F470543
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 627 | 311 | 611 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300005719|Ga0068861_101035972|Ga0068861_1010359722 |
| Length | 146 |
| Sequence | MISRGLRRLPRQGAAECEGKLMFENTKAFSGFSVDDVGKAKAFYGDVLGLKVTEENGLLTLHLAGDRPTLVYPKPNHTPATFTILNFPVDDVESAVDQLTERGVSFERYAGTPTETDEKGVFRGGGPLIAWFKDPAGNVLSVLQAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 2 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 3 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 4 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 5 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 6 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 7 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 8 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 9 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 10 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 11 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 12 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 13 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 14 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 15 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 16 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 17 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 18 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 19 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 83 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 165 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 168 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 169 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 170 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 171 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 173 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 174 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 175 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 176 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 177 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 189 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 190 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 192 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 193 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 194 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 195 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 196 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 197 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 198 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 199 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 200 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 201 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 202 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 203 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 204 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 248 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 249 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 250 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 251 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 254 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 255 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 256 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 257 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 258 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 259 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 260 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 261 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 262 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 291 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 292 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 293 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 302 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 307 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 308 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 311 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.17 |
| Metatranscriptomes | 1.28 |
| Isolates | 2.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.71 |
| Nodule | 0.16 |
| Rhizoplane | 5.74 |
| Rhizosphere | 88.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10184331 | 3300001990 | Bacteria | 616 |
| 2 | JGI25406J46586_10001433 | 3300003203 | Bacteria | 11249 |
| 3 | JGI25406J46586_10062661 | 3300003203 | Bacteria | 1194 |
| 4 | JGI25407J50210_10006655 | 3300003373 | Bacteria | 2884 |
| 5 | Ga0006562J51391_1149020 | 3300003578 | Bacteria | 843 |
| 6 | Ga0006562J51391_1149021 | 3300003578 | Bacteria | 540 |
| 7 | Ga0070658_10741427 | 3300005327 | Bacteria | 853 |
| 8 | Ga0070658_10814886 | 3300005327 | Bacteria | 811 |
| 9 | Ga0070658_11433876 | 3300005327 | Bacteria | 599 |
| 10 | Ga0070683_100037838 | 3300005329 | Bacteria | 4418 |
| 11 | Ga0070683_100591625 | 3300005329 | Bacteria | 1062 |
| 12 | Ga0070670_102143570 | 3300005331 | Bacteria | 515 |
| 13 | Ga0068869_100929078 | 3300005334 | Bacteria | 754 |
| 14 | Ga0070682_100066096 | 3300005337 | Bacteria | 2300 |
| 15 | Ga0070682_100097982 | 3300005337 | Bacteria | 1931 |
| 16 | Ga0068868_100856041 | 3300005338 | Bacteria | 824 |
| 17 | Ga0070660_100335145 | 3300005339 | Bacteria | 1244 |
| 18 | Ga0070660_100812719 | 3300005339 | Bacteria | 787 |
| 19 | Ga0070689_100114650 | 3300005340 | Bacteria | 2147 |
| 20 | Ga0070691_10255127 | 3300005341 | Bacteria | 942 |
| 21 | Ga0070687_101261660 | 3300005343 | Unclassified | 547 |
| 22 | Ga0070661_101124887 | 3300005344 | Bacteria | 655 |
| 23 | Ga0070692_10328301 | 3300005345 | Bacteria | 943 |
| 24 | Ga0070692_10358584 | 3300005345 | Bacteria | 908 |
| 25 | Ga0070668_100016307 | 3300005347 | Bacteria | 5556 |
| 26 | Ga0070668_100227718 | 3300005347 | Bacteria | 1540 |
| 27 | Ga0070668_100552655 | 3300005347 | Bacteria | 1002 |
| 28 | Ga0070669_100274065 | 3300005353 | Bacteria | 1350 |
| 29 | Ga0070675_100670167 | 3300005354 | Bacteria | 943 |
| 30 | Ga0070674_100011194 | 3300005356 | Bacteria | 5450 |
| 31 | Ga0070674_100181166 | 3300005356 | Bacteria | 1614 |
| 32 | Ga0070673_100184860 | 3300005364 | Bacteria | 1786 |
| 33 | Ga0070688_100176303 | 3300005365 | Bacteria | 1479 |
| 34 | Ga0070659_100064596 | 3300005366 | Bacteria | 2897 |
| 35 | Ga0070659_100066151 | 3300005366 | Bacteria | 2864 |
| 36 | Ga0070667_100006798 | 3300005367 | Bacteria | 9503 |
| 37 | Ga0070709_10385256 | 3300005434 | Bacteria | 1043 |
| 38 | Ga0070714_100362115 | 3300005435 | Bacteria | 1364 |
| 39 | Ga0070713_100023695 | 3300005436 | Bacteria | 4769 |
| 40 | Ga0070713_100078833 | 3300005436 | Bacteria | 2804 |
| 41 | Ga0070710_10033155 | 3300005437 | Bacteria | 2803 |
| 42 | Ga0070701_10403664 | 3300005438 | Bacteria | 866 |
| 43 | Ga0070701_10497148 | 3300005438 | Unclassified | 791 |
| 44 | Ga0070701_11043039 | 3300005438 | Bacteria | 572 |
| 45 | Ga0070700_100021958 | 3300005441 | Bacteria | 3715 |
| 46 | Ga0070700_100204794 | 3300005441 | Bacteria | 1388 |
| 47 | Ga0070700_100750438 | 3300005441 | Bacteria | 781 |
| 48 | Ga0070708_100371394 | 3300005445 | Bacteria | 1348 |
| 49 | Ga0070663_100000310 | 3300005455 | Bacteria | 25165 |
| 50 | Ga0070663_100174403 | 3300005455 | Bacteria | 1664 |
| 51 | Ga0070663_101698638 | 3300005455 | Bacteria | 564 |
| 52 | Ga0070678_100076271 | 3300005456 | Bacteria | 2525 |
| 53 | Ga0070678_102075892 | 3300005456 | Bacteria | 538 |
| 54 | Ga0070662_100063774 | 3300005457 | Bacteria | 2696 |
| 55 | Ga0068867_100053534 | 3300005459 | Bacteria | 2981 |
| 56 | Ga0070706_100136278 | 3300005467 | Bacteria | 2292 |
| 57 | Ga0070706_100522365 | 3300005467 | Bacteria | 1104 |
| 58 | Ga0070706_101230545 | 3300005467 | Bacteria | 687 |
| 59 | Ga0070707_100000150 | 3300005468 | Bacteria | 67233 |
| 60 | Ga0070707_100161097 | 3300005468 | Bacteria | 2186 |
| 61 | Ga0070698_100001980 | 3300005471 | Bacteria | 22745 |
| 62 | Ga0070698_100058822 | 3300005471 | Bacteria | 3884 |
