga0373936_0003680 3300035113 Bacteria 5757
294 Ga0373936_0062253 3300035113 Bacteria 1525
295 Ga0373945_0094133 3300035116 Bacteria 1164
296 Ga0373945_0119499 3300035116 Bacteria 1046
297 Ga0373953_0013515 3300035117 Bacteria 2917
298 Ga0373954_0006146 3300035118 Bacteria 5230
299 Ga0373954_0016972 3300035118 Bacteria 3265
300 Ga0373954_0142169 3300035118 Bacteria 1171
301 Ga0373956_0010173 3300035119 Bacteria 3845
302 Ga0373956_0029350 3300035119 Bacteria 2398
303 Ga0373956_0561341 3300035119 Bacteria 545
304 Ga0373957_0067431 3300035120 Bacteria 1395
305 Ga0373957_0133892 3300035120 Bacteria 1010
306 Ga0373943_0000449 3300035170 Bacteria 17431
307 Ga0373943_0024323 3300035170 Bacteria 2823
308 Ga0373946_0140154 3300035171 Bacteria 1120
309 Ga0373955_0000177 3300035172 Bacteria 26296
310 Ga0373955_0166451 3300035172 Bacteria 1303
311 Ga0373924_0000051 3300035410 Bacteria 29889
312 Ga0373924_0012896 3300035410 Bacteria 3131
313 Ga0373935_0000018 3300035692 Bacteria 68811
314 Ga0373935_0115552 3300035692 Bacteria 1786
315 Ga0373935_0419173 3300035692 Bacteria 963
316 Ga0373935_0464219 3300035692 Bacteria 916
317 Ga0373927_0005516 3300035695 Bacteria 8714
318 Ga0373927_0021259 3300035695 Bacteria 4252
319 Ga0373927_0036417 3300035695 Bacteria 3200
320 Ga0373927_0089864 3300035695 Bacteria 1994
321 Ga0373933_0080337 3300035724 Bacteria 1998
322 Ga0373933_0115244 3300035724 Bacteria 1679
323 Ga0373947_0000264 3300035725 Bacteria 29727
324 Ga0373947_0005784 3300035725 Bacteria 7213
325 Ga0373937_0000571 3300036401 Bacteria 32663
326 Ga0373937_0071235 3300036401 Bacteria 3206
327 Ga0373937_0076255 3300036401 Bacteria 3096
328 Ga0373937_0727513 3300036401 Bacteria 939
329 Ga0373925_0000018 3300037068 Bacteria 174213
330 Ga0373925_0022168 3300037068 Bacteria 4631
331 Ga0373925_0047862 3300037068 Bacteria 3184
332 Ga0395899_0208052 3300037312 Bacteria 1361
333 Ga0395900_0055360 3300037418 Bacteria 4085
334 Ga0395898_0052949 3300037466 Bacteria 3964
335 Ga0436364_1267269 3300037853 Bacteria 2224
336 Ga0395901_0259107 3300038443 Bacteria 1810
337 Ga0436365_0114173 3300039437 Bacteria 10030
338 Ga0436365_0714059 3300039437 Bacteria 1235
339 Ga0436365_1021560 3300039437 Bacteria 1851
340 Ga0436360_0325899 3300039438 Bacteria 6943
341 Ga0436360_0483636 3300039438 Bacteria 1406
342 Ga0436360_0559001 3300039438 Bacteria 1110
343 Ga0436360_1359889 3300039438 Bacteria 2346
344 Ga0436361_0230534 3300039447 Bacteria 1408
345 Ga0436361_0349114 3300039447 Bacteria 825
346 Ga0436363_0291288 3300039450 Bacteria 1093
347 Ga0436363_0429643 3300039450 Bacteria 1280
348 Ga0436362_0235669 3300039453 Bacteria 2784
349 Ga0436362_0243271 3300039453 Bacteria 1427
350 Ga0439447_064814 3300041407 Bacteria 855
351 Ga0439461_0000044 3300041410 Bacteria 14804
352 Ga0439461_0014314 3300041410 Bacteria 1507
353 Ga0439466_0159117 3300041411 Bacteria 691
354 Ga0439465_0001380 3300041413 Bacteria 7830
355 Ga0439465_0006731 3300041413 Bacteria 3648
356 Ga0451789_0300051 3300041443 Bacteria 527
357 Ga0439431_0000185 3300041997 Bacteria 12073
358 Ga0439433_0040264 3300041999 Bacteria 1087
359 Ga0439442_003809 3300042002 Bacteria 2988
360 Ga0439445_0000740 3300042004 Bacteria 6830
361 Ga0439445_0077862 3300042004 Bacteria 924
362 Ga0439432_000280 3300042006 Bacteria 18433
363 Ga0439432_033746 3300042006 Bacteria 1645
364 Ga0439452_017787 3300042010 Bacteria 1903
365 Ga0439452_042338 3300042010 Bacteria 1067
366 Ga0439457_012964 3300042014 Bacteria 1875
367 Ga0439462_0000118 3300042015 Bacteria 12485
368 Ga0439462_0218733 3300042015 Bacteria 544
369 Ga0450920_041367 3300042122 Bacteria 919
370 Ga0439446_0064809 3300042156 Bacteria 1110
371 Ga0439446_0198289 3300042156 Bacteria 677
372 Ga0439459_0030552 3300042438 Bacteria 1094
373 Ga0466969_0047726 3300044656 Bacteria 2119
374 Ga0466966_0122608 3300044684 Bacteria 1595
375 Ga0466966_0883277 3300044684 Bacteria 539
376 Ga0466963_0038501 3300044694 Bacteria 3127
377 Ga0466971_0151368 3300044719 Bacteria 1083
