F470543

General Info

Members Datasets Scaffolds Average Seq Length
627 311 611 126

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_101035972|Ga0068861_1010359722
Length 146
Sequence MISRGLRRLPRQGAAECEGKLMFENTKAFSGFSVDDVGKAKAFYGDVLGLKVTEENGLLTLHLAGDRPTLVYPKPNHTPATFTILNFPVDDVESAVDQLTERGVSFERYAGTPTETDEKGVFRGGGPLIAWFKDPAGNVLSVLQAG

Samples

Sample ID Description Type Environment
1 2643221711 Terrabacter sp. Root85 Isolate Unclassified
2 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
3 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
4 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
5 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
6 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
7 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
8 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
9 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
10 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
11 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
12 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
13 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
14 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
15 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
189 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
190 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
191 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
192 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
195 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
196 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
197 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
198 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
199 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
205 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
209 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
215 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
220 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
221 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
222 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
233 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
234 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
235 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
236 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
259 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
260 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
276 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
277 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
278 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
279 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
280 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
281 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
282 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
283 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
284 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
285 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
286 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
287 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
290 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
291 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
292 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
300 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
301 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
302 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
303 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
304 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
305 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
306 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
307 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
308 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
309 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
310 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
311 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.17
Metatranscriptomes 1.28
Isolates 2.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.71
Nodule 0.16
Rhizoplane 5.74
Rhizosphere 88.52
Stem 0
Stem Tuber 0
Unclassified 2.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10184331 3300001990 Bacteria 616
2 JGI25406J46586_10001433 3300003203 Bacteria 11249
3 JGI25406J46586_10062661 3300003203 Bacteria 1194
4 JGI25407J50210_10006655 3300003373 Bacteria 2884
5 Ga0006562J51391_1149020 3300003578 Bacteria 843
6 Ga0006562J51391_1149021 3300003578 Bacteria 540
7 Ga0070658_10741427 3300005327 Bacteria 853
8 Ga0070658_10814886 3300005327 Bacteria 811
9 Ga0070658_11433876 3300005327 Bacteria 599
10 Ga0070683_100037838 3300005329 Bacteria 4418
11 Ga0070683_100591625 3300005329 Bacteria 1062
12 Ga0070670_102143570 3300005331 Bacteria 515
13 Ga0068869_100929078 3300005334 Bacteria 754
14 Ga0070682_100066096 3300005337 Bacteria 2300
15 Ga0070682_100097982 3300005337 Bacteria 1931
16 Ga0068868_100856041 3300005338 Bacteria 824
17 Ga0070660_100335145 3300005339 Bacteria 1244
18 Ga0070660_100812719 3300005339 Bacteria 787
19 Ga0070689_100114650 3300005340 Bacteria 2147
20 Ga0070691_10255127 3300005341 Bacteria 942
21 Ga0070687_101261660 3300005343 Unclassified 547
22 Ga0070661_101124887 3300005344 Bacteria 655
23 Ga0070692_10328301 3300005345 Bacteria 943
24 Ga0070692_10358584 3300005345 Bacteria 908
25 Ga0070668_100016307 3300005347 Bacteria 5556
26 Ga0070668_100227718 3300005347 Bacteria 1540
27 Ga0070668_100552655 3300005347 Bacteria 1002
28 Ga0070669_100274065 3300005353 Bacteria 1350
29 Ga0070675_100670167 3300005354 Bacteria 943
30 Ga0070674_100011194 3300005356 Bacteria 5450
31 Ga0070674_100181166 3300005356 Bacteria 1614
32 Ga0070673_100184860 3300005364 Bacteria 1786
33 Ga0070688_100176303 3300005365 Bacteria 1479
34 Ga0070659_100064596 3300005366 Bacteria 2897
35 Ga0070659_100066151 3300005366 Bacteria 2864
36 Ga0070667_100006798 3300005367 Bacteria 9503
37 Ga0070709_10385256 3300005434 Bacteria 1043
38 Ga0070714_100362115 3300005435 Bacteria 1364
39 Ga0070713_100023695 3300005436 Bacteria 4769
40 Ga0070713_100078833 3300005436 Bacteria 2804
41 Ga0070710_10033155 3300005437 Bacteria 2803
42 Ga0070701_10403664 3300005438 Bacteria 866
43 Ga0070701_10497148 3300005438 Unclassified 791
44 Ga0070701_11043039 3300005438 Bacteria 572
45 Ga0070700_100021958 3300005441 Bacteria 3715
46 Ga0070700_100204794 3300005441 Bacteria 1388
47 Ga0070700_100750438 3300005441 Bacteria 781
48 Ga0070708_100371394 3300005445 Bacteria 1348
49 Ga0070663_100000310 3300005455 Bacteria 25165
50 Ga0070663_100174403 3300005455 Bacteria 1664
51 Ga0070663_101698638 3300005455 Bacteria 564
52 Ga0070678_100076271 3300005456 Bacteria 2525
53 Ga0070678_102075892 3300005456 Bacteria 538
54 Ga0070662_100063774 3300005457 Bacteria 2696
55 Ga0068867_100053534 3300005459 Bacteria 2981
56 Ga0070706_100136278 3300005467 Bacteria 2292
57 Ga0070706_100522365 3300005467 Bacteria 1104
58 Ga0070706_101230545 3300005467 Bacteria 687
59 Ga0070707_100000150 3300005468 Bacteria 67233
60 Ga0070707_100161097 3300005468 Bacteria 2186
61 Ga0070698_100001980 3300005471 Bacteria 22745
62 Ga0070698_100058822 3300005471 Bacteria 3884
63 Ga0070698_100127283 3300005471 Bacteria 2504
64 Ga0070698_100677116 3300005471 Bacteria 973
65 Ga0070699_100067213 3300005518 Bacteria 3112
66 Ga0070699_100285978 3300005518 Bacteria 1477
67 Ga0070699_101669800 3300005518 Bacteria 583
68 Ga0070679_100576805 3300005530 Bacteria 1068
69 Ga0070684_100087988 3300005535 Bacteria 2759
70 Ga0070684_100240650 3300005535 Bacteria 1653
71 Ga0070684_100365747 3300005535 Bacteria 1328
72 Ga0070684_100474513 3300005535 Bacteria 1157
73 Ga0070672_100031433 3300005543 Bacteria 3995
74 Ga0070672_101949889 3300005543 Bacteria 529
75 Ga0070686_100629981 3300005544 Bacteria 848
76 Ga0070686_101208781 3300005544 Bacteria 628
77 Ga0070696_100548416 3300005546 Bacteria 926
78 Ga0070693_101511660 3300005547 Bacteria 525
79 Ga0070665_100080791 3300005548 Bacteria 3257
80 Ga0070665_100488911 3300005548 Bacteria 1242
81 Ga0070704_100458820 3300005549 Bacteria 1099
82 Ga0070664_100051363 3300005564 Bacteria 3491
83 Ga0070664_100725788 3300005564 Bacteria 927
84 Ga0070664_101512762 3300005564 Bacteria 635
85 Ga0068854_100929991 3300005578 Bacteria 766
86 Ga0068856_100138311 3300005614 Bacteria 2442
