F470626

General Info

Members Datasets Scaffolds Average Seq Length
628 294 1256 85

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_102168986|Ga0070714_1021689861
Length 87
Sequence VIRMSAYDHDTLGRLIAALPPAPDGWVRAAQELPAARRGIDDIVGRAEADVAYRERVVADLESALAAEGIEPTPSLLDELRDRFRSI

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
89 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
90 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
165 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
166 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
167 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
183 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
184 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
185 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
191 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
209 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
210 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
211 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
212 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
214 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
218 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
233 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
234 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
239 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
240 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
246 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
247 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
269 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
272 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
277 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
280 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
283 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
287 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
288 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
289 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
293 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
294 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.82
Metatranscriptomes 3.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 10.99
Rhizosphere 88.54
Stem 0
Stem Tuber 0
Unclassified 19.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_102168986 3300005435 Bacteria 541
2 Ga0058862_10009011 3300004803 Bacteria 535
3 Ga0058862_12835682 3300004803 Unclassified 504
4 Ga0058862_12850731 3300004803 Unclassified 519
5 Ga0070676_10184675 3300005328 Bacteria 1358
6 Ga0070683_100001257 3300005329 Bacteria 19285
7 Ga0070683_100127338 3300005329 Bacteria 2408
8 Ga0070683_100138099 3300005329 Bacteria 2309
9 Ga0070683_100150706 3300005329 Bacteria 2205
10 Ga0070683_100281103 3300005329 Unclassified 1583
11 Ga0070683_101720592 3300005329 Bacteria 603
12 Ga0070670_100025844 3300005331 Bacteria 5052
13 Ga0070670_100912797 3300005331 Bacteria 796
14 Ga0070680_100023373 3300005336 Bacteria 4930
15 Ga0070680_100036642 3300005336 Bacteria 3963
16 Ga0070680_100219263 3300005336 Bacteria 1605
17 Ga0070680_100292749 3300005336 Bacteria 1380
18 Ga0070682_100059586 3300005337 Bacteria 2412
19 Ga0070682_100116637 3300005337 Bacteria 1786
20 Ga0068868_100522967 3300005338 Bacteria 1042
21 Ga0068868_101118335 3300005338 Bacteria 725
22 Ga0070660_100003641 3300005339 Bacteria 10639
23 Ga0070660_100036371 3300005339 Unclassified 3729
24 Ga0070660_100433718 3300005339 Bacteria 1089
25 Ga0070691_10232320 3300005341 Bacteria 982
26 Ga0070661_100043077 3300005344 Bacteria 3297
27 Ga0070661_100315958 3300005344 Bacteria 1219
28 Ga0070661_100356196 3300005344 Bacteria 1149
29 Ga0070692_10618557 3300005345 Bacteria 719
30 Ga0070668_100007521 3300005347 Bacteria 8089
31 Ga0070669_100297064 3300005353 Bacteria 1298
32 Ga0070675_101807439 3300005354 Unclassified 564
33 Ga0070671_100217487 3300005355 Bacteria 1621
34 Ga0070674_100161630 3300005356 Bacteria 1700
35 Ga0070674_100699004 3300005356 Bacteria 867
36 Ga0070688_101634822 3300005365 Bacteria 526
37 Ga0070659_100017135 3300005366 Bacteria 5446
38 Ga0070703_10485778 3300005406 Unclassified 553
39 Ga0070714_100000534 3300005435 Bacteria 27486
40 Ga0070714_100087887 3300005435 Unclassified 2719
41 Ga0070714_100209944 3300005435 Bacteria 1784
42 Ga0070713_100008026 3300005436 Bacteria 7460
43 Ga0070713_100110591 3300005436 Bacteria 2395
44 Ga0070713_101117248 3300005436 Unclassified 762
45 Ga0070710_10005607 3300005437 Bacteria 5978
46 Ga0070701_10296814 3300005438 Bacteria 992
47 Ga0070711_100016585 3300005439 Bacteria 4679
48 Ga0070711_100373589 3300005439 Bacteria 1151
49 Ga0070705_100267017 3300005440 Bacteria 1210
50 Ga0070705_100551301 3300005440 Bacteria 884
51 Ga0070705_100889526 3300005440 Bacteria 715
52 Ga0070700_100437460 3300005441 Bacteria 992
53 Ga0070694_100007303 3300005444 Bacteria 6733
54 Ga0070694_101028931 3300005444 Bacteria 685
55 Ga0070694_101148580 3300005444 Unclassified 649
56 Ga0070708_101325388 3300005445 Bacteria 672
57 Ga0070663_100406493 3300005455 Bacteria 1114
58 Ga0070663_101179982 3300005455 Bacteria 672
59 Ga0070678_100022622 3300005456 Bacteria 4170
60 Ga0070678_100462966 3300005456 Bacteria 1113
61 Ga0070678_100778138 3300005456 Bacteria 867
62 Ga0070662_100010294 3300005457 Bacteria 6132
63 Ga0070681_10048675 3300005458 Bacteria 4236
64 Ga0070681_10054416 3300005458 Unclassified 3987
65 Ga0070681_10063264 3300005458 Bacteria 3672
66 Ga0070681_10074427 3300005458 Bacteria 3357
67 Ga0070681_10080991 3300005458 Bacteria 3202
68 Ga0068867_100526734 3300005459 Bacteria 1020
69 Ga0070706_100769084 3300005467 Unclassified 892
70 Ga0070706_101215645 3300005467 Bacteria 692
71 Ga0070707_100380760 3300005468 Unclassified 1371
72 Ga0070707_101158459 3300005468 Bacteria 739
73 Ga0070698_100133850 3300005471 Bacteria 2433
74 Ga0074259_10213146 3300005507 Unclassified 528
75 Ga0070679_100025391 3300005530 Bacteria 5814
76 Ga0070679_100080574 3300005530 Unclassified 3245
77 Ga0070679_100211667 3300005530 Bacteria 1902
78 Ga0070679_100311202 3300005530 Bacteria 1525