378 Ga0466968_0036414 3300044735 Bacteria 2063
379 Ga0466968_0138232 3300044735 Bacteria 1113
380 Ga0466968_0215073 3300044735 Bacteria 904
381 Ga0466970_0026326 3300044765 Bacteria 3049
382 Ga0466970_0970387 3300044765 Bacteria 501
383 Ga0466959_0256020 3300045049 Bacteria 1206
384 Ga0466958_0362109 3300045836 Bacteria 934
385 Ga0466967_1935014 3300045976 Bacteria 586
386 Ga0495627_028150 3300046453 Bacteria 1797
387 Ga0495592_0000001 3300046454 Bacteria 305819
388 Ga0495603_0192175 3300046455 Bacteria 1180
389 Ga0495629_0012920 3300046459 Bacteria 6040
390 Ga0495629_0024232 3300046459 Bacteria 4321
391 Ga0495638_0000029 3300046460 Bacteria 330201
392 Ga0495638_0260592 3300046460 Bacteria 951
393 Ga0495651_0004527 3300046462 Bacteria 10630
394 Ga0495651_0160521 3300046462 Bacteria 1611
395 Ga0495651_0829632 3300046462 Bacteria 569
396 Ga0495653_0000015 3300046463 Bacteria 213697
397 Ga0495653_0384284 3300046463 Bacteria 896
398 Ga0495580_0036269 3300046472 Bacteria 3541
399 Ga0495580_0176271 3300046472 Bacteria 1477
400 Ga0495639_0144628 3300046475 Bacteria 1144
401 Ga0495662_0148473 3300046476 Bacteria 1154
402 Ga0495664_0000001 3300046477 Bacteria 757730
403 Ga0495664_0012380 3300046477 Bacteria 4830
404 Ga0495664_0042664 3300046477 Bacteria 2687
405 Ga0495607_0037321 3300046501 Bacteria 2920
406 Ga0495583_0000147 3300046506 Bacteria 119035
407 Ga0495606_0103784 3300046507 Bacteria 1726
408 Ga0495608_0000116 3300046511 Bacteria 56633
409 Ga0495610_0000015 3300046512 Bacteria 391489
410 Ga0495616_0187967 3300046513 Bacteria 914
411 Ga0495618_0000021 3300046514 Bacteria 129750
412 Ga0495618_0058906 3300046514 Bacteria 2433
413 Ga0495620_0003997 3300046515 Bacteria 8380
414 Ga0495620_0157793 3300046515 Bacteria 882
415 Ga0495628_0000005 3300046516 Bacteria 420969
416 Ga0495628_0107821 3300046516 Bacteria 2144
417 Ga0495630_0001024 3300046517 Bacteria 19309
418 Ga0495630_0069763 3300046517 Bacteria 2644
419 Ga0495632_0000565 3300046519 Bacteria 34434
420 Ga0495632_0000689 3300046519 Bacteria 30742
421 Ga0495632_0117610 3300046519 Bacteria 1244
422 Ga0495643_0039018 3300046522 Bacteria 2598
423 Ga0495648_0000020 3300046524 Bacteria 254330
424 Ga0495652_0000001 3300046529 Bacteria 1045081
425 Ga0495652_0276977 3300046529 Bacteria 1230
426 Ga0495665_0052744 3300046531 Bacteria 2152
427 Ga0495665_0264342 3300046531 Bacteria 884
428 Ga0495665_0338890 3300046531 Bacteria 766
429 Ga0495640_0000006 3300046533 Bacteria 285419
430 Ga0495640_0014823 3300046533 Bacteria 5884
431 Ga0495587_0000012 3300046536 Bacteria 197088
432 Ga0495645_0000004 3300046543 Bacteria 532661
433 Ga0495645_0022863 3300046543 Bacteria 4525
434 Ga0495622_0216257 3300046557 Bacteria 850
435 Ga0495633_0033883 3300046558 Bacteria 2459
436 Ga0495667_0000001 3300046559 Bacteria 834831
437 Ga0495667_0297651 3300046559 Bacteria 1022
438 Ga0495634_0000388 3300046642 Bacteria 42999
439 Ga0495625_0037310 3300046660 Bacteria 3566
440 Ga0495625_0196947 3300046660 Bacteria 1332
441 Ga0495625_0508891 3300046660 Bacteria 735
442 Ga0495635_0000007 3300046663 Bacteria 278786
443 Ga0495635_0078182 3300046663 Bacteria 2265
444 Ga0495661_0326691 3300046665 Bacteria 761
445 Ga0495657_0000250 3300046675 Bacteria 48717
446 Ga0495599_0000002 3300046678 Bacteria 348168
447 Ga0495623_0000116 3300046679 Bacteria 48662
448 Ga0495623_0651660 3300046679 Bacteria 543
449 Ga0495646_0000049 3300046680 Bacteria 60856
450 Ga0495646_0068818 3300046680 Bacteria 2089
451 Ga0495647_0032421 3300046681 Bacteria 1947
452 Ga0495658_0167661 3300046683 Bacteria 1357
453 Ga0495658_0173351 3300046683 Bacteria 1336
454 Ga0495613_0044521 3300046689 Bacteria 3283
455 Ga0495613_0217940 3300046689 Bacteria 1340
456 Ga0495624_0018939 3300046690 Bacteria 4600
457 Ga0495624_0152493 3300046690 Bacteria 1413
458 Ga0495670_0000003 3300046691 Bacteria 326779
459 Ga0495671_0000022 3300046692 Bacteria 255591
460 Ga0495600_0000013 3300046809 Bacteria 119404
461 Ga0495660_0186793 3300046810 Bacteria 999
