F470657

General Info

Members Datasets Scaffolds Average Seq Length
628 511 344 138

Family's Representative Sequence

Representative Sequence 3300035171|Ga0373946_0685994|Ga0373946_0685994_25_507
Length 160
Sequence MSDITIYHNPACGTSRNTLALIRHAGIEPVVIEYLKTPPSREKLRELIAAMGISARELVREKGTPYAGLGLDDASLSDEQLLDAMLAHPILINRPIVVARLGTKLCRPSEEVLELLPVPKLAPFTKEDGDVVADSGRRRDPGNGKLTLPGAARSARRAGP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
5 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
6 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
7 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
8 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
9 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
10 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
11 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
12 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
13 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
14 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
15 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
16 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
17 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
18 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
19 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
20 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
21 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
22 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
23 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
24 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
25 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
26 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
27 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
28 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
29 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
30 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
31 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
32 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
33 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
34 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
35 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
36 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
37 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
38 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
39 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
40 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
41 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
42 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
43 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
44 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
45 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
46 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
47 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
48 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
49 2818991450 Burkholderia sp. 604 Isolate Unclassified
50 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
51 2838048938 Rhizobium pisi 27/80 Isolate Nodule
52 2838061910 Rhizobium phaseoli L15 Isolate Nodule
53 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
54 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
55 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
56 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
57 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
58 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
59 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
60 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
61 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
62 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
63 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
64 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
65 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
66 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
67 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
68 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
69 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
70 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
71 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
72 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
73 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
74 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
75 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
76 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
77 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
78 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
79 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
80 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
81 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
82 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
83 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
84 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
85 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
86 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
87 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
88 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
89 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
90 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
91 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
92 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
93 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
94 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
95 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
96 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
97 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
98 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
99 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
100 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
101 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
102 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
103 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
104 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
105 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
106 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
107 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
108 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
109 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
110 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
111 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
112 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
113 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
114 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
115 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
116 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
117 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
118 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
119 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
120 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
121 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
122 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
123 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
124 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
125 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
126 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
127 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
128 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
129 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
130 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
131 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
132 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
133 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
134 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
135 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
136 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
137 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
138 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
139 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
140 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
141 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
142 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
143 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
144 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
145 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
146 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
147 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
148 2933599457 Rhizobium phaseoli M3 Isolate Nodule
149 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
150 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
151 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
152 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
153 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
154 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
155 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
156 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
157 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
158 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
159 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
160 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
161 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
162 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
163 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
164 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
165 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
166 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
167 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
168 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
169 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
170 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
171 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