87 Ga0068852_100306572 3300005616 Bacteria 1538
88 Ga0068852_101632337 3300005616 Bacteria 667
89 Ga0068864_100180830 3300005618 Bacteria 1928
90 Ga0068864_101431654 3300005618 Bacteria 693
91 Ga0068866_10220587 3300005718 Bacteria 1144
92 Ga0068861_100044522 3300005719 Bacteria 3338
93 Ga0068861_100109181 3300005719 Bacteria 2214
94 Ga0068861_101035972 3300005719 Bacteria 785
95 Ga0068861_101408854 3300005719 Bacteria 681
96 Ga0068861_101467282 3300005719 Bacteria 668
97 Ga0068860_100506063 3300005843 Bacteria 1206
98 Ga0068862_100872698 3300005844 Bacteria 883
99 Ga0081455_10035272 3300005937 Bacteria 4473
100 Ga0081455_10053330 3300005937 Bacteria 3454
101 Ga0081455_10055205 3300005937 Bacteria 3380
102 Ga0081455_10120016 3300005937 Bacteria 2073
103 Ga0081455_10142346 3300005937 Bacteria 1860
104 Ga0081455_10166874 3300005937 Bacteria 1681
105 Ga0081538_10000021 3300005981 Bacteria 138488
106 Ga0081538_10000353 3300005981 Bacteria 52501
107 Ga0081538_10057974 3300005981 Bacteria 2250
108 Ga0081538_10091189 3300005981 Bacteria 1574
109 Ga0081538_10091839 3300005981 Bacteria 1566
110 Ga0081538_10094284 3300005981 Bacteria 1533
111 Ga0081538_10146035 3300005981 Bacteria 1081
112 Ga0081540_1043706 3300005983 Bacteria 2295
113 Ga0081539_10002270 3300005985 Bacteria 27882
114 Ga0081539_10006008 3300005985 Bacteria 11927
115 Ga0081539_10033238 3300005985 Bacteria 3145
116 Ga0070717_10160923 3300006028 Bacteria 1947
117 Ga0075365_10042099 3300006038 Bacteria 2985
118 Ga0075363_100193238 3300006048 Bacteria 1161
119 Ga0075364_10024550 3300006051 Bacteria 3830
120 Ga0075364_10132281 3300006051 Bacteria 1675
121 Ga0075364_10598441 3300006051 Bacteria 753
122 Ga0075432_10021722 3300006058 Bacteria 2194
123 Ga0070716_100063407 3300006173 Bacteria 2145
124 Ga0075369_10466967 3300006186 Bacteria 598
125 Ga0075427_10044144 3300006194 Bacteria 757
126 Ga0097621_101734155 3300006237 Bacteria 595
127 Ga0068871_101114387 3300006358 Bacteria 738
128 Ga0075428_100027657 3300006844 Bacteria 6273
129 Ga0075428_100533610 3300006844 Bacteria 1255
130 Ga0075428_100685934 3300006844 Unclassified 1091
131 Ga0075428_102060083 3300006844 Bacteria 591
132 Ga0075430_100003194 3300006846 Bacteria 13728
133 Ga0075430_100047186 3300006846 Bacteria 3637
134 Ga0075430_100346266 3300006846 Bacteria 1227
135 Ga0075430_100811002 3300006846 Bacteria 771
136 Ga0075430_101562207 3300006846 Bacteria 542
137 Ga0075431_100005917 3300006847 Bacteria 12098
138 Ga0075431_100159360 3300006847 Bacteria 2321
139 Ga0075431_100314155 3300006847 Bacteria 1581
140 Ga0075433_10016161 3300006852 Bacteria 6140
141 Ga0075433_10397043 3300006852 Bacteria 1217
142 Ga0075434_100188077 3300006871 Unclassified 2085
143 Ga0075434_100454074 3300006871 Bacteria 1303
144 Ga0075429_100125435 3300006880 Bacteria 2245
145 Ga0075429_100165003 3300006880 Bacteria 1940
146 Ga0075429_100240030 3300006880 Bacteria 1587
147 Ga0068865_100592666 3300006881 Bacteria 936
148 Ga0068865_101132910 3300006881 Bacteria 690
149 Ga0075435_100912823 3300007076 Bacteria 766
150 Ga0111539_10025045 3300009094 Bacteria 7313
151 Ga0111539_10449923 3300009094 Bacteria 1500
152 Ga0111539_11571193 3300009094 Bacteria 763
153 Ga0111539_11589686 3300009094 Bacteria 758
154 Ga0111539_11667775 3300009094 Bacteria 739
155 Ga0111539_11741811 3300009094 Bacteria 722
156 Ga0111539_12000593 3300009094 Bacteria 672
157 Ga0105245_10128194 3300009098 Bacteria 2377
158 Ga0105247_11577100 3300009101 Bacteria 538
159 Ga0114129_10202515 3300009147 Bacteria 2687
160 Ga0114129_10284003 3300009147 Bacteria 2211
161 Ga0114129_10304614 3300009147 Bacteria 2122
162 Ga0114129_10559141 3300009147 Bacteria 1487
163 Ga0114129_10692124 3300009147 Bacteria 1311
164 Ga0114129_10844099 3300009147 Bacteria 1165
165 Ga0105243_10027123 3300009148 Bacteria 4387
166 Ga0105243_10049893 3300009148 Bacteria 3304
167 Ga0105243_10535869 3300009148 Bacteria 1116
168 Ga0105243_13045395 3300009148 Bacteria 508
169 Ga0105248_10153693 3300009177 Bacteria 2596
170 Ga0105248_10294931 3300009177 Bacteria 1826
171 Ga0105248_11502830 3300009177 Bacteria 762
172 Ga0105237_10085990 3300009545 Bacteria 3134
173 Ga0105238_10000248 3300009551 Bacteria 60289
174 Ga0105238_11316716 3300009551 Bacteria 748
175 Ga0105249_10400604 3300009553 Bacteria 1403
176 Ga0105249_10463457 3300009553 Bacteria 1308
177 Ga0105249_12313055 3300009553 Bacteria 610
178 Ga0105239_10568967 3300010375 Bacteria 1291
179 Ga0105239_10975970 3300010375 Bacteria 974
180 Ga0105246_10156181 3300011119 Bacteria 1733
181 Ga0157371_10032288 3300013102 Bacteria 3768
182 Ga0157370_10325470 3300013104 Bacteria 1417
183 Ga0157370_10482816 3300013104 Bacteria 1139
184 Ga0157369_10000393 3300013105 Bacteria 58167
185 Ga0157369_10005654 3300013105 Bacteria 14525
186 Ga0157369_10529178 3300013105 Bacteria 1219
187 Ga0157369_11037339 3300013105 Unclassified 839
188 Ga0157374_10634244 3300013296 Bacteria 1080
189 Ga0157374_11339368 3300013296 Bacteria 738
190 Ga0163162_10080807 3300013306 Bacteria 3320
191 Ga0163162_10201724 3300013306 Bacteria 2118
192 Ga0163162_10261469 3300013306 Bacteria 1862
193 Ga0163162_10551516 3300013306 Bacteria 1281
194 Ga0163162_13231724 3300013306 Bacteria 523
195 Ga0157372_10000034 3300013307 Bacteria 174784
196 Ga0157372_10586926 3300013307 Bacteria 1299
197 Ga0157372_10936721 3300013307 Bacteria 1004
198 Ga0157372_11812149 3300013307 Bacteria 702
199 Ga0157375_10162961 3300013308 Bacteria 2373
200 Ga0157375_10366868 3300013308 Bacteria 1606
201 Ga0157375_10668985 3300013308 Bacteria 1193
202 Ga0157375_10841606 3300013308 Bacteria 1064
203 Ga0157375_11152563 3300013308 Bacteria 908
204 Ga0163163_10792081 3300014325 Bacteria 1011
205 Ga0163163_11766053 3300014325 Bacteria 679
206 Ga0157380_10045675 3300014326 Bacteria 3439
207 Ga0157380_10235508 3300014326 Bacteria 1647
208 Ga0157380_11250606 3300014326 Bacteria 788
209 Ga0157377_10021633 3300014745 Bacteria 3385
210 Ga0157377_10074830 3300014745 Bacteria 1965
211 Ga0157377_10678981 3300014745 Bacteria 745
212 Ga0157376_11024196 3300014969 Bacteria 849
213 Ga0197907_10057455 3300020069 Bacteria 635
214 Ga0206356_10248501 3300020070 Bacteria 2209
215 Ga0206351_10146550 3300020077 Bacteria 874
216 Ga0206352_11312785 3300020078 Bacteria 670
217 Ga0206354_11555507 3300020081 Bacteria 1846
218 Ga0207688_10169842 3300025901 Bacteria 1296
219 Ga0207688_10567349 3300025901 Bacteria 714
220 Ga0207688_10863034 3300025901 Bacteria 573
221 Ga0207647_10137471 3300025904 Bacteria 1433
222 Ga0207643_10044633 3300025908 Bacteria 2502
223 Ga0207643_10575349 3300025908 Bacteria 724
224 Ga0207705_10014201 3300025909 Bacteria 5737
225 Ga0207705_10590216 3300025909 Bacteria 864
226 Ga0207684_10003088 3300025910 Bacteria 16449
227 Ga0207684_10037108 3300025910 Bacteria 4136
228 Ga0207662_11053599 3300025918 Unclassified 578
229 Ga0207657_10212583 3300025919 Bacteria 1552
230 Ga0207657_10627041 3300025919 Bacteria 838
231 Ga0207649_10053522 3300025920 Bacteria 2508
232 Ga0207652_10069339 3300025921 Bacteria 3061
233 Ga0207646_10000096 3300025922 Bacteria 117197
234 Ga0207646_11125941 3300025922 Unclassified 690
235 Ga0207694_10000814 3300025924 Bacteria 27898
236 Ga0207650_10707866 3300025925 Bacteria 851
237 Ga0207659_10676550 3300025926 Bacteria 883
238 Ga0207659_11180183 3300025926 Bacteria 658
239 Ga0207659_11779542 3300025926 Bacteria 524
240 Ga0207687_10205290 3300025927 Bacteria 1543
241 Ga0207700_10037916 3300025928 Bacteria 3495
242 Ga0207664_10105345 3300025929 Bacteria 2337
243 Ga0207664_11444972 3300025929 Unclassified 609
244 Ga0207709_10076390 3300025935 Bacteria 2144
245 Ga0207709_10233447 3300025935 Bacteria 1334
246 Ga0207709_11001418 3300025935 Bacteria 683
247 Ga0207669_10003482 3300025937 Bacteria 6809
248 Ga0207669_10330235 3300025937 Bacteria 1170
249 Ga0207704_10198568 3300025938 Bacteria 1466
250 Ga0207704_10636799 3300025938 Bacteria 877
251 Ga0207691_10055564 3300025940 Bacteria 3607
252 Ga0207691_10418588 3300025940 Bacteria 1142
253 Ga0207691_11255812 3300025940 Bacteria 613
254 Ga0207711_10395398 3300025941 Bacteria 1284
255 Ga0207689_10874868 3300025942 Bacteria 758
256 Ga0207689_11539452 3300025942 Bacteria 555
257 Ga0207661_10009084 3300025944 Bacteria 7122
258 Ga0207661_10142371 3300025944 Bacteria 2065
259 Ga0207661_10201566 3300025944 Bacteria 1750
260 Ga0207661_10290660 3300025944 Bacteria 1463