462 Ga0495581_0028974 3300047315 Bacteria 3211
463 Ga0495581_0039780 3300047315 Bacteria 2722
464 Ga0495604_0000007 3300047317 Bacteria 412174
465 Ga0495604_0047239 3300047317 Bacteria 3354
466 Ga0495674_0000001 3300047319 Bacteria 778665
467 Ga0495674_0077744 3300047319 Bacteria 2852
468 Ga0495676_0165436 3300047321 Bacteria 1561
469 Ga0495676_0295721 3300047321 Bacteria 1093
470 Ga0495680_0004250 3300047322 Bacteria 13751
471 Ga0495675_0000014 3300047444 Bacteria 137646
472 Ga0495673_0000051 3300047469 Bacteria 255511
473 Ga0495681_0060649 3300047470 Bacteria 1745
474 Ga0495681_0132601 3300047470 Bacteria 1059
475 Ga0495684_0000219 3300047471 Bacteria 44380
476 Ga0495684_0247631 3300047471 Bacteria 1297
477 Ga0495686_0733276 3300047472 Bacteria 502
478 Ga0495593_0000454 3300047673 Bacteria 23017
479 Ga0495593_0104486 3300047673 Bacteria 1450
480 Ga0495602_0000004 3300048088 Bacteria 326932
481 Ga0495614_0445079 3300048089 Bacteria 612
482 Ga0495615_0000016 3300048090 Bacteria 56891
483 Ga0496102_0279407 3300048905 Bacteria 1574
484 Ga0496106_0065584 3300048909 Bacteria 2764
485 Ga0496106_0137878 3300048909 Bacteria 1917
486 Ga0496107_0501697 3300048910 Bacteria 900
487 Ga0496108_0013032 3300048911 Bacteria 6775
488 Ga0496109_0073319 3300048912 Bacteria 3146
489 Ga0496109_1532629 3300048912 Bacteria 601
490 Ga0496114_0235448 3300048917 Bacteria 1609
491 Ga0496114_0992313 3300048917 Bacteria 723
492 Ga0496115_0000266 3300048918 Bacteria 46285
493 Ga0496115_0023737 3300048918 Bacteria 4760
494 Ga0496116_0083195 3300048919 Bacteria 1977
495 Ga0496116_0128967 3300048919 Bacteria 1446
496 Ga0496117_0260560 3300048920 Bacteria 940
497 Ga0496118_0009363 3300048921 Bacteria 9917
498 Ga0496119_0110083 3300048922 Bacteria 1531
499 Ga0496119_0118995 3300048922 Bacteria 1455
500 Ga0496119_0495431 3300048922 Bacteria 569
501 Ga0496121_0000238 3300048924 Bacteria 118593
502 Ga0496121_0001825 3300048924 Bacteria 34332
503 Ga0496121_0739713 3300048924 Bacteria 586
504 Ga0496122_0006343 3300048925 Bacteria 13606
505 Ga0496122_0238034 3300048925 Bacteria 1029
506 Ga0496122_0429574 3300048925 Bacteria 661
507 Ga0496123_0000440 3300048926 Bacteria 74760
508 Ga0496123_0210525 3300048926 Bacteria 989
509 Ga0496124_0001345 3300048927 Bacteria 36839
510 Ga0496124_0002038 3300048927 Bacteria 27462
511 Ga0496124_0068733 3300048927 Bacteria 2943
512 Ga0496124_0111607 3300048927 Bacteria 2199
513 Ga0496124_0333964 3300048927 Bacteria 1079
514 Ga0496125_0000063 3300048928 Bacteria 250260
515 Ga0496125_0189615 3300048928 Bacteria 1359
516 Ga0496125_0213410 3300048928 Bacteria 1251
517 Ga0496125_0524815 3300048928 Bacteria 661
518 Ga0496126_0017613 3300048929 Bacteria 7117
519 Ga0496126_0038874 3300048929 Bacteria 4422
520 Ga0496126_0042213 3300048929 Bacteria 4213
521 Ga0496126_0054522 3300048929 Bacteria 3620
522 Ga0496126_0065422 3300048929 Bacteria 3254
523 Ga0496126_0109046 3300048929 Bacteria 2413
524 Ga0496126_0110744 3300048929 Bacteria 2391
525 Ga0496126_0495052 3300048929 Bacteria 978
526 Ga0496126_1040100 3300048929 Bacteria 612
527 Ga0495682_0360435 3300049460 Bacteria 512
528 Ga0501031_0015829 3300049568 Bacteria 4896
529 Ga0501032_0034960 3300049569 Bacteria 3437
530 Ga0501033_0014007 3300049570 Bacteria 6100
531 Ga0501033_0734925 3300049570 Bacteria 670
532 Ga0501034_0378591 3300049571 Bacteria 1341
533 Ga0501036_0012806 3300049572 Bacteria 6958
534 Ga0501036_0364927 3300049572 Bacteria 1205
535 Ga0501038_0052181 3300049574 Bacteria 3527
536 Ga0501038_0699489 3300049574 Bacteria 759
537 Ga0501039_0287725 3300049575 Unclassified 1292
538 Ga0501040_0002835 3300049576 Bacteria 11189
539 Ga0501041_0012337 3300049577 Bacteria 5062
540 Ga0501042_0008945 3300049578 Bacteria 6645
541 Ga0501042_0140885 3300049578 Bacteria 1739
542 Ga0501046_0070868 3300049580 Bacteria 2709
543 Ga0501046_0672434 3300049580 Bacteria 731
544 Ga0501047_1254921 3300049581 Bacteria 555
545 Ga0501048_0030319 3300049582 Bacteria 3913