172 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
173 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
174 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
175 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
176 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
177 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
178 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
179 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
180 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
181 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
182 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
183 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
184 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
185 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
186 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
187 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
188 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
189 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
190 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
191 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
192 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
193 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
194 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
195 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
196 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
197 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
198 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
199 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
200 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
201 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
202 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
203 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
204 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
205 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
206 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
207 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
208 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
209 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
210 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
211 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
212 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
213 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
214 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
215 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
216 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
217 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
218 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
219 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
220 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
221 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
222 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
223 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
224 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
225 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
226 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
227 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
228 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
229 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
230 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
231 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
232 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
233 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
234 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
235 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
236 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
237 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
238 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
239 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
240 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
241 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
242 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
243 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
244 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
245 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
246 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
247 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
248 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
249 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
250 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
251 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
252 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
253 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
254 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
255 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
256 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
257 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
258 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
259 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
260 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
261 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
262 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
263 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
264 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
265 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
266 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
267 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
268 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
269 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
270 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
271 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
272 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
273 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
274 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
275 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
276 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
277 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
278 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
279 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
280 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
281 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
282 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
283 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
284 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
285 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
286 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
287 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
288 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
289 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
290 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
291 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
292 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
293 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
294 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
295 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
296 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
297 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
298 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
299 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
300 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
301 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
302 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
303 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
304 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
305 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
306 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
307 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
308 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
309 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
310 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
311 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
312 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
313 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
314 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
315 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
316 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
317 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
318 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
319 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
320 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
321 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
322 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
323 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
324 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
325 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
326 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
327 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
328 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
329 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
330 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
331 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
332 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
333 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
334 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
335 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
336 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
337 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
338 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
339 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
340 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
341 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
342 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
343 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