79 Ga0070684_100039637 3300005535 Bacteria 4054
80 Ga0070684_100056958 3300005535 Bacteria 3412
81 Ga0070684_101555820 3300005535 Unclassified 623
82 Ga0070684_102250809 3300005535 Unclassified 514
83 Ga0068853_101640067 3300005539 Bacteria 623
84 Ga0070686_100106091 3300005544 Unclassified 1906
85 Ga0070695_100184918 3300005545 Bacteria 1479
86 Ga0070695_100809474 3300005545 Bacteria 751
87 Ga0070696_100220440 3300005546 Bacteria 1423
88 Ga0070696_100968687 3300005546 Unclassified 709
89 Ga0070693_100167643 3300005547 Bacteria 1404
90 Ga0070693_100187784 3300005547 Bacteria 1335
91 Ga0070665_100448674 3300005548 Unclassified 1299
92 Ga0070704_101334842 3300005549 Unclassified 657
93 Ga0070704_101335349 3300005549 Unclassified 657
94 Ga0068855_100042282 3300005563 Bacteria 5399
95 Ga0068855_100163083 3300005563 Bacteria 2528
96 Ga0068855_100720556 3300005563 Bacteria 1066
97 Ga0068855_100730931 3300005563 Unclassified 1057
98 Ga0068855_101077616 3300005563 Unclassified 841
99 Ga0070664_100027764 3300005564 Bacteria 4705
100 Ga0068857_100011723 3300005577 Bacteria 7622
101 Ga0068857_100706275 3300005577 Unclassified 958
102 Ga0068857_100957069 3300005577 Bacteria 823
103 Ga0068857_101772637 3300005577 Bacteria 604
104 Ga0068854_100247832 3300005578 Bacteria 1421
105 Ga0068854_100399535 3300005578 Bacteria 1137
106 Ga0068854_100976552 3300005578 Bacteria 749
107 Ga0068854_101089104 3300005578 Unclassified 711
108 Ga0068854_101099875 3300005578 Bacteria 708
109 Ga0068856_100060483 3300005614 Bacteria 3742
110 Ga0068856_100061575 3300005614 Bacteria 3707
111 Ga0068856_100108549 3300005614 Bacteria 2771
112 Ga0068856_100470393 3300005614 Bacteria 1278
113 Ga0068852_101614181 3300005616 Bacteria 671
114 Ga0068852_102418830 3300005616 Unclassified 546
115 Ga0068859_102416872 3300005617 Unclassified 579
116 Ga0068866_11094406 3300005718 Unclassified 571
117 Ga0068861_100004166 3300005719 Bacteria 9695
118 Ga0068870_10005550 3300005840 Bacteria 5508
119 Ga0068860_102625933 3300005843 Unclassified 523
120 Ga0068862_100323195 3300005844 Bacteria 1425
121 Ga0070717_10089632 3300006028 Bacteria 2594
122 Ga0070717_10164581 3300006028 Unclassified 1926
123 Ga0070717_11147387 3300006028 Unclassified 707
124 Ga0075365_10573539 3300006038 Bacteria 798
125 Ga0070712_100031619 3300006175 Bacteria 3567
126 Ga0070712_100300596 3300006175 Bacteria 1299
127 Ga0097621_102326702 3300006237 Unclassified 513
128 Ga0068871_100596851 3300006358 Unclassified 1004
129 Ga0075428_100476028 3300006844 Bacteria 1337
130 Ga0075428_101853236 3300006844 Bacteria 627
131 Ga0075428_102202266 3300006844 Bacteria 569
132 Ga0075431_100332959 3300006847 Bacteria 1529
133 Ga0075433_11026056 3300006852 Bacteria 718
134 Ga0075433_11125365 3300006852 Bacteria 682
135 Ga0075434_100039854 3300006871 Bacteria 4652
136 Ga0075434_100200791 3300006871 Unclassified 2014
137 Ga0068865_100495492 3300006881 Bacteria 1018
138 Ga0068865_100526634 3300006881 Bacteria 989
139 Ga0068865_100774908 3300006881 Bacteria 826
140 Ga0075436_100488029 3300006914 Bacteria 900
141 Ga0097620_102417907 3300006931 Unclassified 579
142 Ga0075435_100028143 3300007076 Bacteria 4406
143 Ga0075435_100160588 3300007076 Bacteria 1893
144 Ga0075435_101222217 3300007076 Bacteria 658
145 Ga0099795_10257762 3300007788 Bacteria 754
146 Ga0105240_10594006 3300009093 Bacteria 1220
147 Ga0105240_11212282 3300009093 Bacteria 799
148 Ga0105240_11703104 3300009093 Bacteria 658
149 Ga0111539_10123677 3300009094 Bacteria 3032
150 Ga0111539_12817171 3300009094 Bacteria 563
151 Ga0111539_13023641 3300009094 Unclassified 543
152 Ga0105245_10025625 3300009098 Bacteria 5186
153 Ga0105245_10045304 3300009098 Bacteria 3928
154 Ga0105245_10146927 3300009098 Bacteria 2225
155 Ga0105247_11500487 3300009101 Unclassified 550
156 Ga0114129_10032856 3300009147 Bacteria 7331
157 Ga0114129_10405539 3300009147 Unclassified 1796
158 Ga0114129_10616695 3300009147 Bacteria 1404
159 Ga0114129_10799494 3300009147 Bacteria 1203
160 Ga0114129_11050707 3300009147 Bacteria 1023
161 Ga0105243_10089746 3300009148 Bacteria 2528
162 Ga0105243_10151597 3300009148 Bacteria 1989
163 Ga0105241_10124477 3300009174 Bacteria 2080
164 Ga0105242_10250392 3300009176 Bacteria 1596
165 Ga0105242_10981756 3300009176 Bacteria 851
166 Ga0105242_12874446 3300009176 Bacteria 532
167 Ga0105248_10522146 3300009177 Bacteria 1339
168 Ga0105248_12052289 3300009177 Unclassified 650
169 Ga0105237_10891151 3300009545 Bacteria 897
170 Ga0105237_11038331 3300009545 Bacteria 826
171 Ga0105238_10968816 3300009551 Bacteria 871
172 Ga0105238_11242476 3300009551 Bacteria 770
173 Ga0105249_10022445 3300009553 Bacteria 5653
174 Ga0099796_10122133 3300010159 Bacteria 1002
175 Ga0105239_10209430 3300010375 Bacteria 2185
176 Ga0105239_10753961 3300010375 Archaea 1114
177 Ga0105246_10053071 3300011119 Bacteria 2788
178 Ga0105246_10342439 3300011119 Unclassified 1222
179 Ga0105246_10556788 3300011119 Bacteria 984
180 Ga0157335_1038325 3300012492 Bacteria 531
181 Ga0157341_1008474 3300012494 Bacteria 840
182 Ga0157342_1000466 3300012507 Bacteria 2476
183 Ga0157342_1084689 3300012507 Bacteria 504
184 Ga0157371_11091478 3300013102 Unclassified 612
185 Ga0157370_10400354 3300013104 Bacteria 1264
186 Ga0157370_11587746 3300013104 Bacteria 588
187 Ga0157369_10151355 3300013105 Bacteria 2452
188 Ga0157369_10481807 3300013105 Bacteria 1284
189 Ga0157369_12410509 3300013105 Unclassified 533
190 Ga0157374_10068688 3300013296 Bacteria 3335
191 Ga0157374_11033892 3300013296 Unclassified 841
192 Ga0157378_10654914 3300013297 Bacteria 1066
193 Ga0163162_10018110 3300013306 Bacteria 6895
194 Ga0157372_10049438 3300013307 Bacteria 4675
195 Ga0157372_10604839 3300013307 Bacteria 1278
196 Ga0157372_10732999 3300013307 Bacteria 1149
197 Ga0157375_10132078 3300013308 Bacteria 2617
198 Ga0157375_11141979 3300013308 Unclassified 913
199 Ga0157375_11283059 3300013308 Unclassified 861
200 Ga0157375_12496481 3300013308 Bacteria 617
201 Ga0163163_10304810 3300014325 Bacteria 1645