546 Ga0501048_1100706 3300049582 Bacteria 571
547 Ga0501068_0043233 3300049584 Bacteria 2710
548 Ga0501068_1104302 3300049584 Bacteria 524
549 Ga0501070_0873605 3300049586 Bacteria 703
550 Ga0501071_0020046 3300049587 Bacteria 4646
551 Ga0501071_0648317 3300049587 Bacteria 812
552 Ga0501072_0018509 3300049588 Bacteria 5366
553 Ga0501072_0539611 3300049588 Bacteria 921
554 Ga0501073_0443911 3300049589 Bacteria 897
555 Ga0501074_0355803 3300049590 Bacteria 1039
556 Ga0501074_0593838 3300049590 Bacteria 783
557 Ga0501075_0019580 3300049591 Bacteria 4913
558 Ga0501076_0007904 3300049592 Bacteria 7755
559 Ga0501076_0272490 3300049592 Unclassified 1386
560 Ga0501077_0005478 3300049593 Bacteria 7725
561 Ga0501077_0614245 3300049593 Bacteria 698
562 Ga0501238_016070 3300049671 Bacteria 1035
563 Ga0501079_0011917 3300049741 Bacteria 6634
564 Ga0501079_0535239 3300049741 Unclassified 921
565 Ga0501080_0051794 3300049742 Bacteria 3821
566 Ga0501080_0429355 3300049742 Unclassified 1186
567 Ga0501081_0095222 3300049743 Bacteria 2099
568 Ga0501083_0304636 3300049744 Bacteria 1036
569 Ga0501083_0630797 3300049744 Bacteria 697
570 Ga0501035_0034368 3300049822 Bacteria 4607
571 Ga0501044_0271873 3300049823 Bacteria 1630
572 Ga0501045_0003266 3300049824 Bacteria 11080
573 Ga0501045_0158166 3300049824 Unclassified 1686
574 Ga0501045_0788781 3300049824 Bacteria 700
575 nmdc:mga0n895_37825_c1 3300050512 Bacteria 4671
576 nmdc:mga0n895_475922_c1 3300050512 Bacteria 1260
577 nmdc:mga0n895_545069_c1 3300050512 Bacteria 1166
578 nmdc:mga0n895_777984_c1 3300050512 Bacteria 949
579 nmdc:mga0rr50_625966_c1 3300050513 Bacteria 918
580 nmdc:mga08x19_1205569_c1 3300050514 Bacteria 537
581 Ga0495601_0000006 3300053077 Bacteria 373770
582 Ga0495601_0013980 3300053077 Bacteria 4833
583 Ga0495601_0293080 3300053077 Bacteria 1060
584 Ga0495612_0000004 3300053078 Bacteria 286946
585 Ga0495612_0010349 3300053078 Bacteria 3774
586 Ga0495612_0028946 3300053078 Bacteria 2230
587 Ga0500610_0419605 3300053079 Bacteria 536
588 Ga0495595_0000006 3300053084 Bacteria 231295
589 Ga0495595_0150299 3300053084 Bacteria 1146
590 Ga0495619_0000240 3300053085 Bacteria 39732
591 Ga0500643_003201 3300053087 Bacteria 7988
592 Ga0500643_004720 3300053087 Bacteria 6059
593 Ga0500643_007280 3300053087 Bacteria 4494
594 Ga0500651_0122601 3300053093 Bacteria 1577
595 Ga0500566_0000177 3300053094 Bacteria 32478
596 Ga0500650_0496832 3300053098 Bacteria 519
597 Ga0500652_330154 3300053131 Bacteria 582
598 Ga0500658_0031652 3300053134 Bacteria 2070
599 Ga0500559_0002539 3300053136 Bacteria 9368
600 Ga0500568_0187098 3300053139 Bacteria 760
601 Ga0500573_0404932 3300053140 Bacteria 645
602 Ga0500634_0122106 3300053161 Bacteria 1266
603 Ga0500639_051518 3300053163 Bacteria 2143
604 Ga0500637_0016161 3300053178 Bacteria 3974
605 Ga0500637_0038298 3300053178 Bacteria 2700
606 Ga0500657_088675 3300053728 Bacteria 1309
607 Ga0500552_020105 3300053733 Bacteria 942
608 Ga0501084_0055522 3300054114 Bacteria 3313
609 Ga0500661_000683 3300055283 Bacteria 6373
610 Ga0501082_0014053 3300060353 Bacteria 6886
611 Ga0501082_0334296 3300060353 Bacteria 1320
612 Ga0466962_0027159 3300061719 Bacteria 2748
613 Ga0530510_0012951 3300061734 Bacteria 5865
614 2509153624 2508501128 Bacteria 8613869
615 2511129208 2510917021 Bacteria 5705459
616 2513891945 2513237141 Bacteria 8496279
617 2600225299 2599185359 Bacteria 4772316
618 2644128544 2643221622 Bacteria 4212502
619 2644287710 2643221651 Bacteria 4798932
620 2819713569 2818991466 Bacteria 4748179
621 2879165893 2879163058 Bacteria 4223965
622 2928530129 2928526807 Bacteria 4760224
623 2928972011 2928968154 Bacteria 4633371
624 2929203882 2929199973 Bacteria 7260745
625 2990266779 2990265787 Bacteria 3943888
626 2993693721 2993693658 Bacteria 4040749
627 8054307679 8054302542 Bacteria 5698134
628 8055912900 8055909800 Bacteria 7278581
629 Ga0501241_001829
630 SwRhRL2b_contig_459402
631 ARcpr5oldR_c013989
632 ARcpr5yngRDRAFT_c012840
633 ARCol0yngRDRAFT_1009473