| 63 | Ga0070698_100127283 | 3300005471 | Bacteria | 2504 |
| 64 | Ga0070698_100677116 | 3300005471 | Bacteria | 973 |
| 65 | Ga0070699_100067213 | 3300005518 | Bacteria | 3112 |
| 66 | Ga0070699_100285978 | 3300005518 | Bacteria | 1477 |
| 67 | Ga0070699_101669800 | 3300005518 | Bacteria | 583 |
| 68 | Ga0070679_100576805 | 3300005530 | Bacteria | 1068 |
| 69 | Ga0070684_100087988 | 3300005535 | Bacteria | 2759 |
| 70 | Ga0070684_100240650 | 3300005535 | Bacteria | 1653 |
| 71 | Ga0070684_100365747 | 3300005535 | Bacteria | 1328 |
| 72 | Ga0070684_100474513 | 3300005535 | Bacteria | 1157 |
| 73 | Ga0070672_100031433 | 3300005543 | Bacteria | 3995 |
| 74 | Ga0070672_101949889 | 3300005543 | Bacteria | 529 |
| 75 | Ga0070686_100629981 | 3300005544 | Bacteria | 848 |
| 76 | Ga0070686_101208781 | 3300005544 | Bacteria | 628 |
| 77 | Ga0070696_100548416 | 3300005546 | Bacteria | 926 |
| 78 | Ga0070693_101511660 | 3300005547 | Bacteria | 525 |
| 79 | Ga0070665_100080791 | 3300005548 | Bacteria | 3257 |
| 80 | Ga0070665_100488911 | 3300005548 | Bacteria | 1242 |
| 81 | Ga0070704_100458820 | 3300005549 | Bacteria | 1099 |
| 82 | Ga0070664_100051363 | 3300005564 | Bacteria | 3491 |
| 83 | Ga0070664_100725788 | 3300005564 | Bacteria | 927 |
| 84 | Ga0070664_101512762 | 3300005564 | Bacteria | 635 |
| 85 | Ga0068854_100929991 | 3300005578 | Bacteria | 766 |
| 86 | Ga0068856_100138311 | 3300005614 | Bacteria | 2442 |
| 87 | Ga0068852_100306572 | 3300005616 | Bacteria | 1538 |
| 88 | Ga0068852_101632337 | 3300005616 | Bacteria | 667 |
| 89 | Ga0068864_100180830 | 3300005618 | Bacteria | 1928 |
| 90 | Ga0068864_101431654 | 3300005618 | Bacteria | 693 |
| 91 | Ga0068866_10220587 | 3300005718 | Bacteria | 1144 |
| 92 | Ga0068861_100044522 | 3300005719 | Bacteria | 3338 |
| 93 | Ga0068861_100109181 | 3300005719 | Bacteria | 2214 |
| 94 | Ga0068861_101035972 | 3300005719 | Bacteria | 785 |
| 95 | Ga0068861_101408854 | 3300005719 | Bacteria | 681 |
| 96 | Ga0068861_101467282 | 3300005719 | Bacteria | 668 |
| 97 | Ga0068860_100506063 | 3300005843 | Bacteria | 1206 |
| 98 | Ga0068862_100872698 | 3300005844 | Bacteria | 883 |
| 99 | Ga0081455_10035272 | 3300005937 | Bacteria | 4473 |
| 100 | Ga0081455_10053330 | 3300005937 | Bacteria | 3454 |
| 101 | Ga0081455_10055205 | 3300005937 | Bacteria | 3380 |
| 102 | Ga0081455_10120016 | 3300005937 | Bacteria | 2073 |
| 103 | Ga0081455_10142346 | 3300005937 | Bacteria | 1860 |
| 104 | Ga0081455_10166874 | 3300005937 | Bacteria | 1681 |
| 105 | Ga0081538_10000021 | 3300005981 | Bacteria | 138488 |
| 106 | Ga0081538_10000353 | 3300005981 | Bacteria | 52501 |
| 107 | Ga0081538_10057974 | 3300005981 | Bacteria | 2250 |
| 108 | Ga0081538_10091189 | 3300005981 | Bacteria | 1574 |
| 109 | Ga0081538_10091839 | 3300005981 | Bacteria | 1566 |
| 110 | Ga0081538_10094284 | 3300005981 | Bacteria | 1533 |
| 111 | Ga0081538_10146035 | 3300005981 | Bacteria | 1081 |
| 112 | Ga0081540_1043706 | 3300005983 | Bacteria | 2295 |
| 113 | Ga0081539_10002270 | 3300005985 | Bacteria | 27882 |
| 114 | Ga0081539_10006008 | 3300005985 | Bacteria | 11927 |
| 115 | Ga0081539_10033238 | 3300005985 | Bacteria | 3145 |
| 116 | Ga0070717_10160923 | 3300006028 | Bacteria | 1947 |
| 117 | Ga0075365_10042099 | 3300006038 | Bacteria | 2985 |
| 118 | Ga0075363_100193238 | 3300006048 | Bacteria | 1161 |
| 119 | Ga0075364_10024550 | 3300006051 | Bacteria | 3830 |
| 120 | Ga0075364_10132281 | 3300006051 | Bacteria | 1675 |
| 121 | Ga0075364_10598441 | 3300006051 | Bacteria | 753 |
| 122 | Ga0075432_10021722 | 3300006058 | Bacteria | 2194 |
| 123 | Ga0070716_100063407 | 3300006173 | Bacteria | 2145 |
| 124 | Ga0075369_10466967 | 3300006186 | Bacteria | 598 |
| 125 | Ga0075427_10044144 | 3300006194 | Bacteria | 757 |
| 126 | Ga0097621_101734155 | 3300006237 | Bacteria | 595 |
| 127 | Ga0068871_101114387 | 3300006358 | Bacteria | 738 |
| 128 | Ga0075428_100027657 | 3300006844 | Bacteria | 6273 |