344 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
345 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
346 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
347 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
348 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
349 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
350 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
351 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
352 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
353 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
385 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
386 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
387 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
388 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
390 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
391 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
392 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
393 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
394 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
395 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
396 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
397 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
398 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
399 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
400 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
401 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
402 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
403 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
404 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
405 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
406 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
407 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
408 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
409 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
410 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
411 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
412 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
413 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
414 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
415 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
416 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
417 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
418 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
419 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
420 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
421 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
422 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
423 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
424 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
425 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
426 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
427 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
428 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
429 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
430 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
431 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
432 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
433 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
434 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
435 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
436 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
437 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
438 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
439 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
440 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
441 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
442 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
443 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
444 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
445 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
446 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
447 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
448 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
449 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
450 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
451 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
452 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
453 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
454 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
455 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
456 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
457 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
458 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
459 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
460 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
461 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
462 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
463 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
464 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
465 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
466 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
469 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
470 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
471 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
472 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
473 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
474 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
475 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
476 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
477 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
478 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
479 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
480 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
481 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
482 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
483 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
484 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
485 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
486 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
487 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
488 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
489 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
490 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
491 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
492 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
493 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
494 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
495 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
496 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
497 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
498 8005382845 Rhizobium sp. R634 Isolate Nodule
499 8005395548 Rhizobium sp. R339 Isolate Nodule
500 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
501 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
502 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
503 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
504 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
505 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
506 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
507 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
508 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
509 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
510 8024501048 Rhizobium sp. H4 Isolate Nodule
511 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.78
Metatranscriptomes 0
Isolates 45.22

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 13.54
Nodule 36.31
Rhizoplane 4.94
Rhizosphere 32.96
Stem 0
Stem Tuber 0
Unclassified 11.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1189119 2162886007 Bacteria 1364
2 JGI24737J22298_10039113 3300001990 Bacteria 1459
3 JGI24735J21928_10000694 3300002067 Bacteria 11946
4 JGI25151J46595_10002216 3300003187 Bacteria 12013
5 rootH2_10013979 3300003320 Bacteria 2350
6 rootH2_10020512 3300003320 Bacteria 1932
7 rootL2_10003492 3300003322 Bacteria 36420
8 rootL2_10014427 3300003322 Bacteria 9796
9 rootL2_10275712 3300003322 Bacteria 2488
10 rootH1_10005886 3300003323 Bacteria 9819
11 rootH1_10006122 3300003323 Bacteria 2617
12 rootH1_10030430 3300003323 Bacteria 6026
13 rootH1_10189449 3300003323 Bacteria 1365
14 Ga0055537_1000591 3300003773 Bacteria 20176
15 Ga0055537_1001007 3300003773 Bacteria 12764
16 Ga0055524_1026364 3300003775 Bacteria 1798
17 Ga0055534_1000129 3300003784 Bacteria 56688
18 Ga0055528_1000546 3300003790 Bacteria 28715
19 Ga0055530_10000834 3300003791 Bacteria 25475
20 Ga0055530_10083132 3300003791 Bacteria 669
21 Ga0055531_10002719 3300003794 Bacteria 11641
22 Ga0055531_10004707 3300003794 Bacteria 8164
23 Ga0065704_10080138 3300005289 Bacteria 4002
24 Ga0065715_10479805 3300005293 Bacteria 783
25 Ga0070658_11666947 3300005327 Bacteria 552
26 Ga0068869_100069327 3300005334 Bacteria 2607
27 Ga0070680_100131031 3300005336 Bacteria 2098
28 Ga0070682_100016576 3300005337 Bacteria 4287
29 Ga0070660_100196186 3300005339 Bacteria 1636
30 Ga0070691_10009447 3300005341 Bacteria 4450
31 Ga0070661_100245736 3300005344 Bacteria 1379
32 Ga0070668_102194678 3300005347 Bacteria 510
33 Ga0070659_100019285 3300005366 Bacteria 5165
34 Ga0070701_10520722 3300005438 Bacteria 775
35 Ga0070705_100102023 3300005440 Bacteria 1814
36 Ga0070694_100113675 3300005444 Bacteria 1932
37 Ga0070663_100011608 3300005455 Bacteria 5537
38 Ga0070678_100278059 3300005456 Bacteria 1414
39 Ga0070681_10071239 3300005458 Bacteria 3441
40 Ga0068867_100291237 3300005459 Bacteria 1342
41 Ga0070679_100027731 3300005530 Bacteria 5577
42 Ga0068853_100005835 3300005539 Bacteria 9697
43 Ga0070695_100068652 3300005545 Bacteria 2315