634 JGI24740J21852_10005412
635 JGI24739J22299_10044741
636 JGI24737J22298_10002139
637 JGI24735J21928_10037418
638 JGI25152J39213_1008613
639 JGI25150J39212_1000116
640 JGI25150J39212_1000212
641 JGI25406J46586_10001544
642 JGI25153J46596_10000342
643 JGI25153J46596_10001139
644 Ga0055526_1006476
645 Ga0055537_1000510
646 Ga0055537_1014340
647 Ga0055524_1001053
648 Ga0055536_1009833
649 Ga0055530_10000625
650 Ga0055530_10008286
651 Ga0055530_10098772
652 Ga0055540_1000629
653 Ga0055531_10000648
654 Ga0055531_10010772
655 Ga0055543_1040295
656 Ga0065165_1009220
657 Ga0065165_1011698
658 Ga0065165_1086745
659 Ga0065165_1086928
660 Ga0065704_10079224
661 Ga0070683_100428526
662 Ga0070683_100902761
663 Ga0070680_100118353
664 Ga0070680_100153911
665 Ga0070680_100187104
666 Ga0070682_101161269
667 Ga0070682_101633808
668 Ga0070660_101605388
669 Ga0070691_10140137
670 Ga0070691_10141826
671 Ga0070661_100784079
672 Ga0070668_100012915
673 Ga0070674_101662778
674 Ga0070673_100657274
675 Ga0070659_100033145
676 Ga0070709_10083283
677 Ga0070709_10435786
678 Ga0070709_10657895
679 Ga0070714_100131534
680 Ga0070713_100115771
681 Ga0070713_100167710
682 Ga0070713_100215625
683 Ga0070710_10353810
684 Ga0070710_10387962
685 Ga0070711_100557033
686 Ga0070663_100901716
687 Ga0070681_10431585
688 Ga0070681_10842425
689 Ga0070698_100901686
690 Ga0070679_100043036
691 Ga0070679_100097251
692 Ga0070679_100574574
693 Ga0070679_100631109
694 Ga0070684_100008465
695 Ga0070684_100066654
696 Ga0068853_100011497
697 Ga0068853_100054398
698 Ga0068853_100112437
699 Ga0068853_100193328
700 Ga0068853_100287995
701 Ga0068853_101015699
702 Ga0068853_101046036
703 Ga0070693_100600178
704 Ga0070693_100685786
705 Ga0070665_100046514
706 Ga0070665_102091081
707 Ga0068855_100182776
708 Ga0068855_100359853
709 Ga0068855_100504337
710 Ga0068855_100665101
711 Ga0068855_100920006
712 Ga0070664_101244202
713 Ga0068857_100007696
714 Ga0068857_100081078
715 Ga0068854_100013536
716 Ga0068854_100126088
717 Ga0068854_100320168
718 Ga0068856_100008347
719 Ga0068856_100127185
720 Ga0068856_100642962
721 Ga0068852_100123913
722 Ga0068851_10000399
723 Ga0068858_100081784
724 Ga0081455_10002644
725 Ga0081538_10025001
726 Ga0081540_1058936
727 Ga0081540_1183405
728 Ga0070717_10030643
729 Ga0070717_10659617
730 Ga0070717_11297077
731 Ga0070716_100074497
732 Ga0070712_100261853
733 Ga0070712_100418076
734 Ga0075434_100069935
735 Ga0075434_100905837
736 Ga0075436_101311635
737 Ga0099826_10247422
738 Ga0099795_10441530
739 Ga0105240_10016608
740 Ga0105240_10031769
741 Ga0105240_10049504
742 Ga0105240_10187520
743 Ga0105240_10302438
744 Ga0105240_10384682
745 Ga0105247_10727119
746 Ga0105241_10002407
747 Ga0105241_10055320
748 Ga0105241_11167480
749 Ga0105241_11372260
750 Ga0105248_10346030
751 Ga0105237_10002971
752 Ga0105237_10241631
753 Ga0105237_10327985
754 Ga0105237_11383074
755 Ga0105238_10001762
756 Ga0105238_10034779
757 Ga0105238_10262150
758 Ga0105238_10728051
759 Ga0105238_10918215
760 Ga0105238_11269606
761 Ga0105238_12925935
762 Ga0105249_10815802
763 Ga0105239_10019793
764 Ga0105239_10107385
765 Ga0105239_10694267
766 Ga0105239_10745026
767 Ga0105239_10776221
768 Ga0105239_11529125
769 Ga0105246_12481771
770 Ga0157373_10412108
771 Ga0157370_10167695
772 Ga0157369_10047815
773 Ga0157369_10122427
774 Ga0157369_10189875
775 Ga0157369_10335695
776 Ga0157369_11795955
777 Ga0163162_10446664
778 Ga0163162_10497826
779 Ga0157372_10145662
780 Ga0157372_10363355
781 Ga0157372_10472563
782 Ga0157372_10776375
783 Ga0157372_11314889
784 Ga0157375_12905596
785 Ga0163163_10030111
786 Ga0157380_11709440
787 Ga0157379_10860335
788 Ga0213873_10080411
789 Ga0213872_10059312
790 Ga0213876_10192768
791 Ga0213871_10022259
792 Ga0213871_10047965
793 Ga0213871_10127976
794 Ga0209436_122427
795 Ga0207425_1000088
796 Ga0209129_1000802
797 Ga0209565_1000030
798 Ga0209565_1000568
799 Ga0209565_1034450
800 Ga0209673_1002924
801 Ga0209673_1007891
802 Ga0209675_1005882