| 129 | Ga0075428_100533610 | 3300006844 | Bacteria | 1255 |
| 130 | Ga0075428_100685934 | 3300006844 | Unclassified | 1091 |
| 131 | Ga0075428_102060083 | 3300006844 | Bacteria | 591 |
| 132 | Ga0075430_100003194 | 3300006846 | Bacteria | 13728 |
| 133 | Ga0075430_100047186 | 3300006846 | Bacteria | 3637 |
| 134 | Ga0075430_100346266 | 3300006846 | Bacteria | 1227 |
| 135 | Ga0075430_100811002 | 3300006846 | Bacteria | 771 |
| 136 | Ga0075430_101562207 | 3300006846 | Bacteria | 542 |
| 137 | Ga0075431_100005917 | 3300006847 | Bacteria | 12098 |
| 138 | Ga0075431_100159360 | 3300006847 | Bacteria | 2321 |
| 139 | Ga0075431_100314155 | 3300006847 | Bacteria | 1581 |
| 140 | Ga0075433_10016161 | 3300006852 | Bacteria | 6140 |
| 141 | Ga0075433_10397043 | 3300006852 | Bacteria | 1217 |
| 142 | Ga0075434_100188077 | 3300006871 | Unclassified | 2085 |
| 143 | Ga0075434_100454074 | 3300006871 | Bacteria | 1303 |
| 144 | Ga0075429_100125435 | 3300006880 | Bacteria | 2245 |
| 145 | Ga0075429_100165003 | 3300006880 | Bacteria | 1940 |
| 146 | Ga0075429_100240030 | 3300006880 | Bacteria | 1587 |
| 147 | Ga0068865_100592666 | 3300006881 | Bacteria | 936 |
| 148 | Ga0068865_101132910 | 3300006881 | Bacteria | 690 |
| 149 | Ga0075435_100912823 | 3300007076 | Bacteria | 766 |
| 150 | Ga0111539_10025045 | 3300009094 | Bacteria | 7313 |
| 151 | Ga0111539_10449923 | 3300009094 | Bacteria | 1500 |
| 152 | Ga0111539_11571193 | 3300009094 | Bacteria | 763 |
| 153 | Ga0111539_11589686 | 3300009094 | Bacteria | 758 |
| 154 | Ga0111539_11667775 | 3300009094 | Bacteria | 739 |
| 155 | Ga0111539_11741811 | 3300009094 | Bacteria | 722 |
| 156 | Ga0111539_12000593 | 3300009094 | Bacteria | 672 |
| 157 | Ga0105245_10128194 | 3300009098 | Bacteria | 2377 |
| 158 | Ga0105247_11577100 | 3300009101 | Bacteria | 538 |
| 159 | Ga0114129_10202515 | 3300009147 | Bacteria | 2687 |
| 160 | Ga0114129_10284003 | 3300009147 | Bacteria | 2211 |
| 161 | Ga0114129_10304614 | 3300009147 | Bacteria | 2122 |
| 162 | Ga0114129_10559141 | 3300009147 | Bacteria | 1487 |
| 163 | Ga0114129_10692124 | 3300009147 | Bacteria | 1311 |
| 164 | Ga0114129_10844099 | 3300009147 | Bacteria | 1165 |
| 165 | Ga0105243_10027123 | 3300009148 | Bacteria | 4387 |
| 166 | Ga0105243_10049893 | 3300009148 | Bacteria | 3304 |
| 167 | Ga0105243_10535869 | 3300009148 | Bacteria | 1116 |
| 168 | Ga0105243_13045395 | 3300009148 | Bacteria | 508 |
| 169 | Ga0105248_10153693 | 3300009177 | Bacteria | 2596 |
| 170 | Ga0105248_10294931 | 3300009177 | Bacteria | 1826 |
| 171 | Ga0105248_11502830 | 3300009177 | Bacteria | 762 |
| 172 | Ga0105237_10085990 | 3300009545 | Bacteria | 3134 |
| 173 | Ga0105238_10000248 | 3300009551 | Bacteria | 60289 |
| 174 | Ga0105238_11316716 | 3300009551 | Bacteria | 748 |
| 175 | Ga0105249_10400604 | 3300009553 | Bacteria | 1403 |
| 176 | Ga0105249_10463457 | 3300009553 | Bacteria | 1308 |
| 177 | Ga0105249_12313055 | 3300009553 | Bacteria | 610 |
| 178 | Ga0105239_10568967 | 3300010375 | Bacteria | 1291 |
| 179 | Ga0105239_10975970 | 3300010375 | Bacteria | 974 |
| 180 | Ga0105246_10156181 | 3300011119 | Bacteria | 1733 |
| 181 | Ga0157371_10032288 | 3300013102 | Bacteria | 3768 |
| 182 | Ga0157370_10325470 | 3300013104 | Bacteria | 1417 |
| 183 | Ga0157370_10482816 | 3300013104 | Bacteria | 1139 |
| 184 | Ga0157369_10000393 | 3300013105 | Bacteria | 58167 |
| 185 | Ga0157369_10005654 | 3300013105 | Bacteria | 14525 |
| 186 | Ga0157369_10529178 | 3300013105 | Bacteria | 1219 |
| 187 | Ga0157369_11037339 | 3300013105 | Unclassified | 839 |
| 188 | Ga0157374_10634244 | 3300013296 | Bacteria | 1080 |
| 189 | Ga0157374_11339368 | 3300013296 | Bacteria | 738 |
| 190 | Ga0163162_10080807 | 3300013306 | Bacteria | 3320 |
| 191 | Ga0163162_10201724 | 3300013306 | Bacteria | 2118 |
| 192 | Ga0163162_10261469 | 3300013306 | Bacteria | 1862 |
| 193 | Ga0163162_10551516 | 3300013306 | Bacteria | 1281 |
| 194 | Ga0163162_13231724 | 3300013306 | Bacteria | 523 |
| 195 | Ga0157372_10000034 | 3300013307 | Bacteria | 174784 |