202 Ga0163163_10898040 3300014325 Bacteria 949
203 Ga0163163_12787412 3300014325 Unclassified 545
204 Ga0157380_10494436 3300014326 Bacteria 1186
205 Ga0182008_10075701 3300014497 Bacteria 1656
206 Ga0182008_10080032 3300014497 Unclassified 1607
207 Ga0182008_10409163 3300014497 Bacteria 730
208 Ga0157377_10016666 3300014745 Bacteria 3784
209 Ga0157377_10231484 3300014745 Bacteria 1188
210 Ga0157376_10520819 3300014969 Bacteria 1172
211 Ga0197907_11048449 3300020069 Unclassified 687
212 Ga0206356_10703398 3300020070 Bacteria 1089
213 Ga0206356_10829087 3300020070 Bacteria 1261
214 Ga0206356_11279372 3300020070 Unclassified 938
215 Ga0206356_11822262 3300020070 Bacteria 1486
216 Ga0206352_10235482 3300020078 Bacteria 560
217 Ga0206352_10341648 3300020078 Unclassified 525
218 Ga0206354_11349913 3300020081 Bacteria 877
219 Ga0206354_11467597 3300020081 Unclassified 532
220 Ga0206354_11523351 3300020081 Bacteria 1307
221 Ga0206353_10007380 3300020082 Bacteria 2599
222 Ga0206353_10392913 3300020082 Bacteria 812
223 Ga0206353_10820595 3300020082 Unclassified 573
224 Ga0206353_11318545 3300020082 Unclassified 753
225 Ga0206353_12042111 3300020082 Bacteria 930
226 Ga0154015_1492540 3300020610 Bacteria 540
227 Ga0224712_10196185 3300022467 Bacteria 916
228 Ga0207692_10054871 3300025898 Bacteria 2037
229 Ga0207692_10808125 3300025898 Bacteria 613
230 Ga0207642_10892042 3300025899 Bacteria 569
231 Ga0207688_10040883 3300025901 Bacteria 2577
232 Ga0207688_10766941 3300025901 Bacteria 611
233 Ga0207699_10165604 3300025906 Bacteria 1475
234 Ga0207645_10613511 3300025907 Unclassified 739
235 Ga0207643_10002041 3300025908 Bacteria 11134
236 Ga0207705_10012826 3300025909 Bacteria 6052
237 Ga0207705_11331182 3300025909 Bacteria 548
238 Ga0207684_10069984 3300025910 Bacteria 2981
239 Ga0207684_11749639 3300025910 Unclassified 500
240 Ga0207654_10070217 3300025911 Bacteria 2078
241 Ga0207707_10016888 3300025912 Bacteria 6357
242 Ga0207707_10024468 3300025912 Bacteria 5284
243 Ga0207707_10027672 3300025912 Bacteria 4957
244 Ga0207707_10030360 3300025912 Bacteria 4728
245 Ga0207707_10084312 3300025912 Bacteria 2775
246 Ga0207695_11489953 3300025913 Unclassified 557
247 Ga0207693_10000938 3300025915 Bacteria 26172
248 Ga0207693_10290960 3300025915 Bacteria 1280
249 Ga0207663_10505554 3300025916 Bacteria 939
250 Ga0207663_11148150 3300025916 Bacteria 625
251 Ga0207660_10006528 3300025917 Bacteria 7567
252 Ga0207660_10038707 3300025917 Bacteria 3330
253 Ga0207660_10068076 3300025917 Bacteria 2581
254 Ga0207660_10205482 3300025917 Unclassified 1540
255 Ga0207660_10956955 3300025917 Bacteria 699
256 Ga0207657_10003466 3300025919 Bacteria 16832
257 Ga0207657_10027851 3300025919 Bacteria 5168
258 Ga0207657_10102905 3300025919 Bacteria 2368
259 Ga0207657_11015545 3300025919 Bacteria 636
260 Ga0207649_10027919 3300025920 Bacteria 3318
261 Ga0207649_10373417 3300025920 Bacteria 1061
262 Ga0207649_10984397 3300025920 Unclassified 663
263 Ga0207652_10019354 3300025921 Bacteria 5598
264 Ga0207652_10038901 3300025921 Bacteria 4034
265 Ga0207652_10042585 3300025921 Bacteria 3865
266 Ga0207652_10261502 3300025921 Bacteria 1561
267 Ga0207652_11216535 3300025921 Unclassified 655
268 Ga0207646_10284617 3300025922 Unclassified 1494
269 Ga0207646_11344721 3300025922 Bacteria 623
270 Ga0207694_10601268 3300025924 Bacteria 925
271 Ga0207694_11180658 3300025924 Bacteria 648
272 Ga0207650_10026027 3300025925 Bacteria 4170
273 Ga0207659_10140559 3300025926 Bacteria 1874
274 Ga0207687_10029014 3300025927 Bacteria 3719
275 Ga0207687_10051065 3300025927 Bacteria 2881
276 Ga0207687_10119296 3300025927 Bacteria 1970
277 Ga0207687_11748548 3300025927 Unclassified 533
278 Ga0207700_10148734 3300025928 Bacteria 1933
279 Ga0207700_10494215 3300025928 Bacteria 1082
280 Ga0207700_10984007 3300025928 Unclassified 755
281 Ga0207664_10008194 3300025929 Bacteria 7275
282 Ga0207664_10064275 3300025929 Bacteria 2934
283 Ga0207664_10089001 3300025929 Bacteria 2527
284 Ga0207664_11734710 3300025929 Bacteria 547
285 Ga0207644_10609848 3300025931 Bacteria 907
286 Ga0207690_10079404 3300025932 Bacteria 2286
287 Ga0207706_10011134 3300025933 Bacteria 8197
288 Ga0207686_10240211 3300025934 Bacteria 1318
289 Ga0207686_10245121 3300025934 Bacteria 1306
290 Ga0207709_10437747 3300025935 Bacteria 1008
291 Ga0207709_10978556 3300025935 Bacteria 691
292 Ga0207669_10240221 3300025937 Bacteria 1342
293 Ga0207669_10778073 3300025937 Unclassified 792
294 Ga0207704_10355428 3300025938 Bacteria 1142
295 Ga0207665_10269296 3300025939 Bacteria 1264
296 Ga0207711_11529639 3300025941 Bacteria 610
297 Ga0207661_10000646 3300025944 Bacteria 22497
298 Ga0207661_10002904 3300025944 Bacteria 11845
299 Ga0207661_10144288 3300025944 Bacteria 2052
300 Ga0207661_10240284 3300025944 Unclassified 1607
301 Ga0207661_10445680 3300025944 Bacteria 1179
302 Ga0207679_10038796 3300025945 Bacteria 3397
303 Ga0207679_10404943 3300025945 Bacteria 1201
304 Ga0207667_10310579 3300025949 Bacteria 1610
305 Ga0207667_11044937 3300025949 Bacteria 802
306 Ga0207667_11772424 3300025949 Bacteria 582
307 Ga0207712_10798282 3300025961 Bacteria 830
308 Ga0207668_10033481 3300025972 Bacteria 3404
309 Ga0207640_10176680 3300025981 Bacteria 1597
310 Ga0207640_10783453 3300025981 Unclassified 825
311 Ga0207640_10935558 3300025981 Bacteria 759
312 Ga0207640_11171160 3300025981 Bacteria 682
313 Ga0207640_11581559 3300025981 Bacteria 590
314 Ga0207658_11565921 3300025986 Unclassified 603
315 Ga0207677_10074279 3300026023 Bacteria 2412
316 Ga0207677_10216838 3300026023 Bacteria 1532
317 Ga0207677_11491619 3300026023 Bacteria 624
318 Ga0207703_11727234 3300026035 Bacteria 602
319 Ga0207639_11439301 3300026041 Bacteria 647
320 Ga0207678_10461710 3300026067 Unclassified 1105
321 Ga0207708_10232803 3300026075 Bacteria 1479
322 Ga0207708_10306557 3300026075 Bacteria 1293
323 Ga0207702_10040010 3300026078 Bacteria 3930
324 Ga0207702_10085092 3300026078 Bacteria 2755
325 Ga0207702_11961767 3300026078 Bacteria 576
326 Ga0207676_10621563 3300026095 Unclassified 1040