261 Ga0207661_10421951 3300025944 Bacteria 1212
262 Ga0207679_10615263 3300025945 Bacteria 980
263 Ga0207667_10097975 3300025949 Bacteria 3026
264 Ga0207651_10263670 3300025960 Bacteria 1416
265 Ga0207712_10229545 3300025961 Bacteria 1489
266 Ga0207712_10948571 3300025961 Bacteria 762
267 Ga0207668_10131176 3300025972 Bacteria 1914
268 Ga0207668_10144749 3300025972 Bacteria 1832
269 Ga0207668_10259329 3300025972 Bacteria 1416
270 Ga0207668_10292032 3300025972 Bacteria 1342
271 Ga0207640_10187648 3300025981 Bacteria 1556
272 Ga0207677_11228368 3300026023 Bacteria 687
273 Ga0207703_12427624 3300026035 Bacteria 500
274 Ga0207678_10011687 3300026067 Bacteria 7708
275 Ga0207678_10226404 3300026067 Bacteria 1601
276 Ga0207708_10041438 3300026075 Bacteria 3511
277 Ga0207708_10193789 3300026075 Bacteria 1619
278 Ga0207708_10254252 3300026075 Bacteria 1417
279 Ga0207702_10310155 3300026078 Bacteria 1500
280 Ga0207676_11406932 3300026095 Bacteria 693
281 Ga0207674_10200596 3300026116 Bacteria 1944
282 Ga0207675_100065615 3300026118 Bacteria 3393
283 Ga0207675_100072031 3300026118 Bacteria 3231
284 Ga0207675_100341587 3300026118 Bacteria 1466
285 Ga0207675_101963430 3300026118 Bacteria 603
286 Ga0207683_10178714 3300026121 Bacteria 1924
287 Ga0207683_10576945 3300026121 Bacteria 1040
288 Ga0207683_10742838 3300026121 Bacteria 910
289 Ga0207698_10444275 3300026142 Bacteria 1250
290 Ga0207698_12490993 3300026142 Bacteria 528
291 Ga0209974_10317046 3300027876 Bacteria 599
292 Ga0207428_10045877 3300027907 Bacteria 3517
293 Ga0207428_10264939 3300027907 Bacteria 1279
294 Ga0268266_10211279 3300028379 Bacteria 1780
295 Ga0268266_10272209 3300028379 Bacteria 1572
296 Ga0268264_10380543 3300028381 Bacteria 1351
297 Ga0307408_100080031 3300031548 Bacteria 2440
298 Ga0307508_10405683 3300031616 Bacteria 954
299 Ga0307405_10037357 3300031731 Bacteria 2918
300 Ga0307405_10167849 3300031731 Bacteria 1562
301 Ga0307405_10274059 3300031731 Bacteria 1267
302 Ga0307405_10562399 3300031731 Bacteria 925
303 Ga0307413_10181759 3300031824 Bacteria 1500
304 Ga0307413_10219847 3300031824 Bacteria 1387
305 Ga0307410_10817600 3300031852 Bacteria 794
306 Ga0307410_11645206 3300031852 Bacteria 568
307 Ga0307406_10000435 3300031901 Bacteria 24366
308 Ga0307406_10168389 3300031901 Bacteria 1583
309 Ga0307406_10189728 3300031901 Bacteria 1503
310 Ga0307406_10247389 3300031901 Bacteria 1341
311 Ga0307406_10386652 3300031901 Bacteria 1105
312 Ga0307406_11943253 3300031901 Bacteria 525
313 Ga0307407_10221237 3300031903 Bacteria 1280
314 Ga0307407_10351992 3300031903 Bacteria 1043
315 Ga0307412_11112290 3300031911 Bacteria 704
316 Ga0307412_11440727 3300031911 Bacteria 624
317 Ga0307409_100027473 3300031995 Bacteria 4034
318 Ga0307409_100035148 3300031995 Bacteria 3668
319 Ga0307409_100131689 3300031995 Bacteria 2138
320 Ga0307409_100345924 3300031995 Bacteria 1401
321 Ga0307409_100758537 3300031995 Bacteria 975
322 Ga0307409_101183705 3300031995 Bacteria 787
323 Ga0307416_100034612 3300032002 Bacteria 3846
324 Ga0307416_100257621 3300032002 Bacteria 1703
325 Ga0307416_100422906 3300032002 Bacteria 1377
326 Ga0307416_100463950 3300032002 Bacteria 1322
327 Ga0307416_100612889 3300032002 Bacteria 1170
328 Ga0307416_100783551 3300032002 Bacteria 1048
329 Ga0307416_101463507 3300032002 Bacteria 789
330 Ga0307416_102248474 3300032002 Bacteria 646
331 Ga0307414_10138243 3300032004 Bacteria 1903
332 Ga0307414_10235890 3300032004 Bacteria 1511
333 Ga0307414_12159143 3300032004 Bacteria 520
334 Ga0307411_10274266 3300032005 Bacteria 1339
335 Ga0307411_10835040 3300032005 Bacteria 814
336 Ga0307411_11604080 3300032005 Bacteria 600
337 Ga0307415_100004962 3300032126 Bacteria 7001
338 Ga0307415_100016891 3300032126 Bacteria 4363
339 Ga0307415_100215673 3300032126 Bacteria 1535
340 Ga0307415_100366872 3300032126 Bacteria 1218
341 Ga0307415_100501880 3300032126 Bacteria 1061
342 Ga0307415_100697659 3300032126 Bacteria 915
343 Ga0307415_100742041 3300032126 Bacteria 890
344 Ga0307415_101316278 3300032126 Bacteria 685
345 Ga0373956_0016532 3300035119 Bacteria 3100
346 Ga0373955_0007506 3300035172 Bacteria 5015
347 Ga0373933_0050302 3300035724 Bacteria 2487
348 Ga0373937_0024203 3300036401 Bacteria 5474
349 Ga0373925_0006813 3300037068 Bacteria 8366
350 Ga0373925_0023114 3300037068 Bacteria 4536
351 Ga0395899_0000182 3300037312 Bacteria 92470
352 Ga0395899_0028975 3300037312 Bacteria 4165
353 Ga0395899_0195150 3300037312 Bacteria 1415
354 Ga0395900_0017479 3300037418 Bacteria 7320
355 Ga0395900_0058297 3300037418 Bacteria 3975
356 Ga0395900_0144161 3300037418 Bacteria 2437
357 Ga0395900_0244373 3300037418 Bacteria 1799
358 Ga0395900_0357575 3300037418 Bacteria 1432
359 Ga0395900_0369486 3300037418 Bacteria 1404
360 Ga0395900_0551491 3300037418 Bacteria 1097
361 Ga0395900_1445838 3300037418 Bacteria 600
362 Ga0395898_0048071 3300037466 Bacteria 4185
363 Ga0395898_0059776 3300037466 Bacteria 3706
364 Ga0395898_0078126 3300037466 Bacteria 3194
365 Ga0395898_0251090 3300037466 Bacteria 1687
366 Ga0395898_0288290 3300037466 Bacteria 1566
367 Ga0395898_0372506 3300037466 Bacteria 1362
368 Ga0395898_0748088 3300037466 Bacteria 919
369 Ga0395898_1137370 3300037466 Bacteria 713
370 Ga0395898_1635104 3300037466 Bacteria 568
371 Ga0395905_0031454 3300037471 Bacteria 4997
372 Ga0395905_0078883 3300037471 Bacteria 3086
373 Ga0395905_0458884 3300037471 Bacteria 1172
374 Ga0395905_0632932 3300037471 Bacteria 972
375 Ga0395905_1005070 3300037471 Bacteria 737
376 Ga0395905_1192430 3300037471 Bacteria 665
377 Ga0395905_1222968 3300037471 Bacteria 655
378 Ga0436364_0957520 3300037853 Bacteria 4465
379 Ga0395901_0020985 3300038443 Bacteria 6692
380 Ga0395901_0038248 3300038443 Bacteria 4963
381 Ga0395901_0050343 3300038443 Bacteria 4329
382 Ga0395901_0080880 3300038443 Bacteria 3393
383 Ga0395901_0204838 3300038443 Bacteria 2067
384 Ga0395901_0371480 3300038443 Bacteria 1473
385 Ga0395901_0405133 3300038443 Bacteria 1401
386 Ga0395901_0428047 3300038443 Bacteria 1356
387 Ga0395901_0494412 3300038443 Bacteria 1246
388 Ga0395901_0797420 3300038443 Bacteria 934
389 Ga0439453_0002006 3300041408 Bacteria 2738
390 Ga0439465_0090612 3300041413 Bacteria 1046
391 Ga0451802_0922775 3300041460 Bacteria 700
392 Ga0451845_0928093 3300041501 Bacteria 767
393 Ga0451843_1210050 3300041509 Unclassified 690
394 Ga0451853_0368024 3300041512 Bacteria 645
395 Ga0451853_1546664 3300041512 Unclassified 802
396 Ga0451853_3985726 3300041512 Bacteria 680
397 Ga0439449_0155469 3300042007 Bacteria 853
398 Ga0439449_0160627 3300042007 Bacteria 839
399 Ga0439451_013023 3300042009 Bacteria 1680
400 Ga0439451_117251 3300042009 Bacteria 541
401 Ga0439454_000186 3300042011 Bacteria 4346
402 Ga0439456_047142 3300042013 Bacteria 939
403 Ga0439435_0104773 3300042436 Bacteria 873
404 Ga0439464_0053624 3300042439 Bacteria 1170
405 Ga0466966_0011419 3300044684 Bacteria 5891
406 Ga0466961_0304093 3300044693 Bacteria 974
407 Ga0466970_0068293 3300044765 Bacteria 1910
408 Ga0466970_0130148 3300044765 Bacteria 1382
409 Ga0466960_0019661 3300044901 Bacteria 2979
410 Ga0466960_0283302 3300044901 Bacteria 929
411 Ga0495627_000603 3300046453 Bacteria 28682
412 Ga0495603_0048547 3300046455 Bacteria 2528
413 Ga0495629_0438455 3300046459 Bacteria 885
414 Ga0495629_0506098 3300046459 Bacteria 814
415 Ga0495638_0135607 3300046460 Bacteria 1442
416 Ga0495641_0072140 3300046461 Bacteria 1550
417 Ga0495651_0001161 3300046462 Bacteria 20345
418 Ga0495653_0059664 3300046463 Bacteria 2894
419 Ga0495653_0260712 3300046463 Bacteria 1146
420 Ga0495582_0260151 3300046473 Bacteria 996
421 Ga0495662_0197737 3300046476 Bacteria 991
422 Ga0495664_0105564 3300046477 Bacteria 1698
423 Ga0495608_0000210 3300046511 Bacteria 42105
424 Ga0495608_0296677 3300046511 Bacteria 1001
425 Ga0495618_0029610 3300046514 Bacteria 3416
426 Ga0495628_0037958 3300046516 Bacteria 3859
427 Ga0495628_0301762 3300046516 Bacteria 1185
428 Ga0495630_0002090 3300046517 Bacteria 13893
429 Ga0495652_0014485 3300046529 Bacteria 7077
430 Ga0495652_0116652 3300046529 Bacteria 2137
431 Ga0495640_0035580 3300046533 Bacteria 3524
432 Ga0495587_0020463 3300046536 Bacteria 4084
433 Ga0495645_0007961 3300046543 Bacteria 7377
434 Ga0495645_0120740 3300046543 Bacteria 1845
435 Ga0495633_0000152 3300046558 Bacteria 91044
436 Ga0495667_0013576 3300046559 Bacteria 5509