| 196 | Ga0157372_10586926 | 3300013307 | Bacteria | 1299 |
| 197 | Ga0157372_10936721 | 3300013307 | Bacteria | 1004 |
| 198 | Ga0157372_11812149 | 3300013307 | Bacteria | 702 |
| 199 | Ga0157375_10162961 | 3300013308 | Bacteria | 2373 |
| 200 | Ga0157375_10366868 | 3300013308 | Bacteria | 1606 |
| 201 | Ga0157375_10668985 | 3300013308 | Bacteria | 1193 |
| 202 | Ga0157375_10841606 | 3300013308 | Bacteria | 1064 |
| 203 | Ga0157375_11152563 | 3300013308 | Bacteria | 908 |
| 204 | Ga0163163_10792081 | 3300014325 | Bacteria | 1011 |
| 205 | Ga0163163_11766053 | 3300014325 | Bacteria | 679 |
| 206 | Ga0157380_10045675 | 3300014326 | Bacteria | 3439 |
| 207 | Ga0157380_10235508 | 3300014326 | Bacteria | 1647 |
| 208 | Ga0157380_11250606 | 3300014326 | Bacteria | 788 |
| 209 | Ga0157377_10021633 | 3300014745 | Bacteria | 3385 |
| 210 | Ga0157377_10074830 | 3300014745 | Bacteria | 1965 |
| 211 | Ga0157377_10678981 | 3300014745 | Bacteria | 745 |
| 212 | Ga0157376_11024196 | 3300014969 | Bacteria | 849 |
| 213 | Ga0197907_10057455 | 3300020069 | Bacteria | 635 |
| 214 | Ga0206356_10248501 | 3300020070 | Bacteria | 2209 |
| 215 | Ga0206351_10146550 | 3300020077 | Bacteria | 874 |
| 216 | Ga0206352_11312785 | 3300020078 | Bacteria | 670 |
| 217 | Ga0206354_11555507 | 3300020081 | Bacteria | 1846 |
| 218 | Ga0207688_10169842 | 3300025901 | Bacteria | 1296 |
| 219 | Ga0207688_10567349 | 3300025901 | Bacteria | 714 |
| 220 | Ga0207688_10863034 | 3300025901 | Bacteria | 573 |
| 221 | Ga0207647_10137471 | 3300025904 | Bacteria | 1433 |
| 222 | Ga0207643_10044633 | 3300025908 | Bacteria | 2502 |
| 223 | Ga0207643_10575349 | 3300025908 | Bacteria | 724 |
| 224 | Ga0207705_10014201 | 3300025909 | Bacteria | 5737 |
| 225 | Ga0207705_10590216 | 3300025909 | Bacteria | 864 |
| 226 | Ga0207684_10003088 | 3300025910 | Bacteria | 16449 |
| 227 | Ga0207684_10037108 | 3300025910 | Bacteria | 4136 |
| 228 | Ga0207662_11053599 | 3300025918 | Unclassified | 578 |
| 229 | Ga0207657_10212583 | 3300025919 | Bacteria | 1552 |
| 230 | Ga0207657_10627041 | 3300025919 | Bacteria | 838 |
| 231 | Ga0207649_10053522 | 3300025920 | Bacteria | 2508 |
| 232 | Ga0207652_10069339 | 3300025921 | Bacteria | 3061 |
| 233 | Ga0207646_10000096 | 3300025922 | Bacteria | 117197 |
| 234 | Ga0207646_11125941 | 3300025922 | Unclassified | 690 |
| 235 | Ga0207694_10000814 | 3300025924 | Bacteria | 27898 |
| 236 | Ga0207650_10707866 | 3300025925 | Bacteria | 851 |
| 237 | Ga0207659_10676550 | 3300025926 | Bacteria | 883 |
| 238 | Ga0207659_11180183 | 3300025926 | Bacteria | 658 |
| 239 | Ga0207659_11779542 | 3300025926 | Bacteria | 524 |
| 240 | Ga0207687_10205290 | 3300025927 | Bacteria | 1543 |
| 241 | Ga0207700_10037916 | 3300025928 | Bacteria | 3495 |
| 242 | Ga0207664_10105345 | 3300025929 | Bacteria | 2337 |
| 243 | Ga0207664_11444972 | 3300025929 | Unclassified | 609 |
| 244 | Ga0207709_10076390 | 3300025935 | Bacteria | 2144 |
| 245 | Ga0207709_10233447 | 3300025935 | Bacteria | 1334 |
| 246 | Ga0207709_11001418 | 3300025935 | Bacteria | 683 |
| 247 | Ga0207669_10003482 | 3300025937 | Bacteria | 6809 |
| 248 | Ga0207669_10330235 | 3300025937 | Bacteria | 1170 |
| 249 | Ga0207704_10198568 | 3300025938 | Bacteria | 1466 |
| 250 | Ga0207704_10636799 | 3300025938 | Bacteria | 877 |
| 251 | Ga0207691_10055564 | 3300025940 | Bacteria | 3607 |
| 252 | Ga0207691_10418588 | 3300025940 | Bacteria | 1142 |
| 253 | Ga0207691_11255812 | 3300025940 | Bacteria | 613 |
| 254 | Ga0207711_10395398 | 3300025941 | Bacteria | 1284 |
| 255 | Ga0207689_10874868 | 3300025942 | Bacteria | 758 |
| 256 | Ga0207689_11539452 | 3300025942 | Bacteria | 555 |
| 257 | Ga0207661_10009084 | 3300025944 | Bacteria | 7122 |
| 258 | Ga0207661_10142371 | 3300025944 | Bacteria | 2065 |
| 259 | Ga0207661_10201566 | 3300025944 | Bacteria | 1750 |
| 260 | Ga0207661_10290660 | 3300025944 | Bacteria | 1463 |
| 261 | Ga0207661_10421951 | 3300025944 | Bacteria | 1212 |