327 Ga0207674_10011672 3300026116 Bacteria 9864
328 Ga0207674_10898666 3300026116 Bacteria 854
329 Ga0207674_11256417 3300026116 Unclassified 710
330 Ga0207675_100001956 3300026118 Bacteria 20587
331 Ga0207675_101947744 3300026118 Unclassified 606
332 Ga0207683_10013098 3300026121 Bacteria 7074
333 Ga0207683_10315858 3300026121 Bacteria 1430
334 Ga0207683_10475099 3300026121 Bacteria 1153
335 Ga0207683_11268687 3300026121 Bacteria 682
336 Ga0207698_10298846 3300026142 Bacteria 1498
337 Ga0268266_10140427 3300028379 Bacteria 2168
338 Ga0268265_12067415 3300028380 Unclassified 577
339 Ga0265326_10162382 3300028558 Bacteria 639
340 Ga0265318_10117651 3300028577 Bacteria 977
341 Ga0265322_10109813 3300028654 Bacteria 785
342 Ga0265320_10260753 3300031240 Bacteria 768
343 Ga0307405_11486223 3300031731 Bacteria 595
344 Ga0373953_0448006 3300035117 Unclassified 570
345 Ga0373946_0158230 3300035171 Bacteria 1062
346 Ga0373946_0160386 3300035171 Unclassified 1055
347 Ga0373955_0168509 3300035172 Bacteria 1295
348 Ga0373924_0178832 3300035410 Unclassified 933
349 Ga0373924_0219478 3300035410 Unclassified 840
350 Ga0373935_0056628 3300035692 Bacteria 2500
351 Ga0373935_0922575 3300035692 Unclassified 647
352 Ga0373933_0038828 3300035724 Bacteria 2799
353 Ga0373947_0324699 3300035725 Unclassified 1030
354 Ga0373947_0664148 3300035725 Unclassified 711
355 Ga0373937_0030094 3300036401 Bacteria 4918
356 Ga0373937_0332443 3300036401 Bacteria 1438
357 Ga0373937_1464463 3300036401 Bacteria 630
358 Ga0373925_0512321 3300037068 Unclassified 985
359 Ga0373925_0934010 3300037068 Bacteria 715
360 Ga0395900_0095823 3300037418 Bacteria 3049
361 Ga0395898_1115279 3300037466 Bacteria 722
362 Ga0395905_1444064 3300037471 Bacteria 592
363 Ga0395901_0141424 3300038443 Bacteria 2529
364 Ga0395901_0580190 3300038443 Bacteria 1133
365 Ga0439453_0004552 3300041408 Bacteria 2065
366 Ga0439451_006774 3300042009 Bacteria 2344
367 Ga0439456_095025 3300042013 Unclassified 672
368 Ga0466969_0174274 3300044656 Bacteria 985
369 Ga0466965_0046352 3300044683 Bacteria 2152
370 Ga0466965_0084358 3300044683 Unclassified 1609
371 Ga0466965_0390156 3300044683 Bacteria 768
372 Ga0466965_0495442 3300044683 Bacteria 685
373 Ga0466966_0005166 3300044684 Bacteria 8579
374 Ga0466966_0577646 3300044684 Archaea 676
375 Ga0466961_0009411 3300044693 Bacteria 6221
376 Ga0466961_0065511 3300044693 Bacteria 2309
377 Ga0466961_0136690 3300044693 Bacteria 1535
378 Ga0466961_0152043 3300044693 Bacteria 1445
379 Ga0466963_0002961 3300044694 Bacteria 9594
380 Ga0466963_0024009 3300044694 Bacteria 3878
381 Ga0466963_0091428 3300044694 Bacteria 2073
382 Ga0466963_0098550 3300044694 Bacteria 1998
383 Ga0466963_0282540 3300044694 Bacteria 1166
384 Ga0466963_1196667 3300044694 Unclassified 534
385 Ga0466964_0008197 3300044706 Bacteria 3920
386 Ga0466964_0008733 3300044706 Bacteria 3809
387 Ga0466964_0017466 3300044706 Bacteria 2746
388 Ga0466964_0285035 3300044706 Bacteria 827
389 Ga0466964_0329540 3300044706 Bacteria 778
390 Ga0466971_0023956 3300044719 Bacteria 2722
391 Ga0466971_0061092 3300044719 Bacteria 1703
392 Ga0466971_0092888 3300044719 Bacteria 1382
393 Ga0466971_0218192 3300044719 Bacteria 903
394 Ga0466968_0005417 3300044735 Bacteria 4780
395 Ga0466968_0038662 3300044735 Bacteria 2006
396 Ga0466968_0550889 3300044735 Bacteria 579
397 Ga0466970_0121969 3300044765 Bacteria 1428
398 Ga0466970_0179604 3300044765 Unclassified 1174
399 Ga0466957_0009050 3300044842 Bacteria 5677
400 Ga0466957_0014015 3300044842 Bacteria 4663
401 Ga0466957_0063471 3300044842 Bacteria 2270
402 Ga0466957_0122020 3300044842 Unclassified 1662
403 Ga0466957_0624372 3300044842 Bacteria 756
404 Ga0466957_0997452 3300044842 Bacteria 601
405 Ga0466960_0302966 3300044901 Bacteria 901
406 Ga0466960_0303774 3300044901 Bacteria 900
407 Ga0466960_0483945 3300044901 Unclassified 723
408 Ga0466960_0712313 3300044901 Bacteria 603
409 Ga0466960_0768653 3300044901 Bacteria 582
410 Ga0466959_0004905 3300045049 Bacteria 9061
411 Ga0466959_0022900 3300045049 Bacteria 4618
412 Ga0466959_0140204 3300045049 Bacteria 1709
413 Ga0466959_0158886 3300045049 Bacteria 1590
414 Ga0466959_0210962 3300045049 Bacteria 1349
415 Ga0466959_0366118 3300045049 Unclassified 982
416 Ga0451576_1009943 3300045051 Unclassified 872
417 Ga0466958_0003509 3300045836 Bacteria 8146
418 Ga0466958_0021039 3300045836 Bacteria 3808
419 Ga0466958_0154648 3300045836 Bacteria 1447
420 Ga0466958_0231643 3300045836 Bacteria 1179
421 Ga0466958_0330181 3300045836 Bacteria 980
422 Ga0466958_0769977 3300045836 Unclassified 627
423 Ga0466967_0003290 3300045976 Bacteria 10487
424 Ga0466967_0009557 3300045976 Bacteria 7204
425 Ga0466967_0019771 3300045976 Bacteria 5424
426 Ga0466967_0022314 3300045976 Bacteria 5162
427 Ga0466967_0029704 3300045976 Bacteria 4578
428 Ga0466967_0128090 3300045976 Bacteria 2353
429 Ga0466967_0475584 3300045976 Bacteria 1223
430 Ga0466967_0896700 3300045976 Bacteria 882
431 Ga0495592_0000314 3300046454 Bacteria 40742
432 Ga0495592_0150486 3300046454 Unclassified 1610
433 Ga0495603_0177562 3300046455 Bacteria 1233
434 Ga0495629_0033407 3300046459 Unclassified 3639
435 Ga0495641_0026319 3300046461 Unclassified 2839
436 Ga0495651_0000258 3300046462 Bacteria 41081
437 Ga0495653_0005626 3300046463 Bacteria 10229
438 Ga0495653_0128445 3300046463 Unclassified 1797
439 Ga0495580_0993596 3300046472 Unclassified 535
440 Ga0495582_0074742 3300046473 Unclassified 1876
441 Ga0495639_0050189 3300046475 Bacteria 1895
442 Ga0495662_0044284 3300046476 Bacteria 2149
443 Ga0495664_0033655 3300046477 Bacteria 3012
444 Ga0495664_0324189 3300046477 Bacteria 929
445 Ga0495594_0278131 3300046499 Bacteria 954
446 Ga0495596_0062065 3300046500 Bacteria 1455
447 Ga0495608_0026245 3300046511 Bacteria 3972
448 Ga0495608_0788059 3300046511 Unclassified 561
449 Ga0495618_0008364 3300046514 Bacteria 6262
450 Ga0495618_0087204 3300046514 Bacteria 1996
451 Ga0495628_0013491 3300046516 Bacteria 6873
452 Ga0495628_0128299 3300046516 Bacteria 1942
453 Ga0495628_1197126 3300046516 Bacteria 515