803 Ga0209676_1004987
804 Ga0209025_1001214
805 Ga0209564_1000769
806 Ga0209758_1000009
807 Ga0209050_1000005
808 Ga0209050_1000039
809 Ga0209050_1005658
810 Ga0209050_1042235
811 Ga0209256_1000046
812 Ga0207426_1007605
813 Ga0209051_1001266
814 Ga0209257_1000051
815 Ga0209257_1002508
816 Ga0209257_1005370
817 Ga0209257_1023998
818 Ga0207656_10006526
819 Ga0207680_10703761
820 Ga0207647_10019393
821 Ga0207647_10033151
822 Ga0207699_10044824
823 Ga0207699_10649788
824 Ga0207705_10703759
825 Ga0207654_10000123
826 Ga0207654_10027451
827 Ga0207707_10002187
828 Ga0207707_10124348
829 Ga0207695_10001299
830 Ga0207695_10022857
831 Ga0207695_10088520
832 Ga0207695_10234765
833 Ga0207695_10238557
834 Ga0207671_10149057
835 Ga0207671_10301646
836 Ga0207693_10140055
837 Ga0207693_10663335
838 Ga0207693_10776221
839 Ga0207663_10074868
840 Ga0207663_10184891
841 Ga0207663_11191177
842 Ga0207660_10113648
843 Ga0207660_10207386
844 Ga0207660_10467064
845 Ga0207657_10054323
846 Ga0207657_11082224
847 Ga0207649_10855451
848 Ga0207649_10943675
849 Ga0207652_10027423
850 Ga0207652_10302150
851 Ga0207652_10695581
852 Ga0207652_11156127
853 Ga0207681_10221479
854 Ga0207694_10000810
855 Ga0207694_10006589
856 Ga0207694_10454373
857 Ga0207694_10921148
858 Ga0207694_11434106
859 Ga0207659_10748229
860 Ga0207700_10044410
861 Ga0207700_10546096
862 Ga0207700_10710785
863 Ga0207664_10709147
864 Ga0207690_10243672
865 Ga0207669_10164913
866 Ga0207665_10095941
867 Ga0207661_10000576
868 Ga0207661_10022604
869 Ga0207667_10004941
870 Ga0207667_10013218
871 Ga0207667_10183889
872 Ga0207667_10331620
873 Ga0207667_11182210
874 Ga0207668_10041631
875 Ga0207640_10016792
876 Ga0207640_10023559
877 Ga0207640_10055969
878 Ga0207640_10133243
879 Ga0207703_10101219
880 Ga0207639_10063070
881 Ga0207639_10101620
882 Ga0207639_10654282
883 Ga0207639_10709756
884 Ga0207639_11365229
885 Ga0207678_10033399
886 Ga0207678_10066758
887 Ga0207702_10000005
888 Ga0207702_10163668
889 Ga0207702_10400178
890 Ga0207674_10007959
891 Ga0207674_10012174
892 Ga0207674_10179282
893 Ga0265338_10753718
894 Ga0307511_10069156
895 Ga0316176_1128291
896 Ga0314311_1136470
897 Ga0265765_1016672
898 Ga0265332_10293539
899 Ga0265339_10108761
900 Ga0265331_10306433
901 Ga0307509_10255413
902 Ga0307508_10047425
903 Ga0307508_10263496
904 Ga0307508_10302223
905 Ga0265314_10134268
906 Ga0265314_10303763
907 Ga0265342_10004564
908 Ga0307405_10289742
909 Ga0307412_10595867
910 Ga0307416_100047483
911 Ga0307416_102418270
912 Ga0307507_10132748
913 Ga0373926_0028758
914 Ga0373934_0011245
915 Ga0373934_0033729
916 Ga0373944_0033918
917 Ga0373944_0441702
918 Ga0373923_0002543
919 Ga0373932_0127159
920 Ga0373936_0000545
921 Ga0373936_0003680
922 Ga0373936_0062253
923 Ga0373945_0094133
924 Ga0373945_0119499
925 Ga0373953_0013515
926 Ga0373954_0006146
927 Ga0373954_0016972
928 Ga0373954_0142169
929 Ga0373956_0010173
930 Ga0373956_0029350
931 Ga0373956_0561341
932 Ga0373957_0067431
933 Ga0373957_0133892
934 Ga0373943_0000449
935 Ga0373943_0024323
936 Ga0373946_0140154
937 Ga0373955_0000177
938 Ga0373955_0166451
939 Ga0373924_0000051
940 Ga0373924_0012896
941 Ga0373935_0000018
942 Ga0373935_0115552
943 Ga0373935_0419173
944 Ga0373935_0464219
945 Ga0373927_0005516
946 Ga0373927_0021259
947 Ga0373927_0036417
948 Ga0373927_0089864
949 Ga0373933_0080337
950 Ga0373933_0115244
951 Ga0373947_0000264
952 Ga0373947_0005784
953 Ga0373937_0000571
954 Ga0373937_0071235
955 Ga0373937_0076255
956 Ga0373937_0727513
957 Ga0373925_0000018
958 Ga0373925_0022168
959 Ga0373925_0047862
960 Ga0395899_0208052
961 Ga0395900_0055360
962 Ga0395898_0052949
963 Ga0436364_1267269
964 Ga0395901_0259107
965 Ga0436365_0114173
966 Ga0436365_0714059
967 Ga0436365_1021560
968 Ga0436360_0325899
969 Ga0436360_0483636
970 Ga0436360_0559001
971 Ga0436360_1359889
972 Ga0436361_0230534
973 Ga0436361_0349114
974 Ga0436363_0291288
975 Ga0436363_0429643
976 Ga0436362_0235669
977 Ga0436362_0243271
978 Ga0439447_064814