| 262 | Ga0207679_10615263 | 3300025945 | Bacteria | 980 |
| 263 | Ga0207667_10097975 | 3300025949 | Bacteria | 3026 |
| 264 | Ga0207651_10263670 | 3300025960 | Bacteria | 1416 |
| 265 | Ga0207712_10229545 | 3300025961 | Bacteria | 1489 |
| 266 | Ga0207712_10948571 | 3300025961 | Bacteria | 762 |
| 267 | Ga0207668_10131176 | 3300025972 | Bacteria | 1914 |
| 268 | Ga0207668_10144749 | 3300025972 | Bacteria | 1832 |
| 269 | Ga0207668_10259329 | 3300025972 | Bacteria | 1416 |
| 270 | Ga0207668_10292032 | 3300025972 | Bacteria | 1342 |
| 271 | Ga0207640_10187648 | 3300025981 | Bacteria | 1556 |
| 272 | Ga0207677_11228368 | 3300026023 | Bacteria | 687 |
| 273 | Ga0207703_12427624 | 3300026035 | Bacteria | 500 |
| 274 | Ga0207678_10011687 | 3300026067 | Bacteria | 7708 |
| 275 | Ga0207678_10226404 | 3300026067 | Bacteria | 1601 |
| 276 | Ga0207708_10041438 | 3300026075 | Bacteria | 3511 |
| 277 | Ga0207708_10193789 | 3300026075 | Bacteria | 1619 |
| 278 | Ga0207708_10254252 | 3300026075 | Bacteria | 1417 |
| 279 | Ga0207702_10310155 | 3300026078 | Bacteria | 1500 |
| 280 | Ga0207676_11406932 | 3300026095 | Bacteria | 693 |
| 281 | Ga0207674_10200596 | 3300026116 | Bacteria | 1944 |
| 282 | Ga0207675_100065615 | 3300026118 | Bacteria | 3393 |
| 283 | Ga0207675_100072031 | 3300026118 | Bacteria | 3231 |
| 284 | Ga0207675_100341587 | 3300026118 | Bacteria | 1466 |
| 285 | Ga0207675_101963430 | 3300026118 | Bacteria | 603 |
| 286 | Ga0207683_10178714 | 3300026121 | Bacteria | 1924 |
| 287 | Ga0207683_10576945 | 3300026121 | Bacteria | 1040 |
| 288 | Ga0207683_10742838 | 3300026121 | Bacteria | 910 |
| 289 | Ga0207698_10444275 | 3300026142 | Bacteria | 1250 |
| 290 | Ga0207698_12490993 | 3300026142 | Bacteria | 528 |
| 291 | Ga0209974_10317046 | 3300027876 | Bacteria | 599 |
| 292 | Ga0207428_10045877 | 3300027907 | Bacteria | 3517 |
| 293 | Ga0207428_10264939 | 3300027907 | Bacteria | 1279 |
| 294 | Ga0268266_10211279 | 3300028379 | Bacteria | 1780 |
| 295 | Ga0268266_10272209 | 3300028379 | Bacteria | 1572 |
| 296 | Ga0268264_10380543 | 3300028381 | Bacteria | 1351 |
| 297 | Ga0307408_100080031 | 3300031548 | Bacteria | 2440 |
| 298 | Ga0307508_10405683 | 3300031616 | Bacteria | 954 |
| 299 | Ga0307405_10037357 | 3300031731 | Bacteria | 2918 |
| 300 | Ga0307405_10167849 | 3300031731 | Bacteria | 1562 |
| 301 | Ga0307405_10274059 | 3300031731 | Bacteria | 1267 |
| 302 | Ga0307405_10562399 | 3300031731 | Bacteria | 925 |
| 303 | Ga0307413_10181759 | 3300031824 | Bacteria | 1500 |
| 304 | Ga0307413_10219847 | 3300031824 | Bacteria | 1387 |
| 305 | Ga0307410_10817600 | 3300031852 | Bacteria | 794 |
| 306 | Ga0307410_11645206 | 3300031852 | Bacteria | 568 |
| 307 | Ga0307406_10000435 | 3300031901 | Bacteria | 24366 |
| 308 | Ga0307406_10168389 | 3300031901 | Bacteria | 1583 |
| 309 | Ga0307406_10189728 | 3300031901 | Bacteria | 1503 |
| 310 | Ga0307406_10247389 | 3300031901 | Bacteria | 1341 |
| 311 | Ga0307406_10386652 | 3300031901 | Bacteria | 1105 |
| 312 | Ga0307406_11943253 | 3300031901 | Bacteria | 525 |
| 313 | Ga0307407_10221237 | 3300031903 | Bacteria | 1280 |
| 314 | Ga0307407_10351992 | 3300031903 | Bacteria | 1043 |
| 315 | Ga0307412_11112290 | 3300031911 | Bacteria | 704 |
| 316 | Ga0307412_11440727 | 3300031911 | Bacteria | 624 |
| 317 | Ga0307409_100027473 | 3300031995 | Bacteria | 4034 |
| 318 | Ga0307409_100035148 | 3300031995 | Bacteria | 3668 |
| 319 | Ga0307409_100131689 | 3300031995 | Bacteria | 2138 |
| 320 | Ga0307409_100345924 | 3300031995 | Bacteria | 1401 |
| 321 | Ga0307409_100758537 | 3300031995 | Bacteria | 975 |
| 322 | Ga0307409_101183705 | 3300031995 | Bacteria | 787 |
| 323 | Ga0307416_100034612 | 3300032002 | Bacteria | 3846 |
| 324 | Ga0307416_100257621 | 3300032002 | Bacteria | 1703 |
| 325 | Ga0307416_100422906 | 3300032002 | Bacteria | 1377 |
| 326 | Ga0307416_100463950 | 3300032002 | Bacteria | 1322 |
| 327 | Ga0307416_100612889 | 3300032002 | Bacteria | 1170 |
| 328 | Ga0307416_100783551 | 3300032002 | Bacteria | 1048 |