454 Ga0495630_0025453 3300046517 Bacteria 4376
455 Ga0495630_0030394 3300046517 Bacteria 4018
456 Ga0495630_0032064 3300046517 Bacteria 3913
457 Ga0495631_0054859 3300046518 Unclassified 1737
458 Ga0495637_0040705 3300046520 Unclassified 1999
459 Ga0495637_0266583 3300046520 Bacteria 614
460 Ga0495652_0042484 3300046529 Bacteria 3919
461 Ga0495652_0126932 3300046529 Bacteria 2025
462 Ga0495652_0131074 3300046529 Bacteria 1984
463 Ga0495665_0068907 3300046531 Bacteria 1865
464 Ga0495640_0002795 3300046533 Bacteria 14040
465 Ga0495640_0440796 3300046533 Bacteria 796
466 Ga0495640_0664650 3300046533 Bacteria 626
467 Ga0495586_0034052 3300046535 Unclassified 2735
468 Ga0495586_0163437 3300046535 Bacteria 1256
469 Ga0495587_0009035 3300046536 Bacteria 6397
470 Ga0495587_0150740 3300046536 Bacteria 1325
471 Ga0495645_0000103 3300046543 Bacteria 58974
472 Ga0495645_0226620 3300046543 Bacteria 1254
473 Ga0495645_0256939 3300046543 Bacteria 1159
474 Ga0495667_0102564 3300046559 Bacteria 1850
475 Ga0495667_0143540 3300046559 Bacteria 1538
476 Ga0495667_0243132 3300046559 Bacteria 1146
477 Ga0495667_0309286 3300046559 Bacteria 1001
478 Ga0495667_0399637 3300046559 Unclassified 866
479 Ga0495656_0613613 3300046615 Bacteria 583
480 Ga0495656_0812785 3300046615 Bacteria 505
481 Ga0495634_0160746 3300046642 Bacteria 1416
482 Ga0495634_0736609 3300046642 Unclassified 565
483 Ga0495635_0119391 3300046663 Unclassified 1799
484 Ga0495588_0087300 3300046674 Bacteria 1632
485 Ga0495657_0033595 3300046675 Bacteria 3570
486 Ga0495657_0059253 3300046675 Bacteria 2540
487 Ga0495599_0022835 3300046678 Bacteria 3908
488 Ga0495599_0028362 3300046678 Bacteria 3508
489 Ga0495623_0000045 3300046679 Bacteria 76108
490 Ga0495646_0006375 3300046680 Bacteria 7483
491 Ga0495647_0058857 3300046681 Unclassified 1511
492 Ga0495658_0109403 3300046683 Bacteria 1660
493 Ga0495658_0251619 3300046683 Bacteria 1111
494 Ga0495669_0178522 3300046684 Bacteria 1012
495 Ga0495613_0071843 3300046689 Unclassified 2522
496 Ga0495613_0651228 3300046689 Bacteria 697
497 Ga0495624_0084883 3300046690 Unclassified 1956
498 Ga0495670_0652283 3300046691 Bacteria 574
499 Ga0495589_0373551 3300046794 Unclassified 656
500 Ga0495600_0023383 3300046809 Bacteria 3976
501 Ga0495600_0664997 3300046809 Bacteria 629
502 Ga0495581_0269602 3300047315 Bacteria 995
503 Ga0495604_0004311 3300047317 Bacteria 11258
504 Ga0495674_0004834 3300047319 Bacteria 12953
505 Ga0495674_0113912 3300047319 Bacteria 2290
506 Ga0495674_0240699 3300047319 Bacteria 1491
507 Ga0495676_0101786 3300047321 Unclassified 2124
508 Ga0495680_0041118 3300047322 Bacteria 3677
509 Ga0495680_0147250 3300047322 Bacteria 1719
510 Ga0495680_0201688 3300047322 Bacteria 1426
511 Ga0495675_0023529 3300047444 Bacteria 3925
512 Ga0495602_0040084 3300048088 Bacteria 4301
513 Ga0495602_0059738 3300048088 Bacteria 3326
514 Ga0495614_0097041 3300048089 Bacteria 1286
515 Ga0496100_0008464 3300048903 Bacteria 5738
516 Ga0496100_0168519 3300048903 Bacteria 1575
517 Ga0496100_0496804 3300048903 Unclassified 940
518 Ga0496100_0622679 3300048903 Bacteria 839
519 Ga0496101_0007438 3300048904 Bacteria 7099
520 Ga0496101_0070544 3300048904 Bacteria 2559
521 Ga0496101_0475525 3300048904 Bacteria 986
522 Ga0496101_0623766 3300048904 Unclassified 852
523 Ga0496102_0017881 3300048905 Bacteria 6217
524 Ga0496102_0284236 3300048905 Unclassified 1559
525 Ga0496103_0019809 3300048906 Bacteria 4039
526 Ga0496103_0183450 3300048906 Bacteria 1345
527 Ga0496104_0000617 3300048907 Bacteria 30492
528 Ga0496104_0101027 3300048907 Bacteria 2761
529 Ga0496104_0115501 3300048907 Bacteria 2575
530 Ga0496104_0257077 3300048907 Bacteria 1659
531 Ga0496104_0657512 3300048907 Unclassified 957
532 Ga0496104_0900961 3300048907 Unclassified 789
533 Ga0496105_0000147 3300048908 Bacteria 46556
534 Ga0496105_0014518 3300048908 Bacteria 6269
535 Ga0496105_0052984 3300048908 Bacteria 3351
536 Ga0496105_0175168 3300048908 Bacteria 1757
537 Ga0496105_0305292 3300048908 Bacteria 1278
538 Ga0496105_0628055 3300048908 Bacteria 831
539 Ga0496106_0154077 3300048909 Bacteria 1814
540 Ga0496107_0086651 3300048910 Bacteria 2286
541 Ga0496107_0149715 3300048910 Bacteria 1726
542 Ga0496107_0441503 3300048910 Bacteria 967
543 Ga0496107_0983732 3300048910 Unclassified 613
544 Ga0496108_0001243 3300048911 Bacteria 19971
545 Ga0496108_0003120 3300048911 Bacteria 13325
546 Ga0496108_0993909 3300048911 Bacteria 717
547 Ga0496108_1022944 3300048911 Unclassified 705
548 Ga0496108_1329643 3300048911 Unclassified 603
549 Ga0496109_0000605 3300048912 Bacteria 29977
550 Ga0496109_0002132 3300048912 Bacteria 16461
551 Ga0496109_0007916 3300048912 Bacteria 9006
552 Ga0496109_0113950 3300048912 Bacteria 2515
553 Ga0496109_1093196 3300048912 Unclassified 734
554 Ga0496110_0001824 3300048913 Bacteria 15701
555 Ga0496110_0003271 3300048913 Bacteria 12356
556 Ga0496110_0025461 3300048913 Bacteria 5056
557 Ga0496110_0098857 3300048913 Bacteria 2616
558 Ga0496110_0370821 3300048913 Bacteria 1304
559 Ga0496110_0465986 3300048913 Bacteria 1151
560 Ga0496110_0498920 3300048913 Unclassified 1108
561 Ga0496111_0003709 3300048914 Bacteria 9502
562 Ga0496111_0004066 3300048914 Bacteria 9190
563 Ga0496111_0005904 3300048914 Bacteria 7896
564 Ga0496111_0075666 3300048914 Bacteria 2453
565 Ga0496111_0798456 3300048914 Bacteria 683
566 Ga0496112_0001618 3300048915 Bacteria 17434
567 Ga0496112_0043213 3300048915 Bacteria 4412
568 Ga0496112_0067232 3300048915 Unclassified 3537
569 Ga0496112_0178255 3300048915 Bacteria 2089
570 Ga0496112_0231868 3300048915 Unclassified 1800
571 Ga0496112_0432818 3300048915 Unclassified 1254
572 Ga0496113_0055621 3300048916 Bacteria 2967
573 Ga0496113_0072624 3300048916 Bacteria 2619
574 Ga0496113_0185632 3300048916 Bacteria 1649
575 Ga0496113_0229769 3300048916 Bacteria 1479
576 Ga0496113_0755209 3300048916 Bacteria 774
577 Ga0496114_0011459 3300048917 Bacteria 7085
578 Ga0496114_0022653 3300048917 Bacteria 5120
579 Ga0496114_0027874 3300048917 Bacteria 4630
580 Ga0496114_0028923 3300048917 Bacteria 4552