44 Ga0070693_100016157 3300005547 Bacteria 3858
45 Ga0070665_100124037 3300005548 Bacteria 2585
46 Ga0070664_100082956 3300005564 Bacteria 2764
47 Ga0068857_100073814 3300005577 Bacteria 3040
48 Ga0068854_100212820 3300005578 Bacteria 1526
49 Ga0070702_100528385 3300005615 Bacteria 871
50 Ga0068852_100009032 3300005616 Bacteria 7377
51 Ga0068852_100139501 3300005616 Bacteria 2242
52 Ga0068859_100282590 3300005617 Bacteria 1752
53 Ga0068859_101511826 3300005617 Bacteria 741
54 Ga0068864_100505416 3300005618 Bacteria 1163
55 Ga0068864_101070847 3300005618 Bacteria 801
56 Ga0068861_101152961 3300005719 Bacteria 747
57 Ga0068858_100724378 3300005842 Bacteria 968
58 Ga0068862_100976965 3300005844 Bacteria 836
59 Ga0075365_10391345 3300006038 Bacteria 981
60 Ga0075365_10436958 3300006038 Bacteria 924
61 Ga0075368_10000330 3300006042 Bacteria 13869
62 Ga0075368_10212567 3300006042 Bacteria 820
63 Ga0075364_10000022 3300006051 Bacteria 53466
64 Ga0075364_10002855 3300006051 Bacteria 9741
65 Ga0075364_10518298 3300006051 Bacteria 815
66 Ga0075367_10002007 3300006178 Bacteria 9075
67 Ga0075367_10085051 3300006178 Bacteria 1919
68 Ga0075367_10353709 3300006178 Bacteria 927
69 Ga0075367_10909487 3300006178 Bacteria 561
70 Ga0075369_10000533 3300006186 Bacteria 12019
71 Ga0075369_10002567 3300006186 Bacteria 6496
72 Ga0075366_10001429 3300006195 Bacteria 11908
73 Ga0075366_10005515 3300006195 Bacteria 6857
74 Ga0075366_10152647 3300006195 Bacteria 1399
75 Ga0075366_10249730 3300006195 Bacteria 1082
76 Ga0075366_10682106 3300006195 Bacteria 638
77 Ga0075370_10000054 3300006353 Bacteria 34222
78 Ga0075370_10114521 3300006353 Bacteria 1567
79 Ga0075370_10639923 3300006353 Bacteria 645
80 Ga0097620_100282590 3300006931 Bacteria 1752
81 Ga0097620_101511411 3300006931 Bacteria 741
82 Ga0079104_1004220 3300006946 Bacteria 6253
83 Ga0105251_10000029 3300009011 Bacteria 125097
84 Ga0105240_10348638 3300009093 Bacteria 1680
85 Ga0105243_10068610 3300009148 Bacteria 2858
86 Ga0105248_11437518 3300009177 Bacteria 780
87 Ga0105237_10036325 3300009545 Bacteria 4984
88 Ga0105238_10035562 3300009551 Bacteria 5064
89 Ga0105239_12543218 3300010375 Bacteria 597
90 Ga0157373_10136975 3300013100 Bacteria 1721
91 Ga0157370_10055090 3300013104 Bacteria 3790
92 Ga0157370_11219848 3300013104 Bacteria 678
93 Ga0157374_10195354 3300013296 Bacteria 1980
94 Ga0157378_10558321 3300013297 Bacteria 1151
95 Ga0163162_10366056 3300013306 Bacteria 1575
96 Ga0157372_10236779 3300013307 Bacteria 2117
97 Ga0157375_10103761 3300013308 Bacteria 2931
98 Ga0157375_10313638 3300013308 Bacteria 1733
99 Ga0157375_11796607 3300013308 Bacteria 727
100 Ga0157380_10054256 3300014326 Bacteria 3180
101 Ga0157379_10247189 3300014968 Bacteria 1619
102 Ga0157379_10900668 3300014968 Bacteria 839
103 Ga0157376_10354427 3300014969 Bacteria 1405
104 Ga0182006_1191339 3300015261 Bacteria 680
105 Ga0182007_10000788 3300015262 Bacteria 17720
106 Ga0163161_10074887 3300017792 Bacteria 2483
107 Ga0163161_10092094 3300017792 Bacteria 2244
108 Ga0163161_10545236 3300017792 Bacteria 950
109 Ga0214543_1000003 3300021327 Bacteria 692327
110 Ga0207425_1048308 3300025245 Bacteria 786
111 Ga0209565_1000050 3300025263 Bacteria 213856
112 Ga0209565_1028375 3300025263 Bacteria 1106
113 Ga0209673_1000859 3300025273 Bacteria 39489
114 Ga0209673_1033792 3300025273 Bacteria 1553
115 Ga0209675_1000007 3300025291 Bacteria 683430
116 Ga0209676_1000018 3300025292 Bacteria 631385
117 Ga0209676_1000716 3300025292 Bacteria 45721
118 Ga0209676_1104216 3300025292 Bacteria 598
119 Ga0209025_1000062 3300025294 Bacteria 304236
120 Ga0209564_1000061 3300025295 Bacteria 322795
121 Ga0209564_1011921 3300025295 Bacteria 3841
122 Ga0209050_1000562 3300025298 Bacteria 60493
123 Ga0209050_1022022 3300025298 Bacteria 2299
124 Ga0209050_1065007 3300025298 Bacteria 843
125 Ga0209256_1003428 3300025299 Bacteria 11139
126 Ga0209256_1016947 3300025299 Bacteria 2451
127 Ga0209051_1007254 3300025303 Bacteria 6093
128 Ga0209257_1000035 3300025304 Bacteria 631463
129 Ga0209257_1001300 3300025304 Bacteria 30429
130 Ga0209257_1002553 3300025304 Bacteria 17757
131 Ga0209257_1020575 3300025304 Bacteria 2432
132 Ga0207713_1000112 3300025735 Bacteria 133341
133 Ga0207682_10001290 3300025893 Bacteria 11504
134 Ga0207682_10031052 3300025893 Bacteria 2143
135 Ga0207680_10183602 3300025903 Bacteria 1416
136 Ga0207647_10004846 3300025904 Bacteria 9952
137 Ga0207645_10585311 3300025907 Bacteria 757
138 Ga0207707_10060781 3300025912 Bacteria 3287
139 Ga0207695_10049462 3300025913 Bacteria 4430
140 Ga0207695_10245490 3300025913 Bacteria 1690
141 Ga0207671_10163468 3300025914 Bacteria 1725
142 Ga0207660_10078141 3300025917 Bacteria 2424
143 Ga0207662_10790432 3300025918 Bacteria 668
144 Ga0207657_10207932 3300025919 Bacteria 1572
145 Ga0207649_10170107 3300025920 Bacteria 1517
146 Ga0207652_10214136 3300025921 Bacteria 1735
147 Ga0207644_10120861 3300025931 Bacteria 1994
148 Ga0207709_10128260 3300025935 Bacteria 1724
149 Ga0207709_10647484 3300025935 Bacteria 841
150 Ga0207711_10285980 3300025941 Bacteria 1519
151 Ga0207689_10114665 3300025942 Bacteria 2215
152 Ga0207679_10390098 3300025945 Bacteria 1223
153 Ga0207679_10492717 3300025945 Bacteria 1092
154 Ga0207667_10982150 3300025949 Bacteria 832
155 Ga0207668_11697237 3300025972 Bacteria 570
156 Ga0207658_10061941 3300025986 Bacteria 2798
157 Ga0207677_10402120 3300026023 Bacteria 1162
158 Ga0207703_10165825 3300026035 Bacteria 1938
159 Ga0207639_10035093 3300026041 Bacteria 3710
160 Ga0207678_10001716 3300026067 Bacteria 20067
161 Ga0207702_10236738 3300026078 Bacteria 1709
162 Ga0207648_10243037 3300026089 Bacteria 1603
163 Ga0207676_10500380 3300026095 Bacteria 1154
164 Ga0207676_11193615 3300026095 Bacteria 754
165 Ga0207674_10082431 3300026116 Bacteria 3217
166 Ga0207675_100162321 3300026118 Bacteria 2132
167 Ga0207675_100382843 3300026118 Bacteria 1384
168 Ga0207683_10009322 3300026121 Bacteria 8362
169 Ga0209281_1000332 3300027111 Bacteria 81534
170 Ga0209371_1001542 3300027312 Bacteria 15243
171 Ga0209813_10000092 3300027866 Bacteria 33357
172 Ga0209974_10023613 3300027876 Bacteria 2035
173 Ga0268266_10171365 3300028379 Bacteria 1970
174 Ga0268266_12363389 3300028379 Bacteria 502
175 Ga0268256_1031220 3300030500 Bacteria 1281
176 Ga0265328_10007359 3300031239 Bacteria 4592
177 Ga0265327_10000147 3300031251 Bacteria 153254
178 Ga0307513_10030116 3300031456 Bacteria 6171
179 Ga0307513_10506407 3300031456 Bacteria 924
180 Ga0307405_10000918 3300031731 Bacteria 11737
181 Ga0307409_100930960 3300031995 Bacteria 884
182 Ga0307409_101207978 3300031995 Bacteria 780
183 Ga0307416_100548068 3300032002 Bacteria 1229
184 Ga0307414_10181354 3300032004 Bacteria 1694
185 Ga0307411_10279734 3300032005 Bacteria 1327
186 Ga0373946_0685994 3300035171 Bacteria 535
187 Ga0373935_0982501 3300035692 Bacteria 627
188 Ga0395898_0052130 3300037466 Bacteria 3997
189 Ga0439465_0235346 3300041413 Bacteria 674
190 Ga0451797_0542997 3300041453 Bacteria 2315
191 Ga0451804_0477314 3300041463 Bacteria 520
192 Ga0451833_0114529 3300041491 Bacteria 573
193 Ga0451837_0097586 3300041494 Bacteria 1008
194 Ga0451837_0313458 3300041494 Bacteria 733
195 Ga0451839_0447087 3300041496 Bacteria 674
196 Ga0451843_1531609 3300041509 Bacteria 1767
197 Ga0439433_0049165 3300041999 Bacteria 992
198 Ga0439432_000838 3300042006 Bacteria 11493
199 Ga0439449_0004268 3300042007 Bacteria 5523
200 Ga0450915_016376 3300042119 Bacteria 564
201 Ga0439459_0016280 3300042438 Bacteria 1373
202 Ga0466963_0000912 3300044694 Bacteria 15041
203 Ga0466964_0185865 3300044706 Bacteria 988
204 Ga0453684_0511605 3300044712 Bacteria 1328
205 Ga0466970_0102844 3300044765 Bacteria 1556
206 Ga0466959_0277801 3300045049 Bacteria 1150
207 Ga0466958_0101421 3300045836 Bacteria 1790
208 Ga0466967_0131623 3300045976 Bacteria 2323
209 Ga0495627_176446 3300046453 Bacteria 592
210 Ga0495650_0001132 3300046471 Bacteria 28975
211 Ga0495650_0034519 3300046471 Bacteria 2238
212 Ga0495607_0100318 3300046501 Bacteria 1552
213 Ga0495583_0003433 3300046506 Bacteria 12061
214 Ga0495606_0080537 3300046507 Bacteria 2026
215 Ga0495606_0283420 3300046507 Bacteria 905
216 Ga0495610_0002834 3300046512 Bacteria 14106
217 Ga0495610_0002893 3300046512 Bacteria 13895
218 Ga0495616_0423507 3300046513 Bacteria 543
219 Ga0495620_0028628 3300046515 Bacteria 2588
220 Ga0495628_0091841 3300046516 Bacteria 2349
221 Ga0495643_0000509 3300046522 Bacteria 48505
222 Ga0495643_0051616 3300046522 Bacteria 2211
223 Ga0495663_0001346 3300046525 Bacteria 7766
224 Ga0495654_0000080 3300046530 Bacteria 109402
225 Ga0495667_0139561 3300046559 Bacteria 1562
226 Ga0495668_0318292 3300046616 Bacteria 853
227 Ga0495658_0147738 3300046683 Bacteria 1442
228 Ga0495670_0462939 3300046691 Bacteria 687
229 Ga0495671_0186115 3300046692 Bacteria 1008
230 Ga0495674_0053452 3300047319 Bacteria 3550
231 Ga0495672_0000002 3300047320 Bacteria 740116
232 Ga0495672_0000355 3300047320 Bacteria 58647
233 Ga0495672_0008236 3300047320 Bacteria 7727
234 Ga0495679_122940 3300047446 Bacteria 708
235 Ga0495673_0065076 3300047469 Bacteria 1549
236 Ga0495686_0000021 3300047472 Bacteria 426560
237 Ga0495686_0013246 3300047472 Bacteria 5729
238 Ga0496100_0261998 3300048903 Bacteria 1282
239 Ga0496100_0287351 3300048903 Bacteria 1228
240 Ga0496101_0059267 3300048904 Bacteria 2774
241 Ga0496101_0586597 3300048904 Bacteria 881
242 Ga0496102_0176911 3300048905 Bacteria 2009
243 Ga0496102_0365872 3300048905 Bacteria 1357
244 Ga0496102_0961633 3300048905 Bacteria 775
245 Ga0496103_0027051 3300048906 Bacteria 3473
246 Ga0496104_0081202 3300048907 Bacteria 3092
247 Ga0496104_0085211 3300048907 Bacteria 3016
248 Ga0496104_1073859 3300048907 Bacteria 709
249 Ga0496105_0047136 3300048908 Bacteria 3556
250 Ga0496105_0181176 3300048908 Bacteria 1725
251 Ga0496105_0389704 3300048908 Bacteria 1108
252 Ga0496105_0545405 3300048908 Bacteria 905
253 Ga0496106_0065006 3300048909 Bacteria 2776
254 Ga0496107_0055747 3300048910 Bacteria 2854
255 Ga0496107_0442638 3300048910 Bacteria 965