| 329 | Ga0307416_101463507 | 3300032002 | Bacteria | 789 |
| 330 | Ga0307416_102248474 | 3300032002 | Bacteria | 646 |
| 331 | Ga0307414_10138243 | 3300032004 | Bacteria | 1903 |
| 332 | Ga0307414_10235890 | 3300032004 | Bacteria | 1511 |
| 333 | Ga0307414_12159143 | 3300032004 | Bacteria | 520 |
| 334 | Ga0307411_10274266 | 3300032005 | Bacteria | 1339 |
| 335 | Ga0307411_10835040 | 3300032005 | Bacteria | 814 |
| 336 | Ga0307411_11604080 | 3300032005 | Bacteria | 600 |
| 337 | Ga0307415_100004962 | 3300032126 | Bacteria | 7001 |
| 338 | Ga0307415_100016891 | 3300032126 | Bacteria | 4363 |
| 339 | Ga0307415_100215673 | 3300032126 | Bacteria | 1535 |
| 340 | Ga0307415_100366872 | 3300032126 | Bacteria | 1218 |
| 341 | Ga0307415_100501880 | 3300032126 | Bacteria | 1061 |
| 342 | Ga0307415_100697659 | 3300032126 | Bacteria | 915 |
| 343 | Ga0307415_100742041 | 3300032126 | Bacteria | 890 |
| 344 | Ga0307415_101316278 | 3300032126 | Bacteria | 685 |
| 345 | Ga0373956_0016532 | 3300035119 | Bacteria | 3100 |
| 346 | Ga0373955_0007506 | 3300035172 | Bacteria | 5015 |
| 347 | Ga0373933_0050302 | 3300035724 | Bacteria | 2487 |
| 348 | Ga0373937_0024203 | 3300036401 | Bacteria | 5474 |
| 349 | Ga0373925_0006813 | 3300037068 | Bacteria | 8366 |
| 350 | Ga0373925_0023114 | 3300037068 | Bacteria | 4536 |
| 351 | Ga0395899_0000182 | 3300037312 | Bacteria | 92470 |
| 352 | Ga0395899_0028975 | 3300037312 | Bacteria | 4165 |
| 353 | Ga0395899_0195150 | 3300037312 | Bacteria | 1415 |
| 354 | Ga0395900_0017479 | 3300037418 | Bacteria | 7320 |
| 355 | Ga0395900_0058297 | 3300037418 | Bacteria | 3975 |
| 356 | Ga0395900_0144161 | 3300037418 | Bacteria | 2437 |
| 357 | Ga0395900_0244373 | 3300037418 | Bacteria | 1799 |
| 358 | Ga0395900_0357575 | 3300037418 | Bacteria | 1432 |
| 359 | Ga0395900_0369486 | 3300037418 | Bacteria | 1404 |
| 360 | Ga0395900_0551491 | 3300037418 | Bacteria | 1097 |
| 361 | Ga0395900_1445838 | 3300037418 | Bacteria | 600 |
| 362 | Ga0395898_0048071 | 3300037466 | Bacteria | 4185 |
| 363 | Ga0395898_0059776 | 3300037466 | Bacteria | 3706 |
| 364 | Ga0395898_0078126 | 3300037466 | Bacteria | 3194 |
| 365 | Ga0395898_0251090 | 3300037466 | Bacteria | 1687 |
| 366 | Ga0395898_0288290 | 3300037466 | Bacteria | 1566 |
| 367 | Ga0395898_0372506 | 3300037466 | Bacteria | 1362 |
| 368 | Ga0395898_0748088 | 3300037466 | Bacteria | 919 |
| 369 | Ga0395898_1137370 | 3300037466 | Bacteria | 713 |
| 370 | Ga0395898_1635104 | 3300037466 | Bacteria | 568 |
| 371 | Ga0395905_0031454 | 3300037471 | Bacteria | 4997 |
| 372 | Ga0395905_0078883 | 3300037471 | Bacteria | 3086 |
| 373 | Ga0395905_0458884 | 3300037471 | Bacteria | 1172 |
| 374 | Ga0395905_0632932 | 3300037471 | Bacteria | 972 |
| 375 | Ga0395905_1005070 | 3300037471 | Bacteria | 737 |
| 376 | Ga0395905_1192430 | 3300037471 | Bacteria | 665 |
| 377 | Ga0395905_1222968 | 3300037471 | Bacteria | 655 |
| 378 | Ga0436364_0957520 | 3300037853 | Bacteria | 4465 |
| 379 | Ga0395901_0020985 | 3300038443 | Bacteria | 6692 |
| 380 | Ga0395901_0038248 | 3300038443 | Bacteria | 4963 |
| 381 | Ga0395901_0050343 | 3300038443 | Bacteria | 4329 |
| 382 | Ga0395901_0080880 | 3300038443 | Bacteria | 3393 |
| 383 | Ga0395901_0204838 | 3300038443 | Bacteria | 2067 |
| 384 | Ga0395901_0371480 | 3300038443 | Bacteria | 1473 |
| 385 | Ga0395901_0405133 | 3300038443 | Bacteria | 1401 |
| 386 | Ga0395901_0428047 | 3300038443 | Bacteria | 1356 |
| 387 | Ga0395901_0494412 | 3300038443 | Bacteria | 1246 |
| 388 | Ga0395901_0797420 | 3300038443 | Bacteria | 934 |
| 389 | Ga0439453_0002006 | 3300041408 | Bacteria | 2738 |
| 390 | Ga0439465_0090612 | 3300041413 | Bacteria | 1046 |
| 391 | Ga0451802_0922775 | 3300041460 | Bacteria | 700 |
| 392 | Ga0451845_0928093 | 3300041501 | Bacteria | 767 |
| 393 | Ga0451843_1210050 | 3300041509 | Unclassified | 690 |
| 394 | Ga0451853_0368024 | 3300041512 | Bacteria | 645 |
| 395 | Ga0451853_1546664 | 3300041512 | Unclassified | 802 |