581 Ga0496114_0120539 3300048917 Bacteria 2256
582 Ga0496115_0098457 3300048918 Bacteria 2395
583 Ga0496115_0790062 3300048918 Bacteria 739
584 Ga0501040_0153402 3300049576 Bacteria 1626
585 Ga0501041_0099031 3300049577 Bacteria 1803
586 Ga0501067_0039048 3300049583 Bacteria 2635
587 Ga0501067_0073916 3300049583 Bacteria 1888
588 Ga0501068_0713813 3300049584 Bacteria 656
589 Ga0501069_0085311 3300049585 Bacteria 1782
590 Ga0501069_0555148 3300049585 Bacteria 687
591 Ga0501071_0276605 3300049587 Bacteria 1270
592 Ga0501076_0774185 3300049592 Bacteria 792
593 Ga0501080_1577339 3300049742 Bacteria 556
594 Ga0501081_0580876 3300049743 Bacteria 838
595 Ga0501045_0089199 3300049824 Bacteria 2278
596 nmdc:mga00v17_669706_c1 3300050491 Bacteria 666
597 nmdc:mga0yw44_609263_c1 3300050492 Bacteria 742
598 nmdc:mga05p37_251116_c1 3300050507 Bacteria 2121
599 nmdc:mga05p37_298057_c1 3300050507 Unclassified 1917
600 nmdc:mga05p37_368445_c1 3300050507 Bacteria 1687
601 nmdc:mga09592_316987_c1 3300050508 Bacteria 1351
602 nmdc:mga06r32_1489097_c1 3300050510 Bacteria 617
603 nmdc:mga06r32_1561823_c1 3300050510 Bacteria 599
604 nmdc:mga08y16_1211047_c1 3300050511 Bacteria 725
605 nmdc:mga08y16_949004_c1 3300050511 Unclassified 843
606 nmdc:mga0n895_197439_c1 3300050512 Unclassified 2043
607 nmdc:mga0n895_596152_c1 3300050512 Bacteria 1108
608 nmdc:mga0rr50_529051_c1 3300050513 Bacteria 1003
609 nmdc:mga0rr50_64222_c1 3300050513 Bacteria 2776
610 nmdc:mga08x19_456130_c1 3300050514 Bacteria 900
611 nmdc:mga0a205_156507_c2 3300050515 Bacteria 800
612 nmdc:mga0a205_408095_c1 3300050515 Bacteria 1222
613 Ga0495601_0000150 3300053077 Bacteria 39214
614 Ga0495601_0003901 3300053077 Bacteria 8583
615 Ga0495601_0196473 3300053077 Unclassified 1319
616 Ga0495601_0869801 3300053077 Bacteria 570
617 Ga0495612_0081181 3300053078 Bacteria 1362
618 Ga0495655_0114920 3300053083 Bacteria 813
619 Ga0495595_0015947 3300053084 Bacteria 3209
620 Ga0495619_0001586 3300053085 Bacteria 14950
621 Ga0495619_0023224 3300053085 Bacteria 3974
622 Ga0501084_0701443 3300054114 Bacteria 853
623 Ga0501082_0019297 3300060353 Bacteria 5878
624 Ga0466962_0000930 3300061719 Bacteria 13260
625 Ga0466962_0002149 3300061719 Bacteria 9314
626 Ga0466962_0013879 3300061719 Bacteria 3879
627 Ga0466962_0661854 3300061719 Unclassified 534
628 Ga0530510_1085068 3300061734 Bacteria 613
629 Ga0070714_102168986
630 Ga0058862_10009011
631 Ga0058862_12835682
632 Ga0058862_12850731
633 Ga0070676_10184675
634 Ga0070683_100001257
635 Ga0070683_100127338
636 Ga0070683_100138099
637 Ga0070683_100150706
638 Ga0070683_100281103
639 Ga0070683_101720592
640 Ga0070670_100025844
641 Ga0070670_100912797
642 Ga0070680_100023373
643 Ga0070680_100036642
644 Ga0070680_100219263
645 Ga0070680_100292749
646 Ga0070682_100059586
647 Ga0070682_100116637
648 Ga0068868_100522967
649 Ga0068868_101118335
650 Ga0070660_100003641
651 Ga0070660_100036371
652 Ga0070660_100433718
653 Ga0070691_10232320
654 Ga0070661_100043077
655 Ga0070661_100315958
656 Ga0070661_100356196
657 Ga0070692_10618557
658 Ga0070668_100007521
659 Ga0070669_100297064
660 Ga0070675_101807439
661 Ga0070671_100217487
662 Ga0070674_100161630
663 Ga0070674_100699004
664 Ga0070688_101634822
665 Ga0070659_100017135
666 Ga0070703_10485778
667 Ga0070714_100000534
668 Ga0070714_100087887
669 Ga0070714_100209944
670 Ga0070713_100008026
671 Ga0070713_100110591
672 Ga0070713_101117248
673 Ga0070710_10005607
674 Ga0070701_10296814
675 Ga0070711_100016585
676 Ga0070711_100373589
677 Ga0070705_100267017
678 Ga0070705_100551301
679 Ga0070705_100889526
680 Ga0070700_100437460
681 Ga0070694_100007303
682 Ga0070694_101028931
683 Ga0070694_101148580
684 Ga0070708_101325388
685 Ga0070663_100406493
686 Ga0070663_101179982
687 Ga0070678_100022622
688 Ga0070678_100462966
689 Ga0070678_100778138
690 Ga0070662_100010294
691 Ga0070681_10048675
692 Ga0070681_10054416
693 Ga0070681_10063264
694 Ga0070681_10074427
695 Ga0070681_10080991
696 Ga0068867_100526734
697 Ga0070706_100769084
698 Ga0070706_101215645
699 Ga0070707_100380760
700 Ga0070707_101158459
701 Ga0070698_100133850
702 Ga0074259_10213146
703 Ga0070679_100025391
704 Ga0070679_100080574
705 Ga0070679_100211667
706 Ga0070679_100311202
707 Ga0070684_100039637
708 Ga0070684_100056958
709 Ga0070684_101555820
710 Ga0070684_102250809
711 Ga0068853_101640067
712 Ga0070686_100106091
713 Ga0070695_100184918
714 Ga0070695_100809474
715 Ga0070696_100220440
716 Ga0070696_100968687
717 Ga0070693_100167643
718 Ga0070693_100187784
719 Ga0070665_100448674
720 Ga0070704_101334842
721 Ga0070704_101335349
722 Ga0068855_100042282
723 Ga0068855_100163083
724 Ga0068855_100720556
725 Ga0068855_100730931
726 Ga0068855_101077616
727 Ga0070664_100027764
728 Ga0068857_100011723
729 Ga0068857_100706275
730 Ga0068857_100957069
731 Ga0068857_101772637
732 Ga0068854_100247832
733 Ga0068854_100399535
734 Ga0068854_100976552
735 Ga0068854_101089104
736 Ga0068854_101099875
737 Ga0068856_100060483
738 Ga0068856_100061575
739 Ga0068856_100108549
740 Ga0068856_100470393
741 Ga0068852_101614181
742 Ga0068852_102418830
743 Ga0068859_102416872
744 Ga0068866_11094406
745 Ga0068861_100004166
746 Ga0068870_10005550
747 Ga0068860_102625933
748 Ga0068862_100323195
749 Ga0070717_10089632
750 Ga0070717_10164581
751 Ga0070717_11147387
752 Ga0075365_10573539
753 Ga0070712_100031619
754 Ga0070712_100300596
755 Ga0097621_102326702
756 Ga0068871_100596851
757 Ga0075428_100476028
758 Ga0075428_101853236
759 Ga0075428_102202266
760 Ga0075431_100332959
761 Ga0075433_11026056
762 Ga0075433_11125365
763 Ga0075434_100039854
764 Ga0075434_100200791
765 Ga0068865_100495492
766 Ga0068865_100526634
767 Ga0068865_100774908
768 Ga0075436_100488029
769 Ga0097620_102417907
770 Ga0075435_100028143
771 Ga0075435_100160588
772 Ga0075435_101222217
773 Ga0099795_10257762
774 Ga0105240_10594006
775 Ga0105240_11212282
776 Ga0105240_11703104
777 Ga0111539_10123677
778 Ga0111539_12817171
779 Ga0111539_13023641
780 Ga0105245_10025625
781 Ga0105245_10045304
782 Ga0105245_10146927
783 Ga0105247_11500487