437 Ga0495656_0199118 3300046615 Bacteria 993
438 Ga0495634_0096424 3300046642 Bacteria 1915
439 Ga0495635_0020024 3300046663 Bacteria 4662
440 Ga0495635_0302855 3300046663 Bacteria 1071
441 Ga0495657_0013341 3300046675 Bacteria 6068
442 Ga0495657_0021162 3300046675 Bacteria 4668
443 Ga0495599_0102357 3300046678 Bacteria 1785
444 Ga0495623_0077114 3300046679 Bacteria 2067
445 Ga0495658_0655560 3300046683 Bacteria 672
446 Ga0495613_0829293 3300046689 Bacteria 602
447 Ga0495624_0780866 3300046690 Bacteria 565
448 Ga0495671_0326414 3300046692 Bacteria 737
449 Ga0495600_0022163 3300046809 Bacteria 4076
450 Ga0495581_0467842 3300047315 Bacteria 734
451 Ga0495581_0787833 3300047315 Bacteria 546
452 Ga0495604_0008487 3300047317 Bacteria 8109
453 Ga0495674_0008894 3300047319 Bacteria 9550
454 Ga0495672_0101106 3300047320 Bacteria 1563
455 Ga0495676_0328206 3300047321 Bacteria 1027
456 Ga0495680_0039625 3300047322 Bacteria 3756
457 Ga0495680_0970743 3300047322 Bacteria 545
458 Ga0495675_0017229 3300047444 Bacteria 4577
459 Ga0495684_0024249 3300047471 Bacteria 4669
460 Ga0495593_0321630 3300047673 Bacteria 773
461 Ga0495593_0451962 3300047673 Bacteria 643
462 Ga0495602_0088890 3300048088 Bacteria 2570
463 Ga0496100_0020159 3300048903 Bacteria 3993
464 Ga0496100_0611816 3300048903 Bacteria 847
465 Ga0496101_0377369 3300048904 Bacteria 1115
466 Ga0496102_0805644 3300048905 Bacteria 861
467 Ga0496103_0412726 3300048906 Bacteria 867
468 Ga0496103_0452843 3300048906 Bacteria 823
469 Ga0496103_0475670 3300048906 Bacteria 800
470 Ga0496103_0651391 3300048906 Bacteria 669
471 Ga0496103_0904591 3300048906 Bacteria 553
472 Ga0496104_0015898 3300048907 Bacteria 6829
473 Ga0496104_0035111 3300048907 Bacteria 4680
474 Ga0496104_0168127 3300048907 Bacteria 2103
475 Ga0496104_0736053 3300048907 Bacteria 893
476 Ga0496104_1348758 3300048907 Bacteria 616
477 Ga0496105_0035087 3300048908 Bacteria 4127
478 Ga0496105_0354302 3300048908 Bacteria 1172
479 Ga0496105_0459905 3300048908 Bacteria 1003
480 Ga0496108_0022189 3300048911 Bacteria 5219
481 Ga0496108_0062707 3300048911 Bacteria 3130
482 Ga0496108_0161956 3300048911 Bacteria 1934
483 Ga0496108_0236129 3300048911 Bacteria 1590
484 Ga0496109_0405811 3300048912 Bacteria 1287
485 Ga0496109_0759482 3300048912 Bacteria 907
486 Ga0496110_0186345 3300048913 Bacteria 1884
487 Ga0496110_0342490 3300048913 Bacteria 1362
488 Ga0496110_1084857 3300048913 Bacteria 709
489 Ga0496111_0221141 3300048914 Bacteria 1407
490 Ga0496111_0624328 3300048914 Bacteria 788
491 Ga0496112_0046725 3300048915 Bacteria 4247
492 Ga0496113_0029530 3300048916 Bacteria 3961
493 Ga0496113_0068239 3300048916 Bacteria 2698
494 Ga0496113_0407548 3300048916 Bacteria 1092
495 Ga0496114_0028131 3300048917 Bacteria 4610
496 Ga0496114_0243841 3300048917 Bacteria 1580
497 Ga0496114_1528997 3300048917 Bacteria 555
498 Ga0496117_0432116 3300048920 Bacteria 656
499 Ga0496119_0209430 3300048922 Bacteria 1004
500 Ga0496121_0000462 3300048924 Bacteria 79882
501 Ga0496126_0015392 3300048929 Bacteria 7695
502 Ga0501307_058698 3300049162 Bacteria 593
503 Ga0501031_0296984 3300049568 Bacteria 1047
504 Ga0501031_0420405 3300049568 Bacteria 864
505 Ga0501031_0710353 3300049568 Bacteria 645
506 Ga0501034_0588578 3300049571 Bacteria 1019
507 Ga0501034_1568310 3300049571 Bacteria 532
508 Ga0501036_0297305 3300049572 Bacteria 1350
509 Ga0501036_1646473 3300049572 Bacteria 518
510 Ga0501037_0566058 3300049573 Bacteria 766
511 Ga0501038_0142536 3300049574 Bacteria 1959
512 Ga0501038_1086101 3300049574 Unclassified 585
513 Ga0501039_0396788 3300049575 Bacteria 1083
514 Ga0501039_0739362 3300049575 Bacteria 768
515 Ga0501040_0565936 3300049576 Bacteria 820
516 Ga0501040_0606556 3300049576 Bacteria 791
517 Ga0501040_0848427 3300049576 Bacteria 661
518 Ga0501041_0044889 3300049577 Bacteria 2686
519 Ga0501041_0071147 3300049577 Bacteria 2136
520 Ga0501041_0550568 3300049577 Bacteria 735
521 Ga0501041_0680642 3300049577 Bacteria 658
522 Ga0501041_0989382 3300049577 Bacteria 541
523 Ga0501042_0199104 3300049578 Bacteria 1444
524 Ga0501042_0267056 3300049578 Bacteria 1235
525 Ga0501042_0347525 3300049578 Bacteria 1073
526 Ga0501042_0492756 3300049578 Bacteria 890
527 Ga0501042_0756172 3300049578 Bacteria 707
528 Ga0501043_0517424 3300049579 Bacteria 890
529 Ga0501047_0101404 3300049581 Bacteria 2758
530 Ga0501048_0148319 3300049582 Bacteria 1659
531 Ga0501068_0035720 3300049584 Bacteria 2968
532 Ga0501068_0327789 3300049584 Bacteria 982
533 Ga0501069_0099433 3300049585 Bacteria 1651
534 Ga0501070_0811490 3300049586 Bacteria 734
535 Ga0501071_0011845 3300049587 Bacteria 5887
536 Ga0501071_0120043 3300049587 Bacteria 1948
537 Ga0501071_0410919 3300049587 Bacteria 1034
538 Ga0501071_0483863 3300049587 Bacteria 949
539 Ga0501071_0606729 3300049587 Bacteria 841
540 Ga0501072_0125927 3300049588 Bacteria 2041
541 Ga0501072_0297506 3300049588 Bacteria 1283
542 Ga0501073_0444559 3300049589 Unclassified 896
543 Ga0501074_0463661 3300049590 Unclassified 898
544 Ga0501075_0021801 3300049591 Bacteria 4673
545 Ga0501075_0705498 3300049591 Unclassified 768
546 Ga0501076_0179595 3300049592 Bacteria 1725
547 Ga0501076_0344961 3300049592 Bacteria 1223
548 Ga0501076_0353632 3300049592 Bacteria 1206
549 Ga0501076_0855024 3300049592 Bacteria 750
550 Ga0501077_0018980 3300049593 Bacteria 4349
551 Ga0501079_0330131 3300049741 Bacteria 1194
552 Ga0501079_0716485 3300049741 Bacteria 787
553 Ga0501080_1205756 3300049742 Bacteria 650
554 Ga0501081_0021500 3300049743 Bacteria 4307
555 Ga0501081_0439306 3300049743 Unclassified 968
556 Ga0501035_0254346 3300049822 Bacteria 1491
557 Ga0501035_0650122 3300049822 Bacteria 855
558 Ga0501045_0011979 3300049824 Bacteria 6097
559 Ga0501045_0244253 3300049824 Bacteria 1336
560 Ga0501045_0572005 3300049824 Unclassified 837
561 Ga0501045_0649522 3300049824 Bacteria 780
562 Ga0501045_0704459 3300049824 Bacteria 745
563 nmdc:mga03n38_175691_c1 3300050490 Bacteria 1094
564 nmdc:mga00v17_13648_c1 3300050491 Bacteria 4515
565 nmdc:mga00v17_16713_c1 3300050491 Bacteria 4138
566 nmdc:mga00v17_507672_c1 3300050491 Bacteria 781
567 nmdc:mga0yw44_701669_c1 3300050492 Bacteria 687
568 nmdc:mga0yw44_977211_c1 3300050492 Bacteria 573
569 nmdc:mga0yw44_98229_c1 3300050492 Bacteria 1861
570 nmdc:mga05p37_1338829_c1 3300050507 Bacteria 726
571 nmdc:mga05p37_284785_c1 3300050507 Bacteria 1969
572 nmdc:mga05p37_288096_c1 3300050507 Bacteria 1955
573 nmdc:mga05p37_4409_c1 3300050507 Bacteria 16450
574 nmdc:mga05p37_673757_c2 3300050507 Bacteria 820
575 nmdc:mga09592_299529_c1 3300050508 Bacteria 1394
576 nmdc:mga09592_6114_c1 3300050508 Bacteria 9808
577 nmdc:mga0qj67_200048_c1 3300050509 Bacteria 1623
578 nmdc:mga0qj67_294038_c1 3300050509 Bacteria 1316
579 nmdc:mga0qj67_3676_c1 3300050509 Bacteria 11072
580 nmdc:mga06r32_1061508_c1 3300050510 Unclassified 760
581 nmdc:mga06r32_107673_c1 3300050510 Bacteria 2739
582 nmdc:mga06r32_352789_c1 3300050510 Bacteria 1455
583 nmdc:mga06r32_56331_c1 3300050510 Bacteria 3774
584 nmdc:mga08y16_161196_c1 3300050511 Bacteria 2331
585 nmdc:mga08y16_53056_c1 3300050511 Bacteria 4241
586 nmdc:mga0n895_298253_c1 3300050512 Bacteria 1634
587 nmdc:mga0rr50_1187936_c1 3300050513 Unclassified 648
588 nmdc:mga0rr50_1862274_c1 3300050513 Bacteria 506
589 nmdc:mga0a205_21405_c1 3300050515 Bacteria 6118
590 nmdc:mga0a205_621920_c1 3300050515 Bacteria 932
591 nmdc:mga0sz30_421898_c1 3300050516 Bacteria 598
592 nmdc:mga0sz30_543392_c1 3300050516 Bacteria 524
593 Ga0495601_0008295 3300053077 Bacteria 6132
594 Ga0495601_0059717 3300053077 Bacteria 2419
595 Ga0495612_0081715 3300053078 Bacteria 1358
596 Ga0495612_0121432 3300053078 Bacteria 1124
597 Ga0495595_0013826 3300053084 Bacteria 3416
598 Ga0495619_0108417 3300053085 Bacteria 1895
599 Ga0495619_0255250 3300053085 Bacteria 1215
600 Ga0500651_0190842 3300053093 Unclassified 1213
601 Ga0500616_0029799 3300053153 Bacteria 3000
602 Ga0501084_0054419 3300054114 Bacteria 3348
603 Ga0501084_0213264 3300054114 Bacteria 1629
604 Ga0501084_0714460 3300054114 Bacteria 845
605 Ga0501084_1475821 3300054114 Bacteria 569
606 Ga0501084_1507178 3300054114 Bacteria 563
607 Ga0501082_0706982 3300060353 Bacteria 882
608 Ga0530510_0006116 3300061734 Bacteria 8358
609 Ga0530510_0696241 3300061734 Bacteria 774
610 Ga0530510_0904226 3300061734 Bacteria 675
611 Ga0530510_1234812 3300061734 Bacteria 573