979 Ga0439461_0000044
980 Ga0439461_0014314
981 Ga0439466_0159117
982 Ga0439465_0001380
983 Ga0439465_0006731
984 Ga0451789_0300051
985 Ga0439431_0000185
986 Ga0439433_0040264
987 Ga0439442_003809
988 Ga0439445_0000740
989 Ga0439445_0077862
990 Ga0439432_000280
991 Ga0439432_033746
992 Ga0439452_017787
993 Ga0439452_042338
994 Ga0439457_012964
995 Ga0439462_0000118
996 Ga0439462_0218733
997 Ga0450920_041367
998 Ga0439446_0064809
999 Ga0439446_0198289
1000 Ga0439459_0030552
1001 Ga0466969_0047726
1002 Ga0466966_0122608
1003 Ga0466966_0883277
1004 Ga0466963_0038501
1005 Ga0466971_0151368
1006 Ga0466968_0036414
1007 Ga0466968_0138232
1008 Ga0466968_0215073
1009 Ga0466970_0026326
1010 Ga0466970_0970387
1011 Ga0466959_0256020
1012 Ga0466958_0362109
1013 Ga0466967_1935014
1014 Ga0495627_028150
1015 Ga0495592_0000001
1016 Ga0495603_0192175
1017 Ga0495629_0012920
1018 Ga0495629_0024232
1019 Ga0495638_0000029
1020 Ga0495638_0260592
1021 Ga0495651_0004527
1022 Ga0495651_0160521
1023 Ga0495651_0829632
1024 Ga0495653_0000015
1025 Ga0495653_0384284
1026 Ga0495580_0036269
1027 Ga0495580_0176271
1028 Ga0495639_0144628
1029 Ga0495662_0148473
1030 Ga0495664_0000001
1031 Ga0495664_0012380
1032 Ga0495664_0042664
1033 Ga0495607_0037321
1034 Ga0495583_0000147
1035 Ga0495606_0103784
1036 Ga0495608_0000116
1037 Ga0495610_0000015
1038 Ga0495616_0187967
1039 Ga0495618_0000021
1040 Ga0495618_0058906
1041 Ga0495620_0003997
1042 Ga0495620_0157793
1043 Ga0495628_0000005
1044 Ga0495628_0107821
1045 Ga0495630_0001024
1046 Ga0495630_0069763
1047 Ga0495632_0000565
1048 Ga0495632_0000689
1049 Ga0495632_0117610
1050 Ga0495643_0039018
1051 Ga0495648_0000020
1052 Ga0495652_0000001
1053 Ga0495652_0276977
1054 Ga0495665_0052744
1055 Ga0495665_0264342
1056 Ga0495665_0338890
1057 Ga0495640_0000006
1058 Ga0495640_0014823
1059 Ga0495587_0000012
1060 Ga0495645_0000004
1061 Ga0495645_0022863
1062 Ga0495622_0216257
1063 Ga0495633_0033883
1064 Ga0495667_0000001
1065 Ga0495667_0297651
1066 Ga0495634_0000388
1067 Ga0495625_0037310
1068 Ga0495625_0196947
1069 Ga0495625_0508891
1070 Ga0495635_0000007
1071 Ga0495635_0078182
1072 Ga0495661_0326691
1073 Ga0495657_0000250
1074 Ga0495599_0000002
1075 Ga0495623_0000116
1076 Ga0495623_0651660
1077 Ga0495646_0000049
1078 Ga0495646_0068818
1079 Ga0495647_0032421
1080 Ga0495658_0167661
1081 Ga0495658_0173351
1082 Ga0495613_0044521
1083 Ga0495613_0217940
1084 Ga0495624_0018939
1085 Ga0495624_0152493
1086 Ga0495670_0000003
1087 Ga0495671_0000022
1088 Ga0495600_0000013
1089 Ga0495660_0186793
1090 Ga0495581_0028974
1091 Ga0495581_0039780
1092 Ga0495604_0000007
1093 Ga0495604_0047239
1094 Ga0495674_0000001
1095 Ga0495674_0077744
1096 Ga0495676_0165436
1097 Ga0495676_0295721
1098 Ga0495680_0004250
1099 Ga0495675_0000014
1100 Ga0495673_0000051
1101 Ga0495681_0060649
1102 Ga0495681_0132601
1103 Ga0495684_0000219
1104 Ga0495684_0247631
1105 Ga0495686_0733276
1106 Ga0495593_0000454
1107 Ga0495593_0104486
1108 Ga0495602_0000004
1109 Ga0495614_0445079
1110 Ga0495615_0000016
1111 Ga0496102_0279407
1112 Ga0496106_0065584
1113 Ga0496106_0137878
1114 Ga0496107_0501697
1115 Ga0496108_0013032
1116 Ga0496109_0073319
1117 Ga0496109_1532629
1118 Ga0496114_0235448
1119 Ga0496114_0992313
1120 Ga0496115_0000266
1121 Ga0496115_0023737
1122 Ga0496116_0083195
1123 Ga0496116_0128967
1124 Ga0496117_0260560
1125 Ga0496118_0009363
1126 Ga0496119_0110083
1127 Ga0496119_0118995
1128 Ga0496119_0495431
1129 Ga0496121_0000238
1130 Ga0496121_0001825
1131 Ga0496121_0739713
1132 Ga0496122_0006343
1133 Ga0496122_0238034
1134 Ga0496122_0429574
1135 Ga0496123_0000440
1136 Ga0496123_0210525
1137 Ga0496124_0001345
1138 Ga0496124_0002038
1139 Ga0496124_0068733
1140 Ga0496124_0111607
1141 Ga0496124_0333964
1142 Ga0496125_0000063
1143 Ga0496125_0189615
1144 Ga0496125_0213410
1145 Ga0496125_0524815
1146 Ga0496126_0017613
1147 Ga0496126_0038874
1148 Ga0496126_0042213
1149 Ga0496126_0054522
1150 Ga0496126_0065422
1151 Ga0496126_0109046
1152 Ga0496126_0110744
1153 Ga0496126_0495052