784 Ga0114129_10032856
785 Ga0114129_10405539
786 Ga0114129_10616695
787 Ga0114129_10799494
788 Ga0114129_11050707
789 Ga0105243_10089746
790 Ga0105243_10151597
791 Ga0105241_10124477
792 Ga0105242_10250392
793 Ga0105242_10981756
794 Ga0105242_12874446
795 Ga0105248_10522146
796 Ga0105248_12052289
797 Ga0105237_10891151
798 Ga0105237_11038331
799 Ga0105238_10968816
800 Ga0105238_11242476
801 Ga0105249_10022445
802 Ga0099796_10122133
803 Ga0105239_10209430
804 Ga0105239_10753961
805 Ga0105246_10053071
806 Ga0105246_10342439
807 Ga0105246_10556788
808 Ga0157335_1038325
809 Ga0157341_1008474
810 Ga0157342_1000466
811 Ga0157342_1084689
812 Ga0157371_11091478
813 Ga0157370_10400354
814 Ga0157370_11587746
815 Ga0157369_10151355
816 Ga0157369_10481807
817 Ga0157369_12410509
818 Ga0157374_10068688
819 Ga0157374_11033892
820 Ga0157378_10654914
821 Ga0163162_10018110
822 Ga0157372_10049438
823 Ga0157372_10604839
824 Ga0157372_10732999
825 Ga0157375_10132078
826 Ga0157375_11141979
827 Ga0157375_11283059
828 Ga0157375_12496481
829 Ga0163163_10304810
830 Ga0163163_10898040
831 Ga0163163_12787412
832 Ga0157380_10494436
833 Ga0182008_10075701
834 Ga0182008_10080032
835 Ga0182008_10409163
836 Ga0157377_10016666
837 Ga0157377_10231484
838 Ga0157376_10520819
839 Ga0197907_11048449
840 Ga0206356_10703398
841 Ga0206356_10829087
842 Ga0206356_11279372
843 Ga0206356_11822262
844 Ga0206352_10235482
845 Ga0206352_10341648
846 Ga0206354_11349913
847 Ga0206354_11467597
848 Ga0206354_11523351
849 Ga0206353_10007380
850 Ga0206353_10392913
851 Ga0206353_10820595
852 Ga0206353_11318545
853 Ga0206353_12042111
854 Ga0154015_1492540
855 Ga0224712_10196185
856 Ga0207692_10054871
857 Ga0207692_10808125
858 Ga0207642_10892042
859 Ga0207688_10040883
860 Ga0207688_10766941
861 Ga0207699_10165604
862 Ga0207645_10613511
863 Ga0207643_10002041
864 Ga0207705_10012826
865 Ga0207705_11331182
866 Ga0207684_10069984
867 Ga0207684_11749639
868 Ga0207654_10070217
869 Ga0207707_10016888
870 Ga0207707_10024468
871 Ga0207707_10027672
872 Ga0207707_10030360
873 Ga0207707_10084312
874 Ga0207695_11489953
875 Ga0207693_10000938
876 Ga0207693_10290960
877 Ga0207663_10505554
878 Ga0207663_11148150
879 Ga0207660_10006528
880 Ga0207660_10038707
881 Ga0207660_10068076
882 Ga0207660_10205482
883 Ga0207660_10956955
884 Ga0207657_10003466
885 Ga0207657_10027851
886 Ga0207657_10102905
887 Ga0207657_11015545
888 Ga0207649_10027919
889 Ga0207649_10373417
890 Ga0207649_10984397
891 Ga0207652_10019354
892 Ga0207652_10038901
893 Ga0207652_10042585
894 Ga0207652_10261502
895 Ga0207652_11216535
896 Ga0207646_10284617
897 Ga0207646_11344721
898 Ga0207694_10601268
899 Ga0207694_11180658
900 Ga0207650_10026027
901 Ga0207659_10140559
902 Ga0207687_10029014
903 Ga0207687_10051065
904 Ga0207687_10119296
905 Ga0207687_11748548
906 Ga0207700_10148734
907 Ga0207700_10494215
908 Ga0207700_10984007
909 Ga0207664_10008194
910 Ga0207664_10064275
911 Ga0207664_10089001
912 Ga0207664_11734710
913 Ga0207644_10609848
914 Ga0207690_10079404
915 Ga0207706_10011134
916 Ga0207686_10240211
917 Ga0207686_10245121
918 Ga0207709_10437747
919 Ga0207709_10978556
920 Ga0207669_10240221
921 Ga0207669_10778073
922 Ga0207704_10355428
923 Ga0207665_10269296
924 Ga0207711_11529639
925 Ga0207661_10000646
926 Ga0207661_10002904
927 Ga0207661_10144288
928 Ga0207661_10240284
929 Ga0207661_10445680
930 Ga0207679_10038796
931 Ga0207679_10404943
932 Ga0207667_10310579
933 Ga0207667_11044937
934 Ga0207667_11772424
935 Ga0207712_10798282
936 Ga0207668_10033481
937 Ga0207640_10176680
938 Ga0207640_10783453
939 Ga0207640_10935558
940 Ga0207640_11171160
941 Ga0207640_11581559
942 Ga0207658_11565921
943 Ga0207677_10074279
944 Ga0207677_10216838
945 Ga0207677_11491619
946 Ga0207703_11727234
947 Ga0207639_11439301
948 Ga0207678_10461710
949 Ga0207708_10232803
950 Ga0207708_10306557
951 Ga0207702_10040010
952 Ga0207702_10085092
953 Ga0207702_11961767
954 Ga0207676_10621563
955 Ga0207674_10011672
956 Ga0207674_10898666
957 Ga0207674_11256417
958 Ga0207675_100001956
959 Ga0207675_101947744
960 Ga0207683_10013098
961 Ga0207683_10315858
962 Ga0207683_10475099
963 Ga0207683_11268687
964 Ga0207698_10298846
965 Ga0268266_10140427
966 Ga0268265_12067415
967 Ga0265326_10162382
968 Ga0265318_10117651
969 Ga0265322_10109813
970 Ga0265320_10260753
971 Ga0307405_11486223
972 Ga0373953_0448006
973 Ga0373946_0158230
974 Ga0373946_0160386
975 Ga0373955_0168509
976 Ga0373924_0178832
977 Ga0373924_0219478
978 Ga0373935_0056628
979 Ga0373935_0922575
980 Ga0373933_0038828
981 Ga0373947_0324699
982 Ga0373947_0664148
983 Ga0373937_0030094
984 Ga0373937_0332443
985 Ga0373937_1464463
986 Ga0373925_0512321
987 Ga0373925_0934010
988 Ga0395900_0095823
989 Ga0395898_1115279
990 Ga0395905_1444064
991 Ga0395901_0141424
992 Ga0395901_0580190
993 Ga0439453_0004552
994 Ga0439451_006774
995 Ga0439456_095025
996 Ga0466969_0174274
997 Ga0466965_0046352
998 Ga0466965_0084358
999 Ga0466965_0390156
1000 Ga0466965_0495442
1001 Ga0466966_0005166
1002 Ga0466966_0577646
1003 Ga0466961_0009411
1004 Ga0466961_0065511
1005 Ga0466961_0136690
1006 Ga0466961_0152043
1007 Ga0466963_0002961
1008 Ga0466963_0024009
1009 Ga0466963_0091428
1010 Ga0466963_0098550
1011 Ga0466963_0282540
1012 Ga0466963_1196667
1013 Ga0466964_0008197
1014 Ga0466964_0008733
1015 Ga0466964_0017466
1016 Ga0466964_0285035
1017 Ga0466964_0329540
1018 Ga0466971_0023956
1019 Ga0466971_0061092
1020 Ga0466971_0092888
1021 Ga0466971_0218192
1022 Ga0466968_0005417
1023 Ga0466968_0038662
1024 Ga0466968_0550889
1025 Ga0466970_0121969
1026 Ga0466970_0179604
1027 Ga0466957_0009050
1028 Ga0466957_0014015
1029 Ga0466957_0063471
1030 Ga0466957_0122020
1031 Ga0466957_0624372
1032 Ga0466957_0997452
1033 Ga0466960_0302966
1034 Ga0466960_0303774
1035 Ga0466960_0483945
1036 Ga0466960_0712313
1037 Ga0466960_0768653
1038 Ga0466959_0004905
1039 Ga0466959_0022900
1040 Ga0466959_0140204
1041 Ga0466959_0158886
1042 Ga0466959_0210962
1043 Ga0466959_0366118
1044 Ga0451576_1009943
1045 Ga0466958_0003509
1046 Ga0466958_0021039
1047 Ga0466958_0154648