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006038 Ga0075365_10042099 Ga0075365_100420994 113
2 3300006051 Ga0075364_10132281 Ga0075364_101322811 113
3 3300050491 nmdc:mga00v17_16713_c1 nmdc:mga00v17_16713_c1_1200_1589 113
4 3300050492 nmdc:mga0yw44_98229_c1 nmdc:mga0yw44_98229_c1_531_920 113
5 3300041460 Ga0451802_0922775 Ga0451802_0922775_303_650 114
6 iso_pu_bacteria 2904765812 2904768799 116
7 iso_pu_bacteria 2904770941 2904771911 116
8 iso_pu_bacteria 2908811453 2908812864 116
9 iso_pu_bacteria 2919420072 2919422160 116
10 iso_pu_bacteria 2919432681 2919434282 116
11 iso_pu_bacteria 2862382967 2862390206 118
12 iso_pu_bacteria 2863404153 2863411052 118
13 3300038443 Ga0395901_0797420 Ga0395901_0797420_549_917 119
14 iso_pu_bacteria 2947224130 2947232207 119
15 iso_pu_bacteria 3006486233 3006492786 119
16 iso_pu_bacteria 8004025490 8004027063 119
17 3300005471 Ga0070698_100127283 Ga0070698_1001272832 120
18 3300005518 Ga0070699_100067213 Ga0070699_1000672133 120
19 3300005937 Ga0081455_10035272 Ga0081455_100352727 120
20 3300005937 Ga0081455_10142346 Ga0081455_101423462 120
21 3300037466 Ga0395898_0748088 Ga0395898_0748088_239_625 120
22 3300037466 Ga0395898_1137370 Ga0395898_1137370_240_626 120
23 3300038443 Ga0395901_0494412 Ga0395901_0494412_536_922 120
24 3300041501 Ga0451845_0928093 Ga0451845_0928093_188_604 120
25 iso_pu_bacteria 2675903059 2676481495 120
26 iso_pu_bacteria 2884693830 2884694098 120
27 iso_pu_bacteria 2895442618 2895444557 120
28 iso_pu_bacteria 2919446982 2919450063 120
29 3300003203 JGI25406J46586_10001433 JGI25406J46586_100014337 121
30 3300005367 Ga0070667_100006798 Ga0070667_1000067983 121
31 3300005467 Ga0070706_100136278 Ga0070706_1001362783 121
32 3300005468 Ga0070707_100000150 Ga0070707_10000015072 121
33 3300005471 Ga0070698_100001980 Ga0070698_10000198029 121
34 3300005985 Ga0081539_10006008 Ga0081539_100060087 121
35 3300006028 Ga0070717_10160923 Ga0070717_101609232 121
36 3300025910 Ga0207684_10003088 Ga0207684_100030888 121
37 3300025922 Ga0207646_10000096 Ga0207646_1000009673 121
38 3300031901 Ga0307406_11943253 Ga0307406_119432531 121
39 3300031903 Ga0307407_10351992 Ga0307407_103519922 121
40 3300031995 Ga0307409_100131689 Ga0307409_1001316894 121
41 3300031995 Ga0307409_101183705 Ga0307409_1011837052 121
42 3300032002 Ga0307416_100257621 Ga0307416_1002576213 121
43 3300032004 Ga0307414_12159143 Ga0307414_121591431 121
44 3300032005 Ga0307411_11604080 Ga0307411_116040801 121
45 3300032126 Ga0307415_100366872 Ga0307415_1003668721 121
46 3300037418 Ga0395900_0244373 Ga0395900_0244373_761_1153 121
47 3300037466 Ga0395898_0288290 Ga0395898_0288290_220_612 121
48 3300037471 Ga0395905_0632932 Ga0395905_0632932_455_847 121
49 3300038443 Ga0395901_0405133 Ga0395901_0405133_256_645 121
50 3300046460 Ga0495638_0135607 Ga0495638_0135607_609_974 121
51 3300046690 Ga0495624_0780866 Ga0495624_0780866_109_495 121
52 3300047315 Ga0495581_0467842 Ga0495581_0467842_72_437 121
53 3300050492 nmdc:mga0yw44_701669_c1 nmdc:mga0yw44_701669_c1_125_490 121
54 3300053078 Ga0495612_0121432 Ga0495612_0121432_348_713 121
55 3300053085 Ga0495619_0108417 Ga0495619_0108417_957_1322 121
56 3300053153 Ga0500616_0029799 Ga0500616_0029799_1679_2044 121
57 iso_pu_bacteria 2946080515 2946082895 121
58 3300005544 Ga0070686_100629981 Ga0070686_1006299811 122
59 3300005844 Ga0068862_100872698 Ga0068862_1008726982 122
60 3300005937 Ga0081455_10166874 Ga0081455_101668742 122
61 3300005981 Ga0081538_10091189 Ga0081538_100911893 122
62 3300005981 Ga0081538_10091839 Ga0081538_100918393 122
63 3300005983 Ga0081540_1043706 Ga0081540_10437063 122
64 3300006051 Ga0075364_10598441 Ga0075364_105984412 122
65 3300006058 Ga0075432_10021722 Ga0075432_100217223 122
66 3300006194 Ga0075427_10044144 Ga0075427_100441442 122
67 3300006846 Ga0075430_100003194 Ga0075430_1000031945 122
68 3300006846 Ga0075430_100346266 Ga0075430_1003462662 122
69 3300006847 Ga0075431_100005917 Ga0075431_10000591710 122
70 3300006852 Ga0075433_10016161 Ga0075433_100161613 122
71 3300006871 Ga0075434_100454074 Ga0075434_1004540743 122
72 3300006880 Ga0075429_100165003 Ga0075429_1001650033 122
73 3300007076 Ga0075435_100912823 Ga0075435_1009128232 122
74 3300009094 Ga0111539_10025045 Ga0111539_100250455 122
75 3300009094 Ga0111539_11667775 Ga0111539_116677751 122
76 3300009147 Ga0114129_10304614 Ga0114129_103046142 122
77 3300009551 Ga0105238_10000248 Ga0105238_1000024832 122
78 3300025901 Ga0207688_10169842 Ga0207688_101698422 122
79 3300025924 Ga0207694_10000814 Ga0207694_100008141 122
80 3300027907 Ga0207428_10045877 Ga0207428_100458772 122
81 3300031548 Ga0307408_100080031 Ga0307408_1000800313 122
82 3300031731 Ga0307405_10037357 Ga0307405_100373574 122
83 3300031731 Ga0307405_10274059 Ga0307405_102740592 122
84 3300031852 Ga0307410_10817600 Ga0307410_108176002 122
85 3300031901 Ga0307406_10168389 Ga0307406_101683891 122
86 3300031901 Ga0307406_10247389 Ga0307406_102473892 122
87 3300031903 Ga0307407_10221237 Ga0307407_102212372 122
88 3300031911 Ga0307412_11440727 Ga0307412_114407271 122
89 3300031995 Ga0307409_100035148 Ga0307409_1000351482 122
90 3300032002 Ga0307416_100034612 Ga0307416_1000346124 122
91 3300032002 Ga0307416_101463507 Ga0307416_1014635072 122
92 3300032004 Ga0307414_10138243 Ga0307414_101382433 122
93 3300032005 Ga0307411_10835040 Ga0307411_108350401 122
94 3300032126 Ga0307415_100004962 Ga0307415_1000049628 122
95 3300032126 Ga0307415_100016891 Ga0307415_1000168914 122
96 3300032126 Ga0307415_101316278 Ga0307415_1013162782 122
97 3300037312 Ga0395899_0028975 Ga0395899_0028975_1602_1970 122
98 3300037312 Ga0395899_0195150 Ga0395899_0195150_486_854 122
99 3300037418 Ga0395900_0017479 Ga0395900_0017479_3611_3979 122
100 3300037418 Ga0395900_0058297 Ga0395900_0058297_1467_1835 122
101 3300037418 Ga0395900_0357575 Ga0395900_0357575_744_1118 122
102 3300037418 Ga0395900_0369486 Ga0395900_0369486_225_593 122
103 3300037466 Ga0395898_0048071 Ga0395898_0048071_675_1043 122
104 3300037466 Ga0395898_0059776 Ga0395898_0059776_697_1065 122
105 3300037466 Ga0395898_0078126 Ga0395898_0078126_1716_2084 122
106 3300037466 Ga0395898_0251090 Ga0395898_0251090_943_1317 122
107 3300037466 Ga0395898_1635104 Ga0395898_1635104_124_492 122
108 3300037471 Ga0395905_0031454 Ga0395905_0031454_244_612 122
109 3300037471 Ga0395905_0078883 Ga0395905_0078883_2347_2715 122
110 3300037471 Ga0395905_0458884 Ga0395905_0458884_283_651 122
111 3300037471 Ga0395905_1192430 Ga0395905_1192430_281_649 122
112 3300038443 Ga0395901_0020985 Ga0395901_0020985_3729_4097 122
113 3300038443 Ga0395901_0038248 Ga0395901_0038248_3871_4239 122
114 3300038443 Ga0395901_0050343 Ga0395901_0050343_3920_4288 122
115 3300042007 Ga0439449_0160627 Ga0439449_0160627_427_795 122
116 3300044765 Ga0466970_0130148 Ga0466970_0130148_929_1297 122
117 3300046615 Ga0495656_0199118 Ga0495656_0199118_228_602 122
118 3300049568 Ga0501031_0710353 Ga0501031_0710353_103_477 122
119 3300049574 Ga0501038_1086101 Ga0501038_1086101_165_536 122
120 3300049577 Ga0501041_0680642 Ga0501041_0680642_142_513 122
121 3300049578 Ga0501042_0756172 Ga0501042_0756172_110_484 122
122 3300049587 Ga0501071_0410919 Ga0501071_0410919_70_444 122
123 3300049587 Ga0501071_0483863 Ga0501071_0483863_340_711 122
124 3300049588 Ga0501072_0297506 Ga0501072_0297506_394_810 122
125 3300049822 Ga0501035_0650122 Ga0501035_0650122_456_830 122
126 3300049824 Ga0501045_0649522 Ga0501045_0649522_340_708 122
127 3300049824 Ga0501045_0704459 Ga0501045_0704459_312_683 122
128 3300050491 nmdc:mga00v17_507672_c1 nmdc:mga00v17_507672_c1_219_620 122
129 3300050507 nmdc:mga05p37_4409_c1 nmdc:mga05p37_4409_c1_11732_12100 122
130 3300050508 nmdc:mga09592_6114_c1 nmdc:mga09592_6114_c1_1913_2281 122
131 3300050509 nmdc:mga0qj67_3676_c1 nmdc:mga0qj67_3676_c1_10443_10811 122
132 3300050510 nmdc:mga06r32_56331_c1 nmdc:mga06r32_56331_c1_828_1196 122
133 3300050511 nmdc:mga08y16_161196_c1 nmdc:mga08y16_161196_c1_343_711 122
134 3300050512 nmdc:mga0n895_298253_c1 nmdc:mga0n895_298253_c1_415_783 122
135 3300050513 nmdc:mga0rr50_1862274_c1 nmdc:mga0rr50_1862274_c1_112_480 122
136 3300050515 nmdc:mga0a205_21405_c1 nmdc:mga0a205_21405_c1_4233_4601 122
137 3300054114 Ga0501084_1475821 Ga0501084_1475821_87_503 122
138 3300061734 Ga0530510_1234812 Ga0530510_1234812_38_406 122
139 iso_pu_bacteria 2643221711 2644608278 122
140 3300005329 Ga0070683_100037838 Ga0070683_1000378382 123
141 3300005337 Ga0070682_100097982 Ga0070682_1000979822 123
142 3300005339 Ga0070660_100335145 Ga0070660_1003351453 123
143 3300005341 Ga0070691_10255127 Ga0070691_102551271 123
144 3300005343 Ga0070687_101261660 Ga0070687_1012616602 123
145 3300005345 Ga0070692_10358584 Ga0070692_103585842 123
146 3300005347 Ga0070668_100552655 Ga0070668_1005526552 123
147 3300005353 Ga0070669_100274065 Ga0070669_1002740653 123
148 3300005354 Ga0070675_100670167 Ga0070675_1006701672 123
149 3300005365 Ga0070688_100176303 Ga0070688_1001763032 123
150 3300005366 Ga0070659_100066151 Ga0070659_1000661513 123
151 3300005435 Ga0070714_100362115 Ga0070714_1003621152 123
152 3300005436 Ga0070713_100078833 Ga0070713_1000788333 123
153 3300005437 Ga0070710_10033155 Ga0070710_100331551 123
154 3300005438 Ga0070701_10403664 Ga0070701_104036642 123
155 3300005438 Ga0070701_10497148 Ga0070701_104971481 123
156 3300005441 Ga0070700_100021958 Ga0070700_1000219586 123
157 3300005441 Ga0070700_100204794 Ga0070700_1002047942 123
158 3300005441 Ga0070700_100750438 Ga0070700_1007504382 123
159 3300005455 Ga0070663_101698638 Ga0070663_1016986381 123
160 3300005456 Ga0070678_102075892 Ga0070678_1020758921 123
161 3300005457 Ga0070662_100063774 Ga0070662_1000637744 123
162 3300005459 Ga0068867_100053534 Ga0068867_1000535341 123
163 3300005530 Ga0070679_100576805 Ga0070679_1005768052 123
164 3300005535 Ga0070684_100240650 Ga0070684_1002406502 123
165 3300005535 Ga0070684_100474513 Ga0070684_1004745132 123
166 3300005543 Ga0070672_101949889 Ga0070672_1019498891 123