256 Ga0496108_0034345 3300048911 Bacteria 4214
257 Ga0496109_0153683 3300048912 Bacteria 2155
258 Ga0496110_0417501 3300048913 Bacteria 1223
259 Ga0496111_0397228 3300048914 Bacteria 1019
260 Ga0496114_0064996 3300048917 Bacteria 3056
261 Ga0496114_0295223 3300048917 Bacteria 1430
262 Ga0496114_0359004 3300048917 Bacteria 1289
263 Ga0496115_0104349 3300048918 Bacteria 2326
264 Ga0496115_0273139 3300048918 Bacteria 1388
265 Ga0496116_0122568 3300048919 Bacteria 1501
266 Ga0496116_0158348 3300048919 Bacteria 1246
267 Ga0496117_0019831 3300048920 Bacteria 5507
268 Ga0496118_0000692 3300048921 Bacteria 54767
269 Ga0496118_0057336 3300048921 Bacteria 2920
270 Ga0496118_0070020 3300048921 Bacteria 2536
271 Ga0496121_0000190 3300048924 Bacteria 136607
272 Ga0496121_0007470 3300048924 Bacteria 13197
273 Ga0496121_0107254 3300048924 Bacteria 2139
274 Ga0496121_0159568 3300048924 Bacteria 1651
275 Ga0496121_0220269 3300048924 Bacteria 1337
276 Ga0496121_0339601 3300048924 Bacteria 1004
277 Ga0496122_0151578 3300048925 Bacteria 1430
278 Ga0496123_0059633 3300048926 Bacteria 2465
279 Ga0496123_0280741 3300048926 Bacteria 805
280 Ga0496124_0005662 3300048927 Bacteria 13938
281 Ga0496124_0093271 3300048927 Bacteria 2451
282 Ga0496124_0148735 3300048927 Bacteria 1840
283 Ga0496124_0220111 3300048927 Bacteria 1428
284 Ga0496125_0004808 3300048928 Bacteria 15356
285 Ga0496125_0153231 3300048928 Bacteria 1579
286 Ga0496126_0027270 3300048929 Bacteria 5458
287 Ga0496126_0064155 3300048929 Bacteria 3291
288 Ga0496126_0094332 3300048929 Bacteria 2626
289 Ga0496126_0166894 3300048929 Bacteria 1878
290 Ga0495678_025628 3300049459 Bacteria 2529
291 Ga0495678_116533 3300049459 Bacteria 903
292 Ga0501031_0422083 3300049568 Bacteria 862
293 Ga0501032_0816024 3300049569 Bacteria 589
294 Ga0501033_0005536 3300049570 Bacteria 9990
295 Ga0501034_0084714 3300049571 Bacteria 3171
296 Ga0501034_0113961 3300049571 Bacteria 2693
297 Ga0501034_0439655 3300049571 Bacteria 1223
298 Ga0501034_0905632 3300049571 Bacteria 770
299 Ga0501036_0331572 3300049572 Bacteria 1271
300 Ga0501043_0013507 3300049579 Bacteria 6389
301 Ga0501043_0134394 3300049579 Bacteria 1938
302 Ga0501043_0349780 3300049579 Bacteria 1123
303 Ga0501047_0010908 3300049581 Bacteria 8593
304 Ga0501047_0028286 3300049581 Bacteria 5404
305 Ga0501047_0627933 3300049581 Bacteria 895
306 Ga0501074_0217987 3300049590 Bacteria 1359
307 Ga0501238_009713 3300049671 Bacteria 1278
308 Ga0501080_0011592 3300049742 Bacteria 8072
309 Ga0501035_0006507 3300049822 Bacteria 10975
310 Ga0501044_0154031 3300049823 Bacteria 2279
311 Ga0501044_0170354 3300049823 Bacteria 2149
312 Ga0501044_0246972 3300049823 Bacteria 1727
313 nmdc:mga03683_1897_c2 3300050489 Bacteria 5857
314 nmdc:mga03n38_11652_c1 3300050490 Bacteria 3284
315 nmdc:mga03n38_854115_c1 3300050490 Bacteria 532
316 nmdc:mga00v17_214_c1 3300050491 Bacteria 34878
317 nmdc:mga00v17_91_c1 3300050491 Bacteria 53223
318 nmdc:mga0yw44_201841_c1 3300050492 Bacteria 1012
319 nmdc:mga0yw44_229367_c1 3300050492 Bacteria 1232
320 nmdc:mga0yw44_248657_c2 3300050492 Bacteria 859
321 nmdc:mga0yw44_727_c2 3300050492 Bacteria 11571
322 nmdc:mga0k408_566_c2 3300050493 Bacteria 13737
323 nmdc:mga0k408_79218_c1 3300050493 Bacteria 1922
324 nmdc:mga0k408_799742_c1 3300050493 Bacteria 549
325 nmdc:mga06z11_24916_c1 3300050494 Bacteria 2828
326 nmdc:mga06z11_48_c1 3300050494 Bacteria 51095
327 nmdc:mga06z11_62457_c1 3300050494 Bacteria 1946
328 nmdc:mga06z11_766419_c1 3300050494 Bacteria 588
329 nmdc:mga04h51_57_c1 3300050495 Bacteria 35214
330 nmdc:mga07m45_318_c1 3300050496 Bacteria 19459
331 nmdc:mga07m45_4447_c1 3300050496 Bacteria 6859
332 nmdc:mga07m45_77822_c1 3300050496 Bacteria 1892
333 nmdc:mga0sz30_34_c1 3300050516 Bacteria 53573
334 nmdc:mga0sz30_4012_c2 3300050516 Bacteria 4988
335 nmdc:mga0sz30_74976_c1 3300050516 Bacteria 1460
336 Ga0500583_0037433 3300053092 Bacteria 2179
337 Ga0500583_0050988 3300053092 Bacteria 1921
338 Ga0500595_085413 3300053119 Bacteria 919
339 Ga0500607_000293 3300053121 Bacteria 47399
340 Ga0500577_0167791 3300053142 Bacteria 938
341 Ga0500634_0009498 3300053161 Bacteria 4926
342 Ga0500645_028765 3300053730 Bacteria 1680
343 Ga0500565_012222 3300053734 Bacteria 909
344 Ga0466962_0085681 3300061719 Bacteria 1508

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053730 Ga0500645_028765 Ga0500645_028765_635_1114 114
2 3300009093 Ga0105240_10348638 Ga0105240_103486383 126
3 3300025913 Ga0207695_10245490 Ga0207695_102454902 126
4 3300041494 Ga0451837_0097586 Ga0451837_0097586_522_962 126
5 3300041509 Ga0451843_1531609 Ga0451843_1531609_729_1169 126
6 3300003322 rootL2_10275712 rootL2_102757123 127
7 3300003323 rootH1_10005886 rootH1_100058868 127
8 3300005616 Ga0068852_100009032 Ga0068852_1000090326 127
9 3300005618 Ga0068864_101070847 Ga0068864_1010708472 127
10 3300026095 Ga0207676_10500380 Ga0207676_105003802 127
11 3300041463 Ga0451804_0477314 Ga0451804_0477314_92_478 127
12 3300006042 Ga0075368_10000330 Ga0075368_100003303 128
13 3300006178 Ga0075367_10002007 Ga0075367_100020075 128
14 3300006353 Ga0075370_10114521 Ga0075370_101145212 128
15 3300013104 Ga0157370_11219848 Ga0157370_112198482 128
16 3300013308 Ga0157375_11796607 Ga0157375_117966072 128
17 3300025949 Ga0207667_10982150 Ga0207667_109821502 128
18 3300027866 Ga0209813_10000092 Ga0209813_100000928 128
19 3300035692 Ga0373935_0982501 Ga0373935_0982501_172_594 128
20 3300050490 nmdc:mga03n38_11652_c1 nmdc:mga03n38_11652_c1_866_1279 128
21 3300050494 nmdc:mga06z11_48_c1 nmdc:mga06z11_48_c1_47693_48106 128
22 3300050495 nmdc:mga04h51_57_c1 nmdc:mga04h51_57_c1_28703_29116 128
23 3300050496 nmdc:mga07m45_4447_c1 nmdc:mga07m45_4447_c1_1058_1471 128
24 3300053121 Ga0500607_000293 Ga0500607_000293_29800_30231 128
25 iso_pu_bacteria 2891373044 2891373984 128
26 iso_pu_bacteria 2585427594 2585843947 129
27 iso_pu_bacteria 2667528175 2671117984 129
28 iso_pu_bacteria 2775507266 2778177100 129
29 iso_pu_bacteria 2818991448 2819608624 129
30 iso_pu_bacteria 2842482326 2842486142 129
31 iso_pu_bacteria 2852387548 2852388203 129
32 iso_pu_bacteria 8005484373 8005484727 129
33 iso_pu_bacteria 8005645114 8005649420 129
34 3300047320 Ga0495672_0008236 Ga0495672_0008236_507_950 130
35 iso_pu_bacteria 2513237098 2513672509 130
36 iso_pu_bacteria 2582581294 2585201048 130
37 iso_pu_bacteria 2582581304 2585256173 130
38 iso_pu_bacteria 2903768456 2903775978 130
39 iso_pu_bacteria 2977240413 2977242959 130
40 3300003320 rootH2_10020512 rootH2_100205122 132
41 3300003322 rootL2_10014427 rootL2_100144279 132
42 3300003323 rootH1_10006122 rootH1_100061222 132
43 3300003323 rootH1_10189449 rootH1_101894492 132
44 3300006038 Ga0075365_10391345 Ga0075365_103913452 132
45 3300006042 Ga0075368_10212567 Ga0075368_102125671 132
46 3300006051 Ga0075364_10518298 Ga0075364_105182981 132
47 3300006178 Ga0075367_10085051 Ga0075367_100850513 132
48 3300013104 Ga0157370_10055090 Ga0157370_100550902 132
49 3300026078 Ga0207702_10236738 Ga0207702_102367382 132
50 3300027312 Ga0209371_1001542 Ga0209371_100154216 132
51 3300030500 Ga0268256_1031220 Ga0268256_10312202 132
52 3300031731 Ga0307405_10000918 Ga0307405_1000091812 132
53 3300044694 Ga0466963_0000912 Ga0466963_0000912_3616_4017 132
54 3300044706 Ga0466964_0185865 Ga0466964_0185865_288_689 132
55 3300044765 Ga0466970_0102844 Ga0466970_0102844_729_1130 132
56 3300045049 Ga0466959_0277801 Ga0466959_0277801_496_897 132
57 3300045836 Ga0466958_0101421 Ga0466958_0101421_373_774 132
58 3300045976 Ga0466967_0131623 Ga0466967_0131623_714_1115 132
59 3300048919 Ga0496116_0158348 Ga0496116_0158348_380_781 132
60 3300048924 Ga0496121_0339601 Ga0496121_0339601_418_819 132
61 3300050494 nmdc:mga06z11_62457_c1 nmdc:mga06z11_62457_c1_1370_1774 132
62 3300050496 nmdc:mga07m45_77822_c1 nmdc:mga07m45_77822_c1_1082_1486 132
63 3300061719 Ga0466962_0085681 Ga0466962_0085681_936_1337 132
64 3300005719 Ga0068861_101152961 Ga0068861_1011529612 133
65 3300006038 Ga0075365_10436958 Ga0075365_104369582 133
66 3300026118 Ga0207675_100382843 Ga0207675_1003828433 133
67 3300037466 Ga0395898_0052130 Ga0395898_0052130_564_965 133
68 3300046453 Ga0495627_176446 Ga0495627_176446_42_446 133
69 3300046471 Ga0495650_0034519 Ga0495650_0034519_1252_1656 133
70 3300046507 Ga0495606_0080537 Ga0495606_0080537_182_586 133
71 3300046512 Ga0495610_0002834 Ga0495610_0002834_11671_12075 133
72 3300046515 Ga0495620_0028628 Ga0495620_0028628_1353_1757 133
73 3300046522 Ga0495643_0051616 Ga0495643_0051616_1648_2052 133
74 3300046616 Ga0495668_0318292 Ga0495668_0318292_101_505 133
75 3300047472 Ga0495686_0013246 Ga0495686_0013246_2942_3346 133
76 3300048921 Ga0496118_0057336 Ga0496118_0057336_415_819 133
77 3300048927 Ga0496124_0093271 Ga0496124_0093271_619_1023 133
78 3300049459 Ga0495678_025628 Ga0495678_025628_854_1258 133
79 3300050492 nmdc:mga0yw44_201841_c1 nmdc:mga0yw44_201841_c1_146_547 133
80 3300050492 nmdc:mga0yw44_229367_c1 nmdc:mga0yw44_229367_c1_64_468 133
81 iso_pu_bacteria 2842757796 2842760514 133
82 iso_pu_bacteria 2941489479 2941493736 133
83 3300005293 Ga0065715_10479805 Ga0065715_104798052 134
84 3300005548 Ga0070665_100124037 Ga0070665_1001240372 134
85 3300006178 Ga0075367_10909487 Ga0075367_109094872 134
86 3300006195 Ga0075366_10249730 Ga0075366_102497301 134
87 3300025907 Ga0207645_10585311 Ga0207645_105853112 134
88 3300028379 Ga0268266_10171365 Ga0268266_101713652 134
89 3300042438 Ga0439459_0016280 Ga0439459_0016280_928_1338 134
90 3300046522 Ga0495643_0000509 Ga0495643_0000509_11652_12056 134
91 3300047320 Ga0495672_0000355 Ga0495672_0000355_12109_12513 134
92 3300048905 Ga0496102_0365872 Ga0496102_0365872_277_684 134
93 3300048908 Ga0496105_0047136 Ga0496105_0047136_1329_1736 134
94 3300048918 Ga0496115_0104349 Ga0496115_0104349_205_612 134
95 3300050493 nmdc:mga0k408_799742_c1 nmdc:mga0k408_799742_c1_30_464 134
96 3300050494 nmdc:mga06z11_766419_c1 nmdc:mga06z11_766419_c1_102_506 134
97 3300050516 nmdc:mga0sz30_74976_c1 nmdc:mga0sz30_74976_c1_496_903 134