1048 Ga0466958_0231643
1049 Ga0466958_0330181
1050 Ga0466958_0769977
1051 Ga0466967_0003290
1052 Ga0466967_0009557
1053 Ga0466967_0019771
1054 Ga0466967_0022314
1055 Ga0466967_0029704
1056 Ga0466967_0128090
1057 Ga0466967_0475584
1058 Ga0466967_0896700
1059 Ga0495592_0000314
1060 Ga0495592_0150486
1061 Ga0495603_0177562
1062 Ga0495629_0033407
1063 Ga0495641_0026319
1064 Ga0495651_0000258
1065 Ga0495653_0005626
1066 Ga0495653_0128445
1067 Ga0495580_0993596
1068 Ga0495582_0074742
1069 Ga0495639_0050189
1070 Ga0495662_0044284
1071 Ga0495664_0033655
1072 Ga0495664_0324189
1073 Ga0495594_0278131
1074 Ga0495596_0062065
1075 Ga0495608_0026245
1076 Ga0495608_0788059
1077 Ga0495618_0008364
1078 Ga0495618_0087204
1079 Ga0495628_0013491
1080 Ga0495628_0128299
1081 Ga0495628_1197126
1082 Ga0495630_0025453
1083 Ga0495630_0030394
1084 Ga0495630_0032064
1085 Ga0495631_0054859
1086 Ga0495637_0040705
1087 Ga0495637_0266583
1088 Ga0495652_0042484
1089 Ga0495652_0126932
1090 Ga0495652_0131074
1091 Ga0495665_0068907
1092 Ga0495640_0002795
1093 Ga0495640_0440796
1094 Ga0495640_0664650
1095 Ga0495586_0034052
1096 Ga0495586_0163437
1097 Ga0495587_0009035
1098 Ga0495587_0150740
1099 Ga0495645_0000103
1100 Ga0495645_0226620
1101 Ga0495645_0256939
1102 Ga0495667_0102564
1103 Ga0495667_0143540
1104 Ga0495667_0243132
1105 Ga0495667_0309286
1106 Ga0495667_0399637
1107 Ga0495656_0613613
1108 Ga0495656_0812785
1109 Ga0495634_0160746
1110 Ga0495634_0736609
1111 Ga0495635_0119391
1112 Ga0495588_0087300
1113 Ga0495657_0033595
1114 Ga0495657_0059253
1115 Ga0495599_0022835
1116 Ga0495599_0028362
1117 Ga0495623_0000045
1118 Ga0495646_0006375
1119 Ga0495647_0058857
1120 Ga0495658_0109403
1121 Ga0495658_0251619
1122 Ga0495669_0178522
1123 Ga0495613_0071843
1124 Ga0495613_0651228
1125 Ga0495624_0084883
1126 Ga0495670_0652283
1127 Ga0495589_0373551
1128 Ga0495600_0023383
1129 Ga0495600_0664997
1130 Ga0495581_0269602
1131 Ga0495604_0004311
1132 Ga0495674_0004834
1133 Ga0495674_0113912
1134 Ga0495674_0240699
1135 Ga0495676_0101786
1136 Ga0495680_0041118
1137 Ga0495680_0147250
1138 Ga0495680_0201688
1139 Ga0495675_0023529
1140 Ga0495602_0040084
1141 Ga0495602_0059738
1142 Ga0495614_0097041
1143 Ga0496100_0008464
1144 Ga0496100_0168519
1145 Ga0496100_0496804
1146 Ga0496100_0622679
1147 Ga0496101_0007438
1148 Ga0496101_0070544
1149 Ga0496101_0475525
1150 Ga0496101_0623766
1151 Ga0496102_0017881
1152 Ga0496102_0284236
1153 Ga0496103_0019809
1154 Ga0496103_0183450
1155 Ga0496104_0000617
1156 Ga0496104_0101027
1157 Ga0496104_0115501
1158 Ga0496104_0257077
1159 Ga0496104_0657512
1160 Ga0496104_0900961
1161 Ga0496105_0000147
1162 Ga0496105_0014518
1163 Ga0496105_0052984
1164 Ga0496105_0175168
1165 Ga0496105_0305292
1166 Ga0496105_0628055
1167 Ga0496106_0154077
1168 Ga0496107_0086651
1169 Ga0496107_0149715
1170 Ga0496107_0441503
1171 Ga0496107_0983732
1172 Ga0496108_0001243
1173 Ga0496108_0003120
1174 Ga0496108_0993909
1175 Ga0496108_1022944
1176 Ga0496108_1329643
1177 Ga0496109_0000605
1178 Ga0496109_0002132
1179 Ga0496109_0007916
1180 Ga0496109_0113950
1181 Ga0496109_1093196
1182 Ga0496110_0001824
1183 Ga0496110_0003271
1184 Ga0496110_0025461
1185 Ga0496110_0098857
1186 Ga0496110_0370821
1187 Ga0496110_0465986
1188 Ga0496110_0498920
1189 Ga0496111_0003709
1190 Ga0496111_0004066
1191 Ga0496111_0005904
1192 Ga0496111_0075666
1193 Ga0496111_0798456
1194 Ga0496112_0001618
1195 Ga0496112_0043213
1196 Ga0496112_0067232
1197 Ga0496112_0178255
1198 Ga0496112_0231868
1199 Ga0496112_0432818
1200 Ga0496113_0055621
1201 Ga0496113_0072624
1202 Ga0496113_0185632
1203 Ga0496113_0229769
1204 Ga0496113_0755209
1205 Ga0496114_0011459
1206 Ga0496114_0022653
1207 Ga0496114_0027874
1208 Ga0496114_0028923
1209 Ga0496114_0120539
1210 Ga0496115_0098457
1211 Ga0496115_0790062
1212 Ga0501040_0153402
1213 Ga0501041_0099031
1214 Ga0501067_0039048
1215 Ga0501067_0073916
1216 Ga0501068_0713813
1217 Ga0501069_0085311
1218 Ga0501069_0555148
1219 Ga0501071_0276605
1220 Ga0501076_0774185
1221 Ga0501080_1577339
1222 Ga0501081_0580876
1223 Ga0501045_0089199
1224 nmdc:mga00v17_669706_c1
1225 nmdc:mga0yw44_609263_c1
1226 nmdc:mga05p37_251116_c1
1227 nmdc:mga05p37_298057_c1
1228 nmdc:mga05p37_368445_c1
1229 nmdc:mga09592_316987_c1
1230 nmdc:mga06r32_1489097_c1
1231 nmdc:mga06r32_1561823_c1
1232 nmdc:mga08y16_1211047_c1
1233 nmdc:mga08y16_949004_c1
1234 nmdc:mga0n895_197439_c1
1235 nmdc:mga0n895_596152_c1
1236 nmdc:mga0rr50_529051_c1
1237 nmdc:mga0rr50_64222_c1
1238 nmdc:mga08x19_456130_c1
1239 nmdc:mga0a205_156507_c2
1240 nmdc:mga0a205_408095_c1
1241 Ga0495601_0000150
1242 Ga0495601_0003901
1243 Ga0495601_0196473
1244 Ga0495601_0869801
1245 Ga0495612_0081181
1246 Ga0495655_0114920
1247 Ga0495595_0015947
1248 Ga0495619_0001586
1249 Ga0495619_0023224
1250 Ga0501084_0701443
1251 Ga0501082_0019297
1252 Ga0466962_0000930
1253 Ga0466962_0002149
1254 Ga0466962_0013879
1255 Ga0466962_0661854
1256 Ga0530510_1085068

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5myj-assembly1.cif.gz_BT structure of 70s ribosome from lactococcus lactis 0.4462 7 69
7piq-assembly1.cif.gz_p 70s ribosome with a- and p-site trnas in pseudouridimycin-treated mycoplasma pneumoniae cells 0.4016 1 69
5myj-assembly1.cif.gz_BT structure of 70s ribosome from lactococcus lactis 0.3459 7 69
7piq-assembly1.cif.gz_p 70s ribosome with a- and p-site trnas in pseudouridimycin-treated mycoplasma pneumoniae cells 0.3352 1 69
ID Description Score Start End Superfamily
af_P34368_57_105_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.8425 55 80 1.10.238.10
af_P34368_57_105_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.4892 55 80 1.10.238.10
ID Description Score Start End GO Terms
AF-A0A1I2UX39-F1-model_v4 Uncharacterized protein 0.5209 16 82
AF-A0A7V9CVR0-F1-model_v4 Addiction module protein 0.5104 1 82 GO:0003824
GO:0046914
AF-A0A7V9FLD4-F1-model_v4 Uncharacterized protein 0.5017 4 66 GO:0003824
GO:0046914
AF-A0A7V9CVR0-F1-model_v4 Addiction module protein 0.4998 1 82 GO:0003824
GO:0046914
AF-A0A7V9DFQ9-F1-model_v4 Uncharacterized protein 0.496 1 82

Map