167 3300005546 Ga0070696_100548416 Ga0070696_1005484162 123
168 3300005547 Ga0070693_101511660 Ga0070693_1015116601 123
169 3300005549 Ga0070704_100458820 Ga0070704_1004588202 123
170 3300005564 Ga0070664_100051363 Ga0070664_1000513632 123
171 3300005564 Ga0070664_100725788 Ga0070664_1007257882 123
172 3300005578 Ga0068854_100929991 Ga0068854_1009299912 123
173 3300005614 Ga0068856_100138311 Ga0068856_1001383114 123
174 3300005616 Ga0068852_101632337 Ga0068852_1016323371 123
175 3300005718 Ga0068866_10220587 Ga0068866_102205873 123
176 3300005719 Ga0068861_100044522 Ga0068861_1000445224 123
177 3300005719 Ga0068861_101408854 Ga0068861_1014088541 123
178 3300005843 Ga0068860_100506063 Ga0068860_1005060632 123
179 3300005937 Ga0081455_10055205 Ga0081455_100552053 123
180 3300005981 Ga0081538_10057974 Ga0081538_100579744 123
181 3300005981 Ga0081538_10146035 Ga0081538_101460352 123
182 3300006051 Ga0075364_10024550 Ga0075364_100245505 123
183 3300006173 Ga0070716_100063407 Ga0070716_1000634073 123
184 3300006186 Ga0075369_10466967 Ga0075369_104669671 123
185 3300006844 Ga0075428_100533610 Ga0075428_1005336103 123
186 3300006844 Ga0075428_102060083 Ga0075428_1020600831 123
187 3300006846 Ga0075430_100047186 Ga0075430_1000471864 123
188 3300006846 Ga0075430_101562207 Ga0075430_1015622071 123
189 3300006847 Ga0075431_100159360 Ga0075431_1001593602 123
190 3300006852 Ga0075433_10397043 Ga0075433_103970432 123
191 3300006880 Ga0075429_100125435 Ga0075429_1001254352 123
192 3300006881 Ga0068865_100592666 Ga0068865_1005926662 123
193 3300006881 Ga0068865_101132910 Ga0068865_1011329102 123
194 3300009094 Ga0111539_10449923 Ga0111539_104499233 123
195 3300009094 Ga0111539_11571193 Ga0111539_115711932 123
196 3300009094 Ga0111539_11589686 Ga0111539_115896862 123
197 3300009094 Ga0111539_11741811 Ga0111539_117418112 123
198 3300009094 Ga0111539_12000593 Ga0111539_120005931 123
199 3300009147 Ga0114129_10202515 Ga0114129_102025154 123
200 3300009147 Ga0114129_10559141 Ga0114129_105591412 123
201 3300009147 Ga0114129_10692124 Ga0114129_106921242 123
202 3300009147 Ga0114129_10844099 Ga0114129_108440992 123
203 3300009148 Ga0105243_10535869 Ga0105243_105358692 123
204 3300009148 Ga0105243_13045395 Ga0105243_130453951 123
205 3300009177 Ga0105248_10294931 Ga0105248_102949313 123
206 3300009551 Ga0105238_11316716 Ga0105238_113167162 123
207 3300009553 Ga0105249_10400604 Ga0105249_104006042 123
208 3300009553 Ga0105249_10463457 Ga0105249_104634573 123
209 3300010375 Ga0105239_10975970 Ga0105239_109759701 123
210 3300013104 Ga0157370_10482816 Ga0157370_104828162 123
211 3300013105 Ga0157369_10005654 Ga0157369_100056545 123
212 3300013105 Ga0157369_10529178 Ga0157369_105291782 123
213 3300013296 Ga0157374_10634244 Ga0157374_106342442 123
214 3300013306 Ga0163162_10261469 Ga0163162_102614694 123
215 3300013307 Ga0157372_10936721 Ga0157372_109367212 123
216 3300013308 Ga0157375_10668985 Ga0157375_106689852 123
217 3300014325 Ga0163163_11766053 Ga0163163_117660532 123
218 3300014326 Ga0157380_10235508 Ga0157380_102355082 123
219 3300014326 Ga0157380_11250606 Ga0157380_112506062 123
220 3300014745 Ga0157377_10074830 Ga0157377_100748302 123
221 3300014745 Ga0157377_10678981 Ga0157377_106789812 123
222 3300014969 Ga0157376_11024196 Ga0157376_110241962 123
223 3300020069 Ga0197907_10057455 Ga0197907_100574552 123
224 3300020070 Ga0206356_10248501 Ga0206356_102485012 123
225 3300020077 Ga0206351_10146550 Ga0206351_101465502 123
226 3300020078 Ga0206352_11312785 Ga0206352_113127851 123
227 3300020081 Ga0206354_11555507 Ga0206354_115555072 123
228 3300025904 Ga0207647_10137471 Ga0207647_101374711 123
229 3300025908 Ga0207643_10575349 Ga0207643_105753492 123
230 3300025909 Ga0207705_10014201 Ga0207705_100142014 123
231 3300025918 Ga0207662_11053599 Ga0207662_110535991 123
232 3300025919 Ga0207657_10212583 Ga0207657_102125833 123
233 3300025920 Ga0207649_10053522 Ga0207649_100535223 123
234 3300025921 Ga0207652_10069339 Ga0207652_100693393 123
235 3300025925 Ga0207650_10707866 Ga0207650_107078662 123
236 3300025926 Ga0207659_10676550 Ga0207659_106765501 123
237 3300025926 Ga0207659_11779542 Ga0207659_117795421 123
238 3300025929 Ga0207664_10105345 Ga0207664_101053453 123
239 3300025935 Ga0207709_10076390 Ga0207709_100763901 123
240 3300025938 Ga0207704_10198568 Ga0207704_101985682 123
241 3300025938 Ga0207704_10636799 Ga0207704_106367992 123
242 3300025940 Ga0207691_10418588 Ga0207691_104185883 123
243 3300025940 Ga0207691_11255812 Ga0207691_112558122 123
244 3300025942 Ga0207689_11539452 Ga0207689_115394521 123
245 3300025944 Ga0207661_10009084 Ga0207661_100090847 123
246 3300025945 Ga0207679_10615263 Ga0207679_106152632 123
247 3300025949 Ga0207667_10097975 Ga0207667_100979753 123
248 3300025961 Ga0207712_10229545 Ga0207712_102295451 123
249 3300025961 Ga0207712_10948571 Ga0207712_109485712 123
250 3300025972 Ga0207668_10131176 Ga0207668_101311762 123
251 3300025972 Ga0207668_10292032 Ga0207668_102920322 123
252 3300025981 Ga0207640_10187648 Ga0207640_101876483 123
253 3300026035 Ga0207703_12427624 Ga0207703_124276241 123
254 3300026075 Ga0207708_10041438 Ga0207708_100414384 123
255 3300026075 Ga0207708_10193789 Ga0207708_101937892 123
256 3300026075 Ga0207708_10254252 Ga0207708_102542523 123
257 3300026078 Ga0207702_10310155 Ga0207702_103101553 123
258 3300026116 Ga0207674_10200596 Ga0207674_102005962 123
259 3300026118 Ga0207675_100065615 Ga0207675_1000656154 123
260 3300026118 Ga0207675_100072031 Ga0207675_1000720313 123
261 3300026142 Ga0207698_12490993 Ga0207698_124909932 123
262 3300027876 Ga0209974_10317046 Ga0209974_103170461 123
263 3300027907 Ga0207428_10264939 Ga0207428_102649392 123
264 3300028381 Ga0268264_10380543 Ga0268264_103805432 123
265 3300031731 Ga0307405_10167849 Ga0307405_101678492 123
266 3300031731 Ga0307405_10562399 Ga0307405_105623992 123
267 3300031824 Ga0307413_10181759 Ga0307413_101817593 123
268 3300031824 Ga0307413_10219847 Ga0307413_102198472 123
269 3300031852 Ga0307410_11645206 Ga0307410_116452062 123
270 3300031901 Ga0307406_10000435 Ga0307406_1000043512 123
271 3300031901 Ga0307406_10189728 Ga0307406_101897281 123
272 3300031901 Ga0307406_10386652 Ga0307406_103866522 123
273 3300031911 Ga0307412_11112290 Ga0307412_111122902 123
274 3300031995 Ga0307409_100027473 Ga0307409_1000274735 123
275 3300031995 Ga0307409_100345924 Ga0307409_1003459244 123
276 3300031995 Ga0307409_100758537 Ga0307409_1007585372 123
277 3300032002 Ga0307416_100463950 Ga0307416_1004639502 123
278 3300032002 Ga0307416_100612889 Ga0307416_1006128892 123
279 3300032002 Ga0307416_100783551 Ga0307416_1007835512 123
280 3300032002 Ga0307416_102248474 Ga0307416_1022484742 123
281 3300032004 Ga0307414_10235890 Ga0307414_102358902 123
282 3300032005 Ga0307411_10274266 Ga0307411_102742662 123
283 3300032126 Ga0307415_100501880 Ga0307415_1005018802 123
284 3300032126 Ga0307415_100697659 Ga0307415_1006976592 123
285 3300032126 Ga0307415_100742041 Ga0307415_1007420412 123
286 3300037418 Ga0395900_0551491 Ga0395900_0551491_96_470 123
287 3300037466 Ga0395898_0372506 Ga0395898_0372506_236_610 123
288 3300037471 Ga0395905_1222968 Ga0395905_1222968_145_519 123
289 3300037853 Ga0436364_0957520 Ga0436364_0957520_2334_2705 123
290 3300038443 Ga0395901_0428047 Ga0395901_0428047_573_947 123
291 3300041408 Ga0439453_0002006 Ga0439453_0002006_1528_1905 123
292 3300042009 Ga0439451_013023 Ga0439451_013023_817_1194 123
293 3300042009 Ga0439451_117251 Ga0439451_117251_134_523 123
294 3300042011 Ga0439454_000186 Ga0439454_000186_171_548 123
295 3300042013 Ga0439456_047142 Ga0439456_047142_433_810 123
296 3300042436 Ga0439435_0104773 Ga0439435_0104773_78_467 123
297 3300044901 Ga0466960_0283302 Ga0466960_0283302_537_908 123
298 3300046692 Ga0495671_0326414 Ga0495671_0326414_215_613 123
299 3300048906 Ga0496103_0412726 Ga0496103_0412726_46_420 123
300 3300048913 Ga0496110_0342490 Ga0496110_0342490_378_749 123
301 3300048915 Ga0496112_0046725 Ga0496112_0046725_1463_1834 123
302 3300048920 Ga0496117_0432116 Ga0496117_0432116_44_415 123
303 3300048924 Ga0496121_0000462 Ga0496121_0000462_76882_77253 123
304 3300048929 Ga0496126_0015392 Ga0496126_0015392_983_1366 123
305 3300049568 Ga0501031_0420405 Ga0501031_0420405_380_754 123
306 3300049571 Ga0501034_0588578 Ga0501034_0588578_605_979 123
307 3300049571 Ga0501034_1568310 Ga0501034_1568310_72_443 123
308 3300049572 Ga0501036_0297305 Ga0501036_0297305_14_388 123
309 3300049573 Ga0501037_0566058 Ga0501037_0566058_114_488 123
310 3300049574 Ga0501038_0142536 Ga0501038_0142536_1143_1517 123
311 3300049575 Ga0501039_0396788 Ga0501039_0396788_123_497 123
312 3300049575 Ga0501039_0739362 Ga0501039_0739362_370_744 123
313 3300049576 Ga0501040_0848427 Ga0501040_0848427_35_409 123
314 3300049577 Ga0501041_0989382 Ga0501041_0989382_52_441 123
315 3300049578 Ga0501042_0267056 Ga0501042_0267056_841_1215 123
316 3300049578 Ga0501042_0347525 Ga0501042_0347525_422_811 123
317 3300049584 Ga0501068_0035720 Ga0501068_0035720_1170_1544 123
318 3300049585 Ga0501069_0099433 Ga0501069_0099433_526_900 123
319 3300049586 Ga0501070_0811490 Ga0501070_0811490_16_390 123
320 3300049587 Ga0501071_0011845 Ga0501071_0011845_5429_5803 123
321 3300049587 Ga0501071_0120043 Ga0501071_0120043_1220_1594 123
322 3300049588 Ga0501072_0125927 Ga0501072_0125927_1644_2018 123
323 3300049589 Ga0501073_0444559 Ga0501073_0444559_166_540 123
324 3300049590 Ga0501074_0463661 Ga0501074_0463661_407_781 123
325 3300049591 Ga0501075_0705498 Ga0501075_0705498_257_631 123
326 3300049592 Ga0501076_0179595 Ga0501076_0179595_49_423 123
327 3300049592 Ga0501076_0353632 Ga0501076_0353632_595_969 123
328 3300049592 Ga0501076_0855024 Ga0501076_0855024_72_443 123
329 3300049593 Ga0501077_0018980 Ga0501077_0018980_1717_2091 123
330 3300049741 Ga0501079_0716485 Ga0501079_0716485_370_744 123
331 3300049742 Ga0501080_1205756 Ga0501080_1205756_259_633 123
332 3300049743 Ga0501081_0439306 Ga0501081_0439306_524_898 123