98 3300053734 Ga0500565_012222 Ga0500565_012222_101_505 134
99 3300006195 Ga0075366_10682106 Ga0075366_106821062 135
100 3300009177 Ga0105248_11437518 Ga0105248_114375181 135
101 iso_pu_bacteria 2747842428 2747950689 135
102 iso_pu_bacteria 2928521798 2928522018 135
103 iso_pu_bacteria 2961064222 2961067309 135
104 iso_pu_bacteria 2974307012 2974307367 135
105 iso_pu_bacteria 2977247770 2977248117 135
106 iso_pu_bacteria 2984514374 2984517430 135
107 3300003773 Ga0055537_1000591 Ga0055537_10005913 136
108 3300003773 Ga0055537_1001007 Ga0055537_100100712 136
109 3300003775 Ga0055524_1026364 Ga0055524_10263642 136
110 3300003784 Ga0055534_1000129 Ga0055534_100012939 136
111 3300003790 Ga0055528_1000546 Ga0055528_10005469 136
112 3300017792 Ga0163161_10074887 Ga0163161_100748872 136
113 3300025263 Ga0209565_1000050 Ga0209565_100005034 136
114 3300025273 Ga0209673_1000859 Ga0209673_100085914 136
115 3300025291 Ga0209675_1000007 Ga0209675_1000007360 136
116 3300025295 Ga0209564_1000061 Ga0209564_1000061133 136
117 3300025299 Ga0209256_1016947 Ga0209256_10169474 136
118 3300025304 Ga0209257_1020575 Ga0209257_10205754 136
119 3300050490 nmdc:mga03n38_854115_c1 nmdc:mga03n38_854115_c1_16_435 136
120 iso_pu_bacteria 2509276019 2509374507 136
121 iso_pu_bacteria 2510065057 2510306599 136
122 iso_pu_bacteria 2511231052 2511500962 136
123 iso_pu_bacteria 2513237086 2513583500 136
124 iso_pu_bacteria 2513237091 2513617651 136
125 iso_pu_bacteria 2513237140 2513882713 136
126 iso_pu_bacteria 2513237143 2513905258 136
127 iso_pu_bacteria 2516653046 2516892243 136
128 iso_pu_bacteria 2537561587 2537876750 136
129 iso_pu_bacteria 2551306084 2551676422 136
130 iso_pu_bacteria 2551306085 2551687221 136
131 iso_pu_bacteria 2551306086 2551694403 136
132 iso_pu_bacteria 2551306087 2551703176 136
133 iso_pu_bacteria 2551306089 2551712363 136
134 iso_pu_bacteria 2551306090 2551720684 136
135 iso_pu_bacteria 2551306092 2551732606 136
136 iso_pu_bacteria 2551306093 2551740392 136
137 iso_pu_bacteria 2558860100 2558863534 136
138 iso_pu_bacteria 2574179768 2574430553 136
139 iso_pu_bacteria 2615840624 2616292272 136
140 iso_pu_bacteria 2690316117 2692319446 136
141 iso_pu_bacteria 2718217997 2719665791 136
142 iso_pu_bacteria 2718218199 2720492211 136
143 iso_pu_bacteria 2718218233 2720620351 136
144 iso_pu_bacteria 2718218235 2720631775 136
145 iso_pu_bacteria 2718218269 2720775503 136
146 iso_pu_bacteria 2721755684 2723560734 136
147 iso_pu_bacteria 2721755685 2723567322 136
148 iso_pu_bacteria 2721755819 2724090110 136
149 iso_pu_bacteria 2721755822 2724104587 136
150 iso_pu_bacteria 2721755823 2724110388 136
151 iso_pu_bacteria 2808606415 2809129384 136
152 iso_pu_bacteria 2808606419 2809149561 136
153 iso_pu_bacteria 2818991448 2819613680 136
154 iso_pu_bacteria 2838016132 2838018020 136
155 iso_pu_bacteria 2838048938 2838053552 136
156 iso_pu_bacteria 2838061910 2838065618 136
157 iso_pu_bacteria 2838068647 2838074333 136
158 iso_pu_bacteria 2838668709 2838674422 136
159 iso_pu_bacteria 2838675328 2838676367 136
160 iso_pu_bacteria 2838701080 2838706950 136
161 iso_pu_bacteria 2838714209 2838715250 136
162 iso_pu_bacteria 2838719591 2838720950 136
163 iso_pu_bacteria 2838724970 2838726008 136
164 iso_pu_bacteria 2839993093 2839994920 136
165 iso_pu_bacteria 2841846520 2841847908 136
166 iso_pu_bacteria 2841859092 2841859567 136
167 iso_pu_bacteria 2842124991 2842126062 136
168 iso_pu_bacteria 2842130223 2842131261 136
169 iso_pu_bacteria 2842146304 2842151478 136
170 iso_pu_bacteria 2842152218 2842153569 136
171 iso_pu_bacteria 2842170452 2842171493 136
172 iso_pu_bacteria 2842175837 2842177189 136
173 iso_pu_bacteria 2842187318 2842188358 136
174 iso_pu_bacteria 2842211629 2842212669 136
175 iso_pu_bacteria 2842224351 2842225712 136
176 iso_pu_bacteria 2842250916 2842256616 136
177 iso_pu_bacteria 2842264693 2842265854 136
178 iso_pu_bacteria 2842285085 2842285946 136
179 iso_pu_bacteria 2842311132 2842314427 136
180 iso_pu_bacteria 2842317721 2842317726 136
181 iso_pu_bacteria 2842402390 2842403305 136
182 iso_pu_bacteria 2842409023 2842409322 136
183 iso_pu_bacteria 2842415677 2842415975 136
184 iso_pu_bacteria 2842422224 2842427552 136
185 iso_pu_bacteria 2842428310 2842429509 136
186 iso_pu_bacteria 2842434925 2842436122 136
187 iso_pu_bacteria 2842441272 2842442469 136
188 iso_pu_bacteria 2842447887 2842450762 136
189 iso_pu_bacteria 2842462802 2842463930 136
190 iso_pu_bacteria 2842469257 2842470451 136
191 iso_pu_bacteria 2842489311 2842490216 136
192 iso_pu_bacteria 2842515876 2842516352 136
193 iso_pu_bacteria 2847417321 2847422052 136
194 iso_pu_bacteria 2848992105 2848997030 136
195 iso_pu_bacteria 2850079185 2850080427 136
196 iso_pu_bacteria 2852618963 2852619712 136
197 iso_pu_bacteria 2855825444 2855831313 136
198 iso_pu_bacteria 2855839649 2855840438 136
199 iso_pu_bacteria 2858800743 2858800966 136
200 iso_pu_bacteria 2894652903 2894656382 136
201 iso_pu_bacteria 2915986958 2915990904 136
202 iso_pu_bacteria 2915993759 2915996270 136
203 iso_pu_bacteria 2916000859 2916005748 136
204 iso_pu_bacteria 2916007675 2916010917 136
205 iso_pu_bacteria 2916014648 2916016554 136
206 iso_pu_bacteria 2916021584 2916024753 136
207 iso_pu_bacteria 2916035215 2916038155 136
208 iso_pu_bacteria 2916041962 2916047917 136
209 iso_pu_bacteria 2916048683 2916054362 136
210 iso_pu_bacteria 2916055098 2916055367 136
211 iso_pu_bacteria 2916068649 2916073449 136
212 iso_pu_bacteria 2916076590 2916078177 136
213 iso_pu_bacteria 2921201388 2921204931 136
214 iso_pu_bacteria 2921208531 2921213521 136
215 iso_pu_bacteria 2921237296 2921241613 136
216 iso_pu_bacteria 2921244191 2921247525 136
217 iso_pu_bacteria 2921257292 2921261600 136
218 iso_pu_bacteria 2921263974 2921264244 136
219 iso_pu_bacteria 2921282425 2921282759 136
220 iso_pu_bacteria 2921289301 2921290139 136
221 iso_pu_bacteria 2921296804 2921303398 136
222 iso_pu_bacteria 2924144063 2924145609 136
223 iso_pu_bacteria 2924150972 2924157261 136
224 iso_pu_bacteria 2924158325 2924160564 136
225 iso_pu_bacteria 2924165586 2924168160 136
226 iso_pu_bacteria 2924172951 2924173407 136
227 iso_pu_bacteria 2924179722 2924186323 136
228 iso_pu_bacteria 2924186466 2924189503 136
229 iso_pu_bacteria 2924193448 2924198239 136
230 iso_pu_bacteria 2924200457 2924204068 136
231 iso_pu_bacteria 2924207177 2924209900 136
232 iso_pu_bacteria 2924214083 2924215185 136
233 iso_pu_bacteria 2924221636 2924226238 136
234 iso_pu_bacteria 2924228884 2924234925 136
235 iso_pu_bacteria 2926754445 2926756388 136
236 iso_pu_bacteria 2933006813 2933008212 136
237 iso_pu_bacteria 2933011516 2933013007 136
238 iso_pu_bacteria 2933599457 2933604790 136
239 iso_pu_bacteria 2937002841 2937009523 136
240 iso_pu_bacteria 2937009748 2937010877 136
241 iso_pu_bacteria 2937016420 2937018994 136
242 iso_pu_bacteria 2937023124 2937027934 136
243 iso_pu_bacteria 2937042894 2937048980 136
244 iso_pu_bacteria 2937049772 2937056293 136
245 iso_pu_bacteria 2937056579 2937063364 136
246 iso_pu_bacteria 2937063883 2937070634 136
247 iso_pu_bacteria 2937071275 2937072168 136
248 iso_pu_bacteria 2937091812 2937095580 136
249 iso_pu_bacteria 2937098957 2937103644 136
250 iso_pu_bacteria 2937106411 2937112553 136
251 iso_pu_bacteria 2937113482 2937118183 136
252 iso_pu_bacteria 2937119839 2937121176 136
253 iso_pu_bacteria 2937126314 2937129810 136
254 iso_pu_bacteria 2954011201 2954014623 136
255 iso_pu_bacteria 2957382221 2957385078 136
256 iso_pu_bacteria 2957388812 2957389141 136
257 iso_pu_bacteria 2957395598 2957396397 136
258 iso_pu_bacteria 2957402308 2957405457 136
259 iso_pu_bacteria 2957408893 2957413260 136
260 iso_pu_bacteria 2957415311 2957419189 136
261 iso_pu_bacteria 2957422303 2957427724 136
262 iso_pu_bacteria 2957430029 2957431100 136
263 iso_pu_bacteria 2957443900 2957446663 136
264 iso_pu_bacteria 2957450854 2957454181 136
265 iso_pu_bacteria 2957457609 2957457612 136
266 iso_pu_bacteria 2957464669 2957467757 136
267 iso_pu_bacteria 2957471148 2957477799 136
268 iso_pu_bacteria 2957478035 2957480637 136
269 iso_pu_bacteria 2957484790 2957485799 136
270 iso_pu_bacteria 2957491536 2957495985 136
271 iso_pu_bacteria 2957498199 2957501027 136
272 iso_pu_bacteria 2957505466 2957509583 136
273 iso_pu_bacteria 2960584000 2960586635 136
274 iso_pu_bacteria 2960597568 2960600584 136
275 iso_pu_bacteria 2960603979 2960609484 136
276 iso_pu_bacteria 2960610863 2960616720 136
277 iso_pu_bacteria 2960617483 2960617694 136
278 iso_pu_bacteria 2960624210 2960629777 136
279 iso_pu_bacteria 2960637947 2960640198 136
280 iso_pu_bacteria 2960645483 2960648737 136
281 iso_pu_bacteria 2960652885 2960659495 136
282 iso_pu_bacteria 2960660292 2960666395 136
283 iso_pu_bacteria 2960667422 2960673916 136
284 iso_pu_bacteria 2960674078 2960678823 136
285 iso_pu_bacteria 2960687367 2960692070 136
286 iso_pu_bacteria 2964607997 2964609721 136
287 iso_pu_bacteria 2964615318 2964620710 136
288 iso_pu_bacteria 2964621998 2964627798 136
289 iso_pu_bacteria 2964628898 2964633126 136
290 iso_pu_bacteria 2964636051 2964637206 136
291 iso_pu_bacteria 2964643177 2964646152 136
292 iso_pu_bacteria 2964649959 2964653094 136
293 iso_pu_bacteria 2964656573 2964661893 136
294 iso_pu_bacteria 2964663802 2964665981 136
295 iso_pu_bacteria 2964670856 2964671695 136
296 iso_pu_bacteria 2964678106 2964678978 136
297 iso_pu_bacteria 2964685014 2964688099 136
298 iso_pu_bacteria 2964691889 2964695832 136
299 iso_pu_bacteria 2964698721 2964703604 136
300 iso_pu_bacteria 2964705432 2964706165 136
301 iso_pu_bacteria 2964712639 2964716290 136
302 iso_pu_bacteria 2964719344 2964726466 136
303 iso_pu_bacteria 2967664464 2967667362 136
304 iso_pu_bacteria 2967671571 2967672153 136
305 iso_pu_bacteria 2967678726 2967678916 136
306 iso_pu_bacteria 2967693043 2967693236 136
307 iso_pu_bacteria 2967699805 2967704249 136
308 iso_pu_bacteria 2967706974 2967712939 136
309 iso_pu_bacteria 2967714385 2967716538 136
310 iso_pu_bacteria 2967721400 2967724577 136