1154 Ga0496126_1040100
1155 Ga0495682_0360435
1156 Ga0501031_0015829
1157 Ga0501032_0034960
1158 Ga0501033_0014007
1159 Ga0501033_0734925
1160 Ga0501034_0378591
1161 Ga0501036_0012806
1162 Ga0501036_0364927
1163 Ga0501038_0052181
1164 Ga0501038_0699489
1165 Ga0501039_0287725
1166 Ga0501040_0002835
1167 Ga0501041_0012337
1168 Ga0501042_0008945
1169 Ga0501042_0140885
1170 Ga0501046_0070868
1171 Ga0501046_0672434
1172 Ga0501047_1254921
1173 Ga0501048_0030319
1174 Ga0501048_1100706
1175 Ga0501068_0043233
1176 Ga0501068_1104302
1177 Ga0501070_0873605
1178 Ga0501071_0020046
1179 Ga0501071_0648317
1180 Ga0501072_0018509
1181 Ga0501072_0539611
1182 Ga0501073_0443911
1183 Ga0501074_0355803
1184 Ga0501074_0593838
1185 Ga0501075_0019580
1186 Ga0501076_0007904
1187 Ga0501076_0272490
1188 Ga0501077_0005478
1189 Ga0501077_0614245
1190 Ga0501238_016070
1191 Ga0501079_0011917
1192 Ga0501079_0535239
1193 Ga0501080_0051794
1194 Ga0501080_0429355
1195 Ga0501081_0095222
1196 Ga0501083_0304636
1197 Ga0501083_0630797
1198 Ga0501035_0034368
1199 Ga0501044_0271873
1200 Ga0501045_0003266
1201 Ga0501045_0158166
1202 Ga0501045_0788781
1203 nmdc:mga0n895_37825_c1
1204 nmdc:mga0n895_475922_c1
1205 nmdc:mga0n895_545069_c1
1206 nmdc:mga0n895_777984_c1
1207 nmdc:mga0rr50_625966_c1
1208 nmdc:mga08x19_1205569_c1
1209 Ga0495601_0000006
1210 Ga0495601_0013980
1211 Ga0495601_0293080
1212 Ga0495612_0000004
1213 Ga0495612_0010349
1214 Ga0495612_0028946
1215 Ga0500610_0419605
1216 Ga0495595_0000006
1217 Ga0495595_0150299
1218 Ga0495619_0000240
1219 Ga0500643_003201
1220 Ga0500643_004720
1221 Ga0500643_007280
1222 Ga0500651_0122601
1223 Ga0500566_0000177
1224 Ga0500650_0496832
1225 Ga0500652_330154
1226 Ga0500658_0031652
1227 Ga0500559_0002539
1228 Ga0500568_0187098
1229 Ga0500573_0404932
1230 Ga0500634_0122106
1231 Ga0500639_051518
1232 Ga0500637_0016161
1233 Ga0500637_0038298
1234 Ga0500657_088675
1235 Ga0500552_020105
1236 Ga0501084_0055522
1237 Ga0500661_000683
1238 Ga0501082_0014053
1239 Ga0501082_0334296
1240 Ga0466962_0027159
1241 Ga0530510_0012951
1242 2509153624
1243 2511129208
1244 2513891945
1245 2600225299
1246 2644128544
1247 2644287710
1248 2819713569
1249 2879165893
1250 2928530129
1251 2928972011
1252 2929203882
1253 2990266779
1254 2993693721
1255 8054307679
1256 8055912900

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06429

Flg_bbr_C

Flagellar basal body rod FlgEFG protein C-terminal

104

148

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6k9q-assembly1.cif.gz_Q structure of the native supercoiled hook as a universal joint 0.8809 15 88
7nvg-assembly1.cif.gz_V2 salmonella flagellar basal body refined in c1 map 0.8711 12 142
7cg0-assembly1.cif.gz_p cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.8638 10 140
7cg0-assembly1.cif.gz_i cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.8565 10 138
7cg0-assembly1.cif.gz_h cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.8547 10 138
ID Description Score Start End Superfamily
2oyqD04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.8681 103 141 1.10.287.690
af_Q13023_1080_1194_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8482 103 139 1.20.58.60
af_Q1LXZ7_784_997_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.7295 53 80 3.30.470.20
af_C6SW11_8_117_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7121 2 136 1.10.287.370
2iecC00 Alpha Beta;2-Layer Sandwich;Pantoate--beta-alanine Ligase; Chain: A,domain 2;7,8-dihydroneopterin aldolase (MptD) 0.6852 53 78 3.30.1300.20
ID Description Score Start End GO Terms
AF-A0A5R2N1W9-F1-model_v4 Flagellar basal body rod protein FlgC 0.9841 10 83
AF-A0A1S8GQX3-F1-model_v4 Flagellar basal-body rod protein FlgC 0.9815 9 141 GO:0030694
GO:0071978
AF-A0A077AYV1-F1-model_v4 Flagellar basal-body rod protein FlgC 0.9726 10 141 GO:0030694
GO:0071978
AF-A0A2W4NI85-F1-model_v4 deleted 0.9715 40 141
AF-A0A2W4ZVW5-F1-model_v4 Flagellar basal-body rod protein FlgC 0.9683 8 142 GO:0030694
GO:0071978

Map