333 3300049824 Ga0501045_0244253 Ga0501045_0244253_190_564 123
334 3300049824 Ga0501045_0572005 Ga0501045_0572005_349_723 123
335 3300050491 nmdc:mga00v17_13648_c1 nmdc:mga00v17_13648_c1_3904_4296 123
336 3300050507 nmdc:mga05p37_1338829_c1 nmdc:mga05p37_1338829_c1_184_558 123
337 3300050507 nmdc:mga05p37_284785_c1 nmdc:mga05p37_284785_c1_997_1368 123
338 3300050507 nmdc:mga05p37_288096_c1 nmdc:mga05p37_288096_c1_483_854 123
339 3300050509 nmdc:mga0qj67_200048_c1 nmdc:mga0qj67_200048_c1_1076_1447 123
340 3300050509 nmdc:mga0qj67_294038_c1 nmdc:mga0qj67_294038_c1_167_556 123
341 3300050510 nmdc:mga06r32_107673_c1 nmdc:mga06r32_107673_c1_2318_2689 123
342 3300050511 nmdc:mga08y16_53056_c1 nmdc:mga08y16_53056_c1_3520_3894 123
343 3300050515 nmdc:mga0a205_621920_c1 nmdc:mga0a205_621920_c1_70_444 123
344 3300050516 nmdc:mga0sz30_421898_c1 nmdc:mga0sz30_421898_c1_144_521 123
345 3300050516 nmdc:mga0sz30_543392_c1 nmdc:mga0sz30_543392_c1_40_432 123
346 3300054114 Ga0501084_0213264 Ga0501084_0213264_1071_1445 123
347 3300054114 Ga0501084_1507178 Ga0501084_1507178_70_441 123
348 3300060353 Ga0501082_0706982 Ga0501082_0706982_38_412 123
349 3300061734 Ga0530510_0696241 Ga0530510_0696241_381_755 123
350 3300061734 Ga0530510_0904226 Ga0530510_0904226_63_452 123
351 3300003203 JGI25406J46586_10062661 JGI25406J46586_100626612 124
352 3300003373 JGI25407J50210_10006655 JGI25407J50210_100066554 124
353 3300003578 Ga0006562J51391_1149020 Ga0006562J51391_11490202 124
354 3300003578 Ga0006562J51391_1149021 Ga0006562J51391_11490211 124
355 3300005327 Ga0070658_10741427 Ga0070658_107414272 124
356 3300005327 Ga0070658_10814886 Ga0070658_108148862 124
357 3300005329 Ga0070683_100591625 Ga0070683_1005916252 124
358 3300005331 Ga0070670_102143570 Ga0070670_1021435701 124
359 3300005334 Ga0068869_100929078 Ga0068869_1009290782 124
360 3300005337 Ga0070682_100066096 Ga0070682_1000660963 124
361 3300005338 Ga0068868_100856041 Ga0068868_1008560412 124
362 3300005339 Ga0070660_100812719 Ga0070660_1008127192 124
363 3300005340 Ga0070689_100114650 Ga0070689_1001146502 124
364 3300005345 Ga0070692_10328301 Ga0070692_103283012 124
365 3300005347 Ga0070668_100227718 Ga0070668_1002277182 124
366 3300005356 Ga0070674_100181166 Ga0070674_1001811662 124
367 3300005366 Ga0070659_100064596 Ga0070659_1000645964 124
368 3300005438 Ga0070701_11043039 Ga0070701_110430391 124
369 3300005445 Ga0070708_100371394 Ga0070708_1003713943 124
370 3300005455 Ga0070663_100174403 Ga0070663_1001744032 124
371 3300005456 Ga0070678_100076271 Ga0070678_1000762713 124
372 3300005467 Ga0070706_100522365 Ga0070706_1005223651 124
373 3300005467 Ga0070706_101230545 Ga0070706_1012305451 124
374 3300005468 Ga0070707_100161097 Ga0070707_1001610973 124
375 3300005471 Ga0070698_100058822 Ga0070698_1000588223 124
376 3300005518 Ga0070699_100285978 Ga0070699_1002859782 124
377 3300005518 Ga0070699_101669800 Ga0070699_1016698001 124
378 3300005535 Ga0070684_100087988 Ga0070684_1000879886 124
379 3300005535 Ga0070684_100365747 Ga0070684_1003657472 124
380 3300005543 Ga0070672_100031433 Ga0070672_1000314334 124
381 3300005544 Ga0070686_101208781 Ga0070686_1012087811 124
382 3300005548 Ga0070665_100080791 Ga0070665_1000807913 124
383 3300005548 Ga0070665_100488911 Ga0070665_1004889112 124
384 3300005616 Ga0068852_100306572 Ga0068852_1003065722 124
385 3300005618 Ga0068864_100180830 Ga0068864_1001808303 124
386 3300005618 Ga0068864_101431654 Ga0068864_1014316542 124
387 3300005719 Ga0068861_100109181 Ga0068861_1001091811 124
388 3300005719 Ga0068861_101467282 Ga0068861_1014672822 124
389 3300005937 Ga0081455_10053330 Ga0081455_100533305 124
390 3300005937 Ga0081455_10120016 Ga0081455_101200162 124
391 3300005981 Ga0081538_10000021 Ga0081538_1000002179 124
392 3300005981 Ga0081538_10000353 Ga0081538_1000035341 124
393 3300005981 Ga0081538_10094284 Ga0081538_100942842 124
394 3300005985 Ga0081539_10002270 Ga0081539_1000227015 124
395 3300005985 Ga0081539_10033238 Ga0081539_100332382 124
396 3300006237 Ga0097621_101734155 Ga0097621_1017341552 124
397 3300006358 Ga0068871_101114387 Ga0068871_1011143872 124
398 3300006844 Ga0075428_100027657 Ga0075428_1000276574 124
399 3300006846 Ga0075430_100811002 Ga0075430_1008110022 124
400 3300006847 Ga0075431_100314155 Ga0075431_1003141553 124
401 3300006880 Ga0075429_100240030 Ga0075429_1002400302 124
402 3300009098 Ga0105245_10128194 Ga0105245_101281943 124
403 3300009101 Ga0105247_11577100 Ga0105247_115771001 124
404 3300009147 Ga0114129_10284003 Ga0114129_102840033 124
405 3300009148 Ga0105243_10027123 Ga0105243_100271235 124
406 3300009177 Ga0105248_10153693 Ga0105248_101536932 124
407 3300009545 Ga0105237_10085990 Ga0105237_100859905 124
408 3300010375 Ga0105239_10568967 Ga0105239_105689672 124
409 3300011119 Ga0105246_10156181 Ga0105246_101561813 124
410 3300013296 Ga0157374_11339368 Ga0157374_113393682 124
411 3300013306 Ga0163162_10080807 Ga0163162_100808074 124
412 3300013306 Ga0163162_10201724 Ga0163162_102017242 124
413 3300013306 Ga0163162_10551516 Ga0163162_105515162 124
414 3300013306 Ga0163162_13231724 Ga0163162_132317241 124
415 3300013307 Ga0157372_11812149 Ga0157372_118121492 124
416 3300013308 Ga0157375_11152563 Ga0157375_111525632 124
417 3300014325 Ga0163163_10792081 Ga0163163_107920812 124
418 3300014326 Ga0157380_10045675 Ga0157380_100456755 124
419 3300014745 Ga0157377_10021633 Ga0157377_100216333 124
420 3300025901 Ga0207688_10567349 Ga0207688_105673491 124
421 3300025901 Ga0207688_10863034 Ga0207688_108630342 124
422 3300025908 Ga0207643_10044633 Ga0207643_100446331 124
423 3300025909 Ga0207705_10590216 Ga0207705_105902162 124
424 3300025910 Ga0207684_10037108 Ga0207684_100371083 124
425 3300025919 Ga0207657_10627041 Ga0207657_106270412 124
426 3300025926 Ga0207659_11180183 Ga0207659_111801832 124
427 3300025927 Ga0207687_10205290 Ga0207687_102052902 124
428 3300025935 Ga0207709_10233447 Ga0207709_102334472 124
429 3300025935 Ga0207709_11001418 Ga0207709_110014182 124
430 3300025937 Ga0207669_10330235 Ga0207669_103302352 124
431 3300025940 Ga0207691_10055564 Ga0207691_100555645 124
432 3300025941 Ga0207711_10395398 Ga0207711_103953982 124
433 3300025942 Ga0207689_10874868 Ga0207689_108748682 124
434 3300025944 Ga0207661_10290660 Ga0207661_102906602 124
435 3300025944 Ga0207661_10421951 Ga0207661_104219512 124
436 3300025960 Ga0207651_10263670 Ga0207651_102636702 124
437 3300025972 Ga0207668_10259329 Ga0207668_102593292 124
438 3300026067 Ga0207678_10226404 Ga0207678_102264042 124
439 3300026095 Ga0207676_11406932 Ga0207676_114069322 124
440 3300026118 Ga0207675_100341587 Ga0207675_1003415872 124
441 3300026118 Ga0207675_101963430 Ga0207675_1019634301 124
442 3300026121 Ga0207683_10178714 Ga0207683_101787142 124
443 3300026121 Ga0207683_10576945 Ga0207683_105769452 124
444 3300026142 Ga0207698_10444275 Ga0207698_104442752 124
445 3300028379 Ga0268266_10211279 Ga0268266_102112792 124
446 3300028379 Ga0268266_10272209 Ga0268266_102722092 124
447 3300031616 Ga0307508_10405683 Ga0307508_104056832 124
448 3300035119 Ga0373956_0016532 Ga0373956_0016532_1768_2175 124
449 3300035172 Ga0373955_0007506 Ga0373955_0007506_811_1218 124
450 3300035724 Ga0373933_0050302 Ga0373933_0050302_1849_2256 124
451 3300036401 Ga0373937_0024203 Ga0373937_0024203_3767_4174 124
452 3300037068 Ga0373925_0006813 Ga0373925_0006813_7399_7785 124
453 3300037068 Ga0373925_0023114 Ga0373925_0023114_109_495 124
454 3300038443 Ga0395901_0204838 Ga0395901_0204838_538_912 124
455 3300041512 Ga0451853_1546664 Ga0451853_1546664_393_767 124
456 3300041512 Ga0451853_3985726 Ga0451853_3985726_60_434 124
457 3300042439 Ga0439464_0053624 Ga0439464_0053624_16_393 124
458 3300044693 Ga0466961_0304093 Ga0466961_0304093_567_950 124
459 3300044765 Ga0466970_0068293 Ga0466970_0068293_379_819 124
460 3300044901 Ga0466960_0019661 Ga0466960_0019661_1960_2337 124
461 3300046453 Ga0495627_000603 Ga0495627_000603_20577_20954 124
462 3300046455 Ga0495603_0048547 Ga0495603_0048547_1935_2309 124
463 3300046459 Ga0495629_0438455 Ga0495629_0438455_390_788 124
464 3300046459 Ga0495629_0506098 Ga0495629_0506098_187_594 124
465 3300046461 Ga0495641_0072140 Ga0495641_0072140_137_511 124
466 3300046462 Ga0495651_0001161 Ga0495651_0001161_10945_11352 124
467 3300046463 Ga0495653_0059664 Ga0495653_0059664_1287_1694 124
468 3300046463 Ga0495653_0260712 Ga0495653_0260712_615_998 124
469 3300046473 Ga0495582_0260151 Ga0495582_0260151_603_977 124
470 3300046476 Ga0495662_0197737 Ga0495662_0197737_357_737 124
471 3300046477 Ga0495664_0105564 Ga0495664_0105564_460_867 124
472 3300046511 Ga0495608_0000210 Ga0495608_0000210_19226_19633 124
473 3300046511 Ga0495608_0296677 Ga0495608_0296677_510_884 124
474 3300046514 Ga0495618_0029610 Ga0495618_0029610_1702_2109 124
475 3300046516 Ga0495628_0037958 Ga0495628_0037958_1905_2312 124
476 3300046516 Ga0495628_0301762 Ga0495628_0301762_314_712 124
477 3300046517 Ga0495630_0002090 Ga0495630_0002090_13175_13558 124
478 3300046529 Ga0495652_0014485 Ga0495652_0014485_2166_2573 124
479 3300046529 Ga0495652_0116652 Ga0495652_0116652_588_986 124
480 3300046533 Ga0495640_0035580 Ga0495640_0035580_665_1072 124
481 3300046536 Ga0495587_0020463 Ga0495587_0020463_2820_3227 124
482 3300046543 Ga0495645_0007961 Ga0495645_0007961_4707_5114 124
483 3300046543 Ga0495645_0120740 Ga0495645_0120740_1342_1740 124
484 3300046558 Ga0495633_0000152 Ga0495633_0000152_64914_65291 124
485 3300046559 Ga0495667_0013576 Ga0495667_0013576_2934_3341 124
486 3300046642 Ga0495634_0096424 Ga0495634_0096424_1013_1420 124
487 3300046663 Ga0495635_0020024 Ga0495635_0020024_2084_2491 124
488 3300046663 Ga0495635_0302855 Ga0495635_0302855_567_941 124
489 3300046675 Ga0495657_0013341 Ga0495657_0013341_2131_2514 124
490 3300046675 Ga0495657_0021162 Ga0495657_0021162_2118_2525 124
491 3300046678 Ga0495599_0102357 Ga0495599_0102357_509_916 124
492 3300046679 Ga0495623_0077114 Ga0495623_0077114_792_1199 124