311 iso_pu_bacteria 2967735183 2967737589 136
312 iso_pu_bacteria 2967742019 2967747864 136
313 iso_pu_bacteria 2967748971 2967752114 136
314 iso_pu_bacteria 2967755722 2967757725 136
315 iso_pu_bacteria 2967762386 2967763810 136
316 iso_pu_bacteria 2967769361 2967770783 136
317 iso_pu_bacteria 2967775926 2967782168 136
318 iso_pu_bacteria 2970019648 2970026062 136
319 iso_pu_bacteria 2970033650 2970037793 136
320 iso_pu_bacteria 2970040964 2970043294 136
321 iso_pu_bacteria 2970047711 2970049929 136
322 iso_pu_bacteria 2970054988 2970059617 136
323 iso_pu_bacteria 2970061556 2970065303 136
324 iso_pu_bacteria 2970068827 2970075674 136
325 iso_pu_bacteria 2970076120 2970076978 136
326 iso_pu_bacteria 2970082768 2970085657 136
327 iso_pu_bacteria 2970088815 2970093299 136
328 iso_pu_bacteria 2970095765 2970096804 136
329 iso_pu_bacteria 2970102677 2970108555 136
330 iso_pu_bacteria 2970109326 2970109828 136
331 iso_pu_bacteria 2970116247 2970117977 136
332 iso_pu_bacteria 2970129317 2970129509 136
333 iso_pu_bacteria 2970136068 2970143159 136
334 iso_pu_bacteria 2970149975 2970153823 136
335 iso_pu_bacteria 2970156795 2970162815 136
336 iso_pu_bacteria 2970164137 2970167495 136
337 iso_pu_bacteria 2970170962 2970171785 136
338 iso_pu_bacteria 2970177841 2970184113 136
339 iso_pu_bacteria 2970184632 2970185135 136
340 iso_pu_bacteria 2970191845 2970198333 136
341 iso_pu_bacteria 2977516862 2977523658 136
342 iso_pu_bacteria 2977523885 2977527646 136
343 iso_pu_bacteria 2977537788 2977537980 136
344 iso_pu_bacteria 2977551784 2977551978 136
345 iso_pu_bacteria 2977558990 2977561681 136
346 iso_pu_bacteria 2977565890 2977568973 136
347 iso_pu_bacteria 2977572785 2977578970 136
348 iso_pu_bacteria 2977579622 2977581503 136
349 iso_pu_bacteria 648276728 648736357 136
350 iso_pu_bacteria 8003992118 8003992935 136
351 iso_pu_bacteria 8005282627 8005285300 136
352 iso_pu_bacteria 8005382845 8005385432 136
353 iso_pu_bacteria 8005395548 8005396576 136
354 iso_pu_bacteria 8005430974 8005431733 136
355 iso_pu_bacteria 8005497431 8005500523 136
356 iso_pu_bacteria 8005619151 8005621901 136
357 iso_pu_bacteria 8005626139 8005627143 136
358 iso_pu_bacteria 8005645114 8005646142 136
359 iso_pu_bacteria 8005668836 8005671941 136
360 iso_pu_bacteria 8018127388 8018130108 136
361 iso_pu_bacteria 8018150411 8018151047 136
362 iso_pu_bacteria 8024501048 8024501450 136
363 iso_pu_bacteria 8056382006 8056388035 136
364 3300032002 Ga0307416_100548068 Ga0307416_1005480682 137
365 3300032005 Ga0307411_10279734 Ga0307411_102797343 137
366 3300046513 Ga0495616_0423507 Ga0495616_0423507_57_494 137
367 3300049571 Ga0501034_0905632 Ga0501034_0905632_95_514 137
368 3300049572 Ga0501036_0331572 Ga0501036_0331572_355_786 137
369 3300049581 Ga0501047_0028286 Ga0501047_0028286_2452_2883 137
370 iso_pu_bacteria 2818991450 2819621290 137
371 iso_pu_bacteria 2928108538 2928109198 137
372 iso_pu_bacteria 2928135762 2928136421 137
373 iso_pu_bacteria 2928503688 2928503798 137
374 3300041453 Ga0451797_0542997 Ga0451797_0542997_710_1126 138
375 3300046471 Ga0495650_0001132 Ga0495650_0001132_706_1122 138
376 3300049671 Ga0501238_009713 Ga0501238_009713_35_451 138
377 iso_pu_bacteria 2648501693 2650898988 138
378 iso_pu_bacteria 2684622997 2686353372 138
379 iso_pu_bacteria 2739367664 2739649609 138
380 iso_pu_bacteria 2739367865 2740028082 138
381 iso_pu_bacteria 2847797336 2847799849 138
382 iso_pu_bacteria 2885429604 2885433086 138
383 iso_pu_bacteria 2919704043 2919708917 138
384 iso_pu_bacteria 2920760137 2920761572 138
385 iso_pu_bacteria 2984494565 2984496660 138
386 iso_pu_bacteria 2990261002 2990262077 138
387 3300003791 Ga0055530_10000834 Ga0055530_100008345 139
388 3300003791 Ga0055530_10083132 Ga0055530_100831322 139
389 3300003794 Ga0055531_10002719 Ga0055531_1000271910 139
390 3300003794 Ga0055531_10004707 Ga0055531_100047075 139
391 3300005617 Ga0068859_101511826 Ga0068859_1015118262 139
392 3300006931 Ga0097620_101511411 Ga0097620_1015114111 139
393 3300013100 Ga0157373_10136975 Ga0157373_101369753 139
394 3300013308 Ga0157375_10103761 Ga0157375_101037613 139
395 3300014968 Ga0157379_10900668 Ga0157379_109006682 139
396 3300017792 Ga0163161_10092094 Ga0163161_100920943 139
397 3300017792 Ga0163161_10545236 Ga0163161_105452362 139
398 3300025245 Ga0207425_1048308 Ga0207425_10483082 139
399 3300025263 Ga0209565_1028375 Ga0209565_10283752 139
400 3300025273 Ga0209673_1033792 Ga0209673_10337922 139
401 3300025292 Ga0209676_1000018 Ga0209676_1000018218 139
402 3300025292 Ga0209676_1000716 Ga0209676_100071624 139
403 3300025292 Ga0209676_1104216 Ga0209676_11042161 139
404 3300025295 Ga0209564_1011921 Ga0209564_10119215 139
405 3300025298 Ga0209050_1000562 Ga0209050_100056218 139
406 3300025298 Ga0209050_1022022 Ga0209050_10220223 139
407 3300025298 Ga0209050_1065007 Ga0209050_10650072 139
408 3300025299 Ga0209256_1003428 Ga0209256_100342811 139
409 3300025303 Ga0209051_1007254 Ga0209051_10072547 139
410 3300025304 Ga0209257_1000035 Ga0209257_1000035218 139
411 3300025304 Ga0209257_1001300 Ga0209257_10013009 139
412 3300025304 Ga0209257_1002553 Ga0209257_100255312 139
413 3300025893 Ga0207682_10001290 Ga0207682_100012904 139
414 3300025893 Ga0207682_10031052 Ga0207682_100310521 139
415 3300025903 Ga0207680_10183602 Ga0207680_101836022 139
416 3300025918 Ga0207662_10790432 Ga0207662_107904321 139
417 3300025931 Ga0207644_10120861 Ga0207644_101208613 139
418 3300025935 Ga0207709_10647484 Ga0207709_106474842 139
419 3300025941 Ga0207711_10285980 Ga0207711_102859802 139
420 3300025945 Ga0207679_10492717 Ga0207679_104927172 139
421 3300026118 Ga0207675_100162321 Ga0207675_1001623212 139
422 3300026121 Ga0207683_10009322 Ga0207683_1000932210 139
423 3300027876 Ga0209974_10023613 Ga0209974_100236132 139
424 3300028379 Ga0268266_12363389 Ga0268266_123633891 139
425 3300031995 Ga0307409_100930960 Ga0307409_1009309601 139
426 3300032004 Ga0307414_10181354 Ga0307414_101813542 139
427 3300042006 Ga0439432_000838 Ga0439432_000838_4261_4680 139
428 3300044712 Ga0453684_0511605 Ga0453684_0511605_641_1063 139
429 3300048924 Ga0496121_0159568 Ga0496121_0159568_340_762 139
430 3300048925 Ga0496122_0151578 Ga0496122_0151578_389_808 139
431 3300048926 Ga0496123_0059633 Ga0496123_0059633_640_1059 139
432 3300048927 Ga0496124_0220111 Ga0496124_0220111_390_809 139
433 3300048929 Ga0496126_0166894 Ga0496126_0166894_1299_1718 139
434 3300049569 Ga0501032_0816024 Ga0501032_0816024_40_459 139
435 3300049581 Ga0501047_0627933 Ga0501047_0627933_71_490 139
436 3300049590 Ga0501074_0217987 Ga0501074_0217987_466_885 139
437 3300049742 Ga0501080_0011592 Ga0501080_0011592_7176_7595 139
438 3300049823 Ga0501044_0154031 Ga0501044_0154031_202_621 139
439 3300049823 Ga0501044_0246972 Ga0501044_0246972_179_598 139
440 iso_pu_bacteria 2643221665 2644363004 139
441 iso_pu_bacteria 2765235838 2765571604 139
442 iso_pu_bacteria 2852653556 2852656982 139
443 3300003187 JGI25151J46595_10002216 JGI25151J46595_100022162 140
444 3300003320 rootH2_10013979 rootH2_100139792 140
445 3300003322 rootL2_10003492 rootL2_1000349210 140
446 3300003323 rootH1_10030430 rootH1_100304307 140
447 3300005327 Ga0070658_11666947 Ga0070658_116669471 140
448 3300005334 Ga0068869_100069327 Ga0068869_1000693274 140
449 3300005336 Ga0070680_100131031 Ga0070680_1001310312 140
450 3300005337 Ga0070682_100016576 Ga0070682_1000165762 140
451 3300005339 Ga0070660_100196186 Ga0070660_1001961862 140
452 3300005341 Ga0070691_10009447 Ga0070691_100094472 140
453 3300005344 Ga0070661_100245736 Ga0070661_1002457362 140
454 3300005347 Ga0070668_102194678 Ga0070668_1021946781 140
455 3300005366 Ga0070659_100019285 Ga0070659_1000192852 140
456 3300005438 Ga0070701_10520722 Ga0070701_105207222 140
457 3300005440 Ga0070705_100102023 Ga0070705_1001020233 140
458 3300005444 Ga0070694_100113675 Ga0070694_1001136753 140
459 3300005455 Ga0070663_100011608 Ga0070663_1000116084 140
460 3300005456 Ga0070678_100278059 Ga0070678_1002780592 140
461 3300005458 Ga0070681_10071239 Ga0070681_100712395 140
462 3300005459 Ga0068867_100291237 Ga0068867_1002912372 140
463 3300005530 Ga0070679_100027731 Ga0070679_1000277312 140
464 3300005539 Ga0068853_100005835 Ga0068853_1000058355 140
465 3300005545 Ga0070695_100068652 Ga0070695_1000686523 140
466 3300005547 Ga0070693_100016157 Ga0070693_1000161573 140
467 3300005564 Ga0070664_100082956 Ga0070664_1000829562 140
468 3300005577 Ga0068857_100073814 Ga0068857_1000738143 140
469 3300005578 Ga0068854_100212820 Ga0068854_1002128202 140
470 3300005615 Ga0070702_100528385 Ga0070702_1005283852 140
471 3300005616 Ga0068852_100139501 Ga0068852_1001395012 140
472 3300005617 Ga0068859_100282590 Ga0068859_1002825902 140
473 3300005618 Ga0068864_100505416 Ga0068864_1005054162 140
474 3300005842 Ga0068858_100724378 Ga0068858_1007243782 140
475 3300005844 Ga0068862_100976965 Ga0068862_1009769652 140
476 3300006051 Ga0075364_10002855 Ga0075364_100028556 140
477 3300006186 Ga0075369_10002567 Ga0075369_100025674 140
478 3300006931 Ga0097620_100282590 Ga0097620_1002825902 140
479 3300006946 Ga0079104_1004220 Ga0079104_10042203 140
480 3300009148 Ga0105243_10068610 Ga0105243_100686103 140
481 3300009545 Ga0105237_10036325 Ga0105237_100363257 140
482 3300009551 Ga0105238_10035562 Ga0105238_100355627 140
483 3300013296 Ga0157374_10195354 Ga0157374_101953543 140
484 3300013297 Ga0157378_10558321 Ga0157378_105583212 140
485 3300013306 Ga0163162_10366056 Ga0163162_103660562 140
486 3300013308 Ga0157375_10313638 Ga0157375_103136384 140
487 3300014326 Ga0157380_10054256 Ga0157380_100542563 140
488 3300014968 Ga0157379_10247189 Ga0157379_102471892 140
489 3300014969 Ga0157376_10354427 Ga0157376_103544273 140
490 3300021327 Ga0214543_1000003 Ga0214543_1000003426 140
491 3300025294 Ga0209025_1000062 Ga0209025_1000062143 140
492 3300025912 Ga0207707_10060781 Ga0207707_100607815 140
493 3300025914 Ga0207671_10163468 Ga0207671_101634682 140
494 3300025917 Ga0207660_10078141 Ga0207660_100781412 140