493 3300046683 Ga0495658_0655560 Ga0495658_0655560_106_480 124
494 3300046809 Ga0495600_0022163 Ga0495600_0022163_2060_2467 124
495 3300047315 Ga0495581_0787833 Ga0495581_0787833_60_434 124
496 3300047317 Ga0495604_0008487 Ga0495604_0008487_4003_4410 124
497 3300047319 Ga0495674_0008894 Ga0495674_0008894_2375_2782 124
498 3300047321 Ga0495676_0328206 Ga0495676_0328206_143_535 124
499 3300047322 Ga0495680_0039625 Ga0495680_0039625_1178_1585 124
500 3300047322 Ga0495680_0970743 Ga0495680_0970743_28_402 124
501 3300047444 Ga0495675_0017229 Ga0495675_0017229_2172_2579 124
502 3300047471 Ga0495684_0024249 Ga0495684_0024249_2172_2579 124
503 3300047673 Ga0495593_0321630 Ga0495593_0321630_64_444 124
504 3300047673 Ga0495593_0451962 Ga0495593_0451962_186_578 124
505 3300048088 Ga0495602_0088890 Ga0495602_0088890_1072_1479 124
506 3300048903 Ga0496100_0611816 Ga0496100_0611816_181_555 124
507 3300048906 Ga0496103_0452843 Ga0496103_0452843_228_611 124
508 3300048906 Ga0496103_0651391 Ga0496103_0651391_128_502 124
509 3300048907 Ga0496104_0168127 Ga0496104_0168127_1670_2068 124
510 3300048907 Ga0496104_0736053 Ga0496104_0736053_183_581 124
511 3300048907 Ga0496104_1348758 Ga0496104_1348758_89_463 124
512 3300048908 Ga0496105_0459905 Ga0496105_0459905_259_657 124
513 3300048911 Ga0496108_0062707 Ga0496108_0062707_939_1313 124
514 3300048911 Ga0496108_0161956 Ga0496108_0161956_31_405 124
515 3300048912 Ga0496109_0759482 Ga0496109_0759482_11_385 124
516 3300048913 Ga0496110_0186345 Ga0496110_0186345_1440_1823 124
517 3300048914 Ga0496111_0624328 Ga0496111_0624328_284_658 124
518 3300048916 Ga0496113_0029530 Ga0496113_0029530_1390_1788 124
519 3300048917 Ga0496114_1528997 Ga0496114_1528997_22_399 124
520 3300049162 Ga0501307_058698 Ga0501307_058698_169_543 124
521 3300049568 Ga0501031_0296984 Ga0501031_0296984_140_532 124
522 3300049576 Ga0501040_0565936 Ga0501040_0565936_415_792 124
523 3300049576 Ga0501040_0606556 Ga0501040_0606556_196_582 124
524 3300049577 Ga0501041_0044889 Ga0501041_0044889_2073_2450 124
525 3300049578 Ga0501042_0199104 Ga0501042_0199104_151_528 124
526 3300049579 Ga0501043_0517424 Ga0501043_0517424_358_732 124
527 3300049581 Ga0501047_0101404 Ga0501047_0101404_2306_2680 124
528 3300049582 Ga0501048_0148319 Ga0501048_0148319_1246_1623 124
529 3300049587 Ga0501071_0606729 Ga0501071_0606729_131_508 124
530 3300049591 Ga0501075_0021801 Ga0501075_0021801_917_1294 124
531 3300049592 Ga0501076_0344961 Ga0501076_0344961_443_820 124
532 3300049741 Ga0501079_0330131 Ga0501079_0330131_774_1151 124
533 3300049743 Ga0501081_0021500 Ga0501081_0021500_1830_2207 124
534 3300049822 Ga0501035_0254346 Ga0501035_0254346_387_764 124
535 3300049824 Ga0501045_0011979 Ga0501045_0011979_4936_5313 124
536 3300050490 nmdc:mga03n38_175691_c1 nmdc:mga03n38_175691_c1_407_781 124
537 3300050492 nmdc:mga0yw44_977211_c1 nmdc:mga0yw44_977211_c1_18_398 124
538 3300050507 nmdc:mga05p37_673757_c2 nmdc:mga05p37_673757_c2_174_548 124
539 3300050508 nmdc:mga09592_299529_c1 nmdc:mga09592_299529_c1_480_854 124
540 3300050510 nmdc:mga06r32_352789_c1 nmdc:mga06r32_352789_c1_386_760 124
541 3300053077 Ga0495601_0008295 Ga0495601_0008295_633_1016 124
542 3300053077 Ga0495601_0059717 Ga0495601_0059717_1292_1699 124
543 3300053078 Ga0495612_0081715 Ga0495612_0081715_537_920 124
544 3300053084 Ga0495595_0013826 Ga0495595_0013826_1825_2232 124
545 3300053085 Ga0495619_0255250 Ga0495619_0255250_320_694 124
546 3300053093 Ga0500651_0190842 Ga0500651_0190842_398_775 124
547 3300054114 Ga0501084_0054419 Ga0501084_0054419_2416_2793 124
548 3300061734 Ga0530510_0006116 Ga0530510_0006116_7140_7517 124
549 3300005327 Ga0070658_11433876 Ga0070658_114338761 125
550 3300005347 Ga0070668_100016307 Ga0070668_1000163076 125
551 3300005356 Ga0070674_100011194 Ga0070674_1000111942 125
552 3300005364 Ga0070673_100184860 Ga0070673_1001848602 125
553 3300005434 Ga0070709_10385256 Ga0070709_103852562 125
554 3300005436 Ga0070713_100023695 Ga0070713_1000236954 125
555 3300005471 Ga0070698_100677116 Ga0070698_1006771161 125
556 3300005719 Ga0068861_101035972 Ga0068861_1010359722 125
557 3300006048 Ga0075363_100193238 Ga0075363_1001932382 125
558 3300006844 Ga0075428_100685934 Ga0075428_1006859341 125
559 3300009148 Ga0105243_10049893 Ga0105243_100498935 125
560 3300013308 Ga0157375_10162961 Ga0157375_101629611 125
561 3300025922 Ga0207646_11125941 Ga0207646_111259412 125
562 3300025928 Ga0207700_10037916 Ga0207700_100379164 125
563 3300025929 Ga0207664_11444972 Ga0207664_114449721 125
564 3300025937 Ga0207669_10003482 Ga0207669_100034826 125
565 3300025972 Ga0207668_10144749 Ga0207668_101447492 125
566 3300026023 Ga0207677_11228368 Ga0207677_112283682 125
567 3300032002 Ga0307416_100422906 Ga0307416_1004229062 125
568 3300032126 Ga0307415_100215673 Ga0307415_1002156732 125
569 3300041413 Ga0439465_0090612 Ga0439465_0090612_328_720 125
570 3300041509 Ga0451843_1210050 Ga0451843_1210050_234_623 125
571 3300041512 Ga0451853_0368024 Ga0451853_0368024_90_476 125
572 3300042007 Ga0439449_0155469 Ga0439449_0155469_84_479 125
573 3300047320 Ga0495672_0101106 Ga0495672_0101106_1162_1542 125
574 3300048911 Ga0496108_0236129 Ga0496108_0236129_159_545 125
575 3300049578 Ga0501042_0492756 Ga0501042_0492756_20_397 125
576 3300050510 nmdc:mga06r32_1061508_c1 nmdc:mga06r32_1061508_c1_251_628 125
577 3300001990 JGI24737J22298_10184331 JGI24737J22298_101843311 126
578 3300005344 Ga0070661_101124887 Ga0070661_1011248872 126
579 3300005455 Ga0070663_100000310 Ga0070663_10000031019 126
580 3300005564 Ga0070664_101512762 Ga0070664_1015127622 126
581 3300006871 Ga0075434_100188077 Ga0075434_1001880773 126
582 3300009177 Ga0105248_11502830 Ga0105248_115028302 126
583 3300009553 Ga0105249_12313055 Ga0105249_123130551 126
584 3300013102 Ga0157371_10032288 Ga0157371_100322883 126
585 3300013104 Ga0157370_10325470 Ga0157370_103254702 126
586 3300013105 Ga0157369_10000393 Ga0157369_100003937 126
587 3300013105 Ga0157369_11037339 Ga0157369_110373391 126
588 3300013307 Ga0157372_10000034 Ga0157372_10000034105 126
589 3300013307 Ga0157372_10586926 Ga0157372_105869262 126
590 3300013308 Ga0157375_10366868 Ga0157375_103668681 126
591 3300013308 Ga0157375_10841606 Ga0157375_108416062 126
592 3300025944 Ga0207661_10142371 Ga0207661_101423712 126
593 3300025944 Ga0207661_10201566 Ga0207661_102015662 126
594 3300026067 Ga0207678_10011687 Ga0207678_100116876 126
595 3300026121 Ga0207683_10742838 Ga0207683_107428382 126
596 3300037312 Ga0395899_0000182 Ga0395899_0000182_33277_33663 126
597 3300037418 Ga0395900_0144161 Ga0395900_0144161_1218_1604 126
598 3300037418 Ga0395900_1445838 Ga0395900_1445838_60_461 126
599 3300037471 Ga0395905_1005070 Ga0395905_1005070_244_630 126
600 3300038443 Ga0395901_0080880 Ga0395901_0080880_2301_2687 126
601 3300038443 Ga0395901_0371480 Ga0395901_0371480_580_987 126
602 3300044684 Ga0466966_0011419 Ga0466966_0011419_1057_1527 126
603 3300046689 Ga0495613_0829293 Ga0495613_0829293_112_507 126
604 3300048903 Ga0496100_0020159 Ga0496100_0020159_2372_2767 126
605 3300048904 Ga0496101_0377369 Ga0496101_0377369_267_662 126
606 3300048905 Ga0496102_0805644 Ga0496102_0805644_78_473 126
607 3300048906 Ga0496103_0475670 Ga0496103_0475670_359_754 126
608 3300048906 Ga0496103_0904591 Ga0496103_0904591_26_421 126
609 3300048907 Ga0496104_0015898 Ga0496104_0015898_5055_5450 126
610 3300048907 Ga0496104_0035111 Ga0496104_0035111_279_674 126
611 3300048908 Ga0496105_0035087 Ga0496105_0035087_320_715 126
612 3300048908 Ga0496105_0354302 Ga0496105_0354302_504_899 126
613 3300048911 Ga0496108_0022189 Ga0496108_0022189_2946_3332 126
614 3300048912 Ga0496109_0405811 Ga0496109_0405811_82_468 126
615 3300048913 Ga0496110_1084857 Ga0496110_1084857_230_625 126
616 3300048914 Ga0496111_0221141 Ga0496111_0221141_845_1240 126
617 3300048916 Ga0496113_0068239 Ga0496113_0068239_297_683 126
618 3300048916 Ga0496113_0407548 Ga0496113_0407548_399_794 126
619 3300048917 Ga0496114_0028131 Ga0496114_0028131_2861_3256 126
620 3300048917 Ga0496114_0243841 Ga0496114_0243841_1034_1429 126
621 3300048922 Ga0496119_0209430 Ga0496119_0209430_78_473 126
622 3300049572 Ga0501036_1646473 Ga0501036_1646473_74_463 126
623 3300049577 Ga0501041_0071147 Ga0501041_0071147_811_1191 126
624 3300049577 Ga0501041_0550568 Ga0501041_0550568_167_553 126
625 3300049584 Ga0501068_0327789 Ga0501068_0327789_20_412 126
626 3300050513 nmdc:mga0rr50_1187936_c1 nmdc:mga0rr50_1187936_c1_25_435 126
627 3300054114 Ga0501084_0714460 Ga0501084_0714460_209_589 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

28

142

0.94

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

32

58

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8075 8 124
5wew-assembly1.cif.gz_A crystal structure of klebsiella pneumoniae fosfomycin resistance protein (fosakp) with inhibitor (any1) bound 0.8006 7 124
5wew-assembly3.cif.gz_E crystal structure of klebsiella pneumoniae fosfomycin resistance protein (fosakp) with inhibitor (any1) bound 0.7878 8 124
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.785 8 124
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.7842 7 124
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8244 61 122 3.30.720.110
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8212 8 53 3.30.720.120
af_O06412_6_120_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8163 7 123 3.10.180.10
af_Q2FYM3_1_61_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7995 10 59 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.797 61 122 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A852WP69-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9968 14 124 GO:0016829
GO:0051213
AF-A0A0M4LD60-F1-model_v4 Glyoxalase 0.9955 1 124
AF-A0A3M2IU54-F1-model_v4 VOC domain-containing protein 0.9879 7 124
AF-A0A2W0CYU3-F1-model_v4 deleted 0.9872 7 123
AF-A0A445ND58-F1-model_v4 deleted 0.9844 1 124

Feature Viewer

pLDDT pTM Quality
95.67 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map