495 3300025919 Ga0207657_10207932 Ga0207657_102079323 140
496 3300025920 Ga0207649_10170107 Ga0207649_101701072 140
497 3300025921 Ga0207652_10214136 Ga0207652_102141362 140
498 3300025935 Ga0207709_10128260 Ga0207709_101282602 140
499 3300025942 Ga0207689_10114665 Ga0207689_101146652 140
500 3300025945 Ga0207679_10390098 Ga0207679_103900982 140
501 3300025972 Ga0207668_11697237 Ga0207668_116972372 140
502 3300026023 Ga0207677_10402120 Ga0207677_104021202 140
503 3300026035 Ga0207703_10165825 Ga0207703_101658252 140
504 3300026041 Ga0207639_10035093 Ga0207639_100350934 140
505 3300026067 Ga0207678_10001716 Ga0207678_100017163 140
506 3300026089 Ga0207648_10243037 Ga0207648_102430372 140
507 3300026095 Ga0207676_11193615 Ga0207676_111936151 140
508 3300026116 Ga0207674_10082431 Ga0207674_100824314 140
509 3300027111 Ga0209281_1000332 Ga0209281_100033214 140
510 3300041413 Ga0439465_0235346 Ga0439465_0235346_216_638 140
511 3300046507 Ga0495606_0283420 Ga0495606_0283420_430_855 140
512 3300046512 Ga0495610_0002893 Ga0495610_0002893_13038_13463 140
513 3300046516 Ga0495628_0091841 Ga0495628_0091841_966_1388 140
514 3300046530 Ga0495654_0000080 Ga0495654_0000080_28871_29296 140
515 3300046559 Ga0495667_0139561 Ga0495667_0139561_155_577 140
516 3300046691 Ga0495670_0462939 Ga0495670_0462939_47_469 140
517 3300047472 Ga0495686_0000021 Ga0495686_0000021_283030_283452 140
518 3300048903 Ga0496100_0261998 Ga0496100_0261998_88_510 140
519 3300048904 Ga0496101_0059267 Ga0496101_0059267_1598_2020 140
520 3300048905 Ga0496102_0176911 Ga0496102_0176911_702_1124 140
521 3300048906 Ga0496103_0027051 Ga0496103_0027051_1531_1953 140
522 3300048907 Ga0496104_0085211 Ga0496104_0085211_1482_1904 140
523 3300048908 Ga0496105_0389704 Ga0496105_0389704_414_836 140
524 3300048909 Ga0496106_0065006 Ga0496106_0065006_1611_2033 140
525 3300048910 Ga0496107_0055747 Ga0496107_0055747_1338_1760 140
526 3300048917 Ga0496114_0295223 Ga0496114_0295223_532_954 140
527 3300048918 Ga0496115_0273139 Ga0496115_0273139_789_1211 140
528 3300048924 Ga0496121_0007470 Ga0496121_0007470_7715_8140 140
529 3300048924 Ga0496121_0220269 Ga0496121_0220269_712_1140 140
530 3300048926 Ga0496123_0280741 Ga0496123_0280741_65_490 140
531 3300048927 Ga0496124_0005662 Ga0496124_0005662_9908_10330 140
532 3300048928 Ga0496125_0004808 Ga0496125_0004808_9905_10327 140
533 3300048929 Ga0496126_0064155 Ga0496126_0064155_674_1096 140
534 3300049459 Ga0495678_116533 Ga0495678_116533_243_668 140
535 3300049568 Ga0501031_0422083 Ga0501031_0422083_388_810 140
536 3300049570 Ga0501033_0005536 Ga0501033_0005536_1202_1624 140
537 3300049571 Ga0501034_0084714 Ga0501034_0084714_1529_1951 140
538 3300049571 Ga0501034_0113961 Ga0501034_0113961_179_604 140
539 3300049571 Ga0501034_0439655 Ga0501034_0439655_729_1151 140
540 3300049579 Ga0501043_0013507 Ga0501043_0013507_617_1039 140
541 3300049579 Ga0501043_0134394 Ga0501043_0134394_473_895 140
542 3300049579 Ga0501043_0349780 Ga0501043_0349780_208_630 140
543 3300049581 Ga0501047_0010908 Ga0501047_0010908_6046_6471 140
544 3300049822 Ga0501035_0006507 Ga0501035_0006507_185_607 140
545 3300049823 Ga0501044_0170354 Ga0501044_0170354_225_647 140
546 3300050491 nmdc:mga00v17_214_c1 nmdc:mga00v17_214_c1_20197_20622 140
547 3300050492 nmdc:mga0yw44_248657_c2 nmdc:mga0yw44_248657_c2_148_573 140
548 3300050516 nmdc:mga0sz30_4012_c2 nmdc:mga0sz30_4012_c2_3727_4149 140
549 3300053119 Ga0500595_085413 Ga0500595_085413_417_839 140
550 iso_pu_bacteria 8005658619 8005662721 140
551 3300001990 JGI24737J22298_10039113 JGI24737J22298_100391133 141
552 3300006195 Ga0075366_10001429 Ga0075366_100014297 141
553 3300006353 Ga0075370_10000054 Ga0075370_1000005410 141
554 3300006353 Ga0075370_10639923 Ga0075370_106399232 141
555 3300009011 Ga0105251_10000029 Ga0105251_10000029113 141
556 3300010375 Ga0105239_12543218 Ga0105239_125432181 141
557 3300013307 Ga0157372_10236779 Ga0157372_102367793 141
558 3300015261 Ga0182006_1191339 Ga0182006_11913392 141
559 3300015262 Ga0182007_10000788 Ga0182007_100007882 141
560 3300025735 Ga0207713_1000112 Ga0207713_10001129 141
561 3300025904 Ga0207647_10004846 Ga0207647_1000484610 141
562 3300025913 Ga0207695_10049462 Ga0207695_100494623 141
563 3300025986 Ga0207658_10061941 Ga0207658_100619412 141
564 3300031456 Ga0307513_10506407 Ga0307513_105064072 141
565 3300031995 Ga0307409_101207978 Ga0307409_1012079781 141
566 3300035171 Ga0373946_0685994 Ga0373946_0685994_25_507 141
567 3300046501 Ga0495607_0100318 Ga0495607_0100318_686_1111 141
568 3300046683 Ga0495658_0147738 Ga0495658_0147738_703_1137 141
569 3300047320 Ga0495672_0000002 Ga0495672_0000002_356317_356745 141
570 3300048904 Ga0496101_0586597 Ga0496101_0586597_18_446 141
571 3300048905 Ga0496102_0961633 Ga0496102_0961633_13_441 141
572 3300048907 Ga0496104_1073859 Ga0496104_1073859_182_610 141
573 3300048908 Ga0496105_0181176 Ga0496105_0181176_980_1408 141
574 3300048908 Ga0496105_0545405 Ga0496105_0545405_11_493 141
575 3300048910 Ga0496107_0442638 Ga0496107_0442638_18_446 141
576 3300048911 Ga0496108_0034345 Ga0496108_0034345_2996_3424 141
577 3300048912 Ga0496109_0153683 Ga0496109_0153683_111_539 141
578 3300048913 Ga0496110_0417501 Ga0496110_0417501_394_822 141
579 3300048914 Ga0496111_0397228 Ga0496111_0397228_557_985 141
580 3300048917 Ga0496114_0064996 Ga0496114_0064996_1198_1626 141
581 3300048917 Ga0496114_0359004 Ga0496114_0359004_344_826 141
582 3300048919 Ga0496116_0122568 Ga0496116_0122568_312_737 141
583 3300048920 Ga0496117_0019831 Ga0496117_0019831_4294_4719 141
584 3300048921 Ga0496118_0000692 Ga0496118_0000692_26523_26948 141
585 3300048921 Ga0496118_0070020 Ga0496118_0070020_1067_1492 141
586 3300048924 Ga0496121_0000190 Ga0496121_0000190_74454_74879 141
587 3300048924 Ga0496121_0107254 Ga0496121_0107254_316_747 141
588 3300048929 Ga0496126_0027270 Ga0496126_0027270_4024_4449 141
589 3300050493 nmdc:mga0k408_566_c2 nmdc:mga0k408_566_c2_3563_4000 141
590 3300050494 nmdc:mga06z11_24916_c1 nmdc:mga06z11_24916_c1_1309_1746 141
591 3300050496 nmdc:mga07m45_318_c1 nmdc:mga07m45_318_c1_4175_4612 141
592 3300006051 Ga0075364_10000022 Ga0075364_100000226 142
593 3300006186 Ga0075369_10000533 Ga0075369_1000053311 142
594 3300006195 Ga0075366_10005515 Ga0075366_1000551510 142
595 3300031239 Ga0265328_10007359 Ga0265328_100073594 142
596 3300031251 Ga0265327_10000147 Ga0265327_1000014764 142
597 3300031456 Ga0307513_10030116 Ga0307513_100301165 142
598 3300041491 Ga0451833_0114529 Ga0451833_0114529_97_534 142
599 3300041494 Ga0451837_0313458 Ga0451837_0313458_132_569 142
600 3300041496 Ga0451839_0447087 Ga0451839_0447087_144_581 142
601 3300041999 Ga0439433_0049165 Ga0439433_0049165_60_497 142
602 3300042007 Ga0439449_0004268 Ga0439449_0004268_2877_3314 142
603 3300042119 Ga0450915_016376 Ga0450915_016376_52_495 142
604 3300046506 Ga0495583_0003433 Ga0495583_0003433_3180_3614 142
605 3300046525 Ga0495663_0001346 Ga0495663_0001346_2556_2993 142
606 3300046692 Ga0495671_0186115 Ga0495671_0186115_511_948 142
607 3300047319 Ga0495674_0053452 Ga0495674_0053452_2594_3037 142
608 3300047446 Ga0495679_122940 Ga0495679_122940_223_666 142
609 3300047469 Ga0495673_0065076 Ga0495673_0065076_680_1123 142
610 3300050489 nmdc:mga03683_1897_c2 nmdc:mga03683_1897_c2_3374_3817 142
611 3300050491 nmdc:mga00v17_91_c1 nmdc:mga00v17_91_c1_48556_48984 142
612 3300050492 nmdc:mga0yw44_727_c2 nmdc:mga0yw44_727_c2_6945_7373 142
613 3300050516 nmdc:mga0sz30_34_c1 nmdc:mga0sz30_34_c1_28081_28509 142
614 3300053092 Ga0500583_0037433 Ga0500583_0037433_273_704 142
615 3300053092 Ga0500583_0050988 Ga0500583_0050988_708_1139 142
616 3300053142 Ga0500577_0167791 Ga0500577_0167791_438_875 142
617 3300053161 Ga0500634_0009498 Ga0500634_0009498_2023_2451 142
618 2162886007 SwRhRL2b_contig_1189119 SwRhRL2b_0278.00005690 143
619 3300002067 JGI24735J21928_10000694 JGI24735J21928_100006949 143
620 3300005289 Ga0065704_10080138 Ga0065704_100801384 143
621 3300006178 Ga0075367_10353709 Ga0075367_103537092 143
622 3300006195 Ga0075366_10152647 Ga0075366_101526471 143
623 3300048903 Ga0496100_0287351 Ga0496100_0287351_498_1031 143
624 3300048907 Ga0496104_0081202 Ga0496104_0081202_65_598 143
625 3300048927 Ga0496124_0148735 Ga0496124_0148735_800_1231 143
626 3300048928 Ga0496125_0153231 Ga0496125_0153231_648_1079 143
627 3300048929 Ga0496126_0094332 Ga0496126_0094332_886_1317 143
628 3300050493 nmdc:mga0k408_79218_c1 nmdc:mga0k408_79218_c1_902_1333 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

7

115

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i9d-assembly1.cif.gz_A arsenate reductase from e. coli 0.981 4 138
1sd8-assembly1.cif.gz_A arsenate reductase r60k mutant from e. coli 0.9803 4 138
1s3d-assembly1.cif.gz_A arsenate reductase r60a mutant from e. coli 0.9799 4 138
1s3c-assembly1.cif.gz_A arsenate reductase c12s mutant from e. coli 0.9794 4 138
1sjz-assembly1.cif.gz_A arsenate reductase r60k mutant +0.4m arsenite from e. coli 0.9725 4 138
ID Description Score Start End Superfamily
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.971 4 138 3.40.30.10
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9502 4 138 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9381 4 112 3.40.30.10
af_O45352_10_98_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.9054 4 33 3.80.10.10
3zmkC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9 4 32 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A6M5JE52-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1.003 3 113 GO:0008794
GO:0046685
AF-A0A4Q0GRZ3-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1.002 1 140 GO:0008794
GO:0046685
AF-A0A659UVR1-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1.001 4 116 GO:0008794
GO:0046685
AF-N0BHG6-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1 4 116 GO:0008794
GO:0046685
AF-A0A527ZCM3-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9998 4 115 GO:0008794
GO:0046685

Feature Viewer

pLDDT pTM Quality
95.06 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map