| 396 | Ga0451853_3985726 | 3300041512 | Bacteria | 680 |
| 397 | Ga0439449_0155469 | 3300042007 | Bacteria | 853 |
| 398 | Ga0439449_0160627 | 3300042007 | Bacteria | 839 |
| 399 | Ga0439451_013023 | 3300042009 | Bacteria | 1680 |
| 400 | Ga0439451_117251 | 3300042009 | Bacteria | 541 |
| 401 | Ga0439454_000186 | 3300042011 | Bacteria | 4346 |
| 402 | Ga0439456_047142 | 3300042013 | Bacteria | 939 |
| 403 | Ga0439435_0104773 | 3300042436 | Bacteria | 873 |
| 404 | Ga0439464_0053624 | 3300042439 | Bacteria | 1170 |
| 405 | Ga0466966_0011419 | 3300044684 | Bacteria | 5891 |
| 406 | Ga0466961_0304093 | 3300044693 | Bacteria | 974 |
| 407 | Ga0466970_0068293 | 3300044765 | Bacteria | 1910 |
| 408 | Ga0466970_0130148 | 3300044765 | Bacteria | 1382 |
| 409 | Ga0466960_0019661 | 3300044901 | Bacteria | 2979 |
| 410 | Ga0466960_0283302 | 3300044901 | Bacteria | 929 |
| 411 | Ga0495627_000603 | 3300046453 | Bacteria | 28682 |
| 412 | Ga0495603_0048547 | 3300046455 | Bacteria | 2528 |
| 413 | Ga0495629_0438455 | 3300046459 | Bacteria | 885 |
| 414 | Ga0495629_0506098 | 3300046459 | Bacteria | 814 |
| 415 | Ga0495638_0135607 | 3300046460 | Bacteria | 1442 |
| 416 | Ga0495641_0072140 | 3300046461 | Bacteria | 1550 |
| 417 | Ga0495651_0001161 | 3300046462 | Bacteria | 20345 |
| 418 | Ga0495653_0059664 | 3300046463 | Bacteria | 2894 |
| 419 | Ga0495653_0260712 | 3300046463 | Bacteria | 1146 |
| 420 | Ga0495582_0260151 | 3300046473 | Bacteria | 996 |
| 421 | Ga0495662_0197737 | 3300046476 | Bacteria | 991 |
| 422 | Ga0495664_0105564 | 3300046477 | Bacteria | 1698 |
| 423 | Ga0495608_0000210 | 3300046511 | Bacteria | 42105 |
| 424 | Ga0495608_0296677 | 3300046511 | Bacteria | 1001 |
| 425 | Ga0495618_0029610 | 3300046514 | Bacteria | 3416 |
| 426 | Ga0495628_0037958 | 3300046516 | Bacteria | 3859 |
| 427 | Ga0495628_0301762 | 3300046516 | Bacteria | 1185 |
| 428 | Ga0495630_0002090 | 3300046517 | Bacteria | 13893 |
| 429 | Ga0495652_0014485 | 3300046529 | Bacteria | 7077 |
| 430 | Ga0495652_0116652 | 3300046529 | Bacteria | 2137 |
| 431 | Ga0495640_0035580 | 3300046533 | Bacteria | 3524 |
| 432 | Ga0495587_0020463 | 3300046536 | Bacteria | 4084 |
| 433 | Ga0495645_0007961 | 3300046543 | Bacteria | 7377 |
| 434 | Ga0495645_0120740 | 3300046543 | Bacteria | 1845 |
| 435 | Ga0495633_0000152 | 3300046558 | Bacteria | 91044 |
| 436 | Ga0495667_0013576 | 3300046559 | Bacteria | 5509 |
| 437 | Ga0495656_0199118 | 3300046615 | Bacteria | 993 |
| 438 | Ga0495634_0096424 | 3300046642 | Bacteria | 1915 |
| 439 | Ga0495635_0020024 | 3300046663 | Bacteria | 4662 |
| 440 | Ga0495635_0302855 | 3300046663 | Bacteria | 1071 |
| 441 | Ga0495657_0013341 | 3300046675 | Bacteria | 6068 |
| 442 | Ga0495657_0021162 | 3300046675 | Bacteria | 4668 |
| 443 | Ga0495599_0102357 | 3300046678 | Bacteria | 1785 |
| 444 | Ga0495623_0077114 | 3300046679 | Bacteria | 2067 |
| 445 | Ga0495658_0655560 | 3300046683 | Bacteria | 672 |
| 446 | Ga0495613_0829293 | 3300046689 | Bacteria | 602 |
| 447 | Ga0495624_0780866 | 3300046690 | Bacteria | 565 |
| 448 | Ga0495671_0326414 | 3300046692 | Bacteria | 737 |
| 449 | Ga0495600_0022163 | 3300046809 | Bacteria | 4076 |
| 450 | Ga0495581_0467842 | 3300047315 | Bacteria | 734 |
| 451 | Ga0495581_0787833 | 3300047315 | Bacteria | 546 |
| 452 | Ga0495604_0008487 | 3300047317 | Bacteria | 8109 |
| 453 | Ga0495674_0008894 | 3300047319 | Bacteria | 9550 |
| 454 | Ga0495672_0101106 | 3300047320 | Bacteria | 1563 |
| 455 | Ga0495676_0328206 | 3300047321 | Bacteria | 1027 |
| 456 | Ga0495680_0039625 | 3300047322 | Bacteria | 3756 |
| 457 | Ga0495680_0970743 | 3300047322 | Bacteria | 545 |
| 458 | Ga0495675_0017229 | 3300047444 | Bacteria | 4577 |
| 459 | Ga0495684_0024249 | 3300047471 | Bacteria | 4669 |
| 460 | Ga0495593_0321630 | 3300047673 | Bacteria | 773 |
| 461 | Ga0495593_0451962 | 3300047673 | Bacteria | 643 |
| 462 | Ga0495602_0088890 | 3300048088 | Bacteria | 2570 |
| 463 | Ga0496100_0020159 | 3300048903 | Bacteria | 3993 |
| 464 | Ga0496100_0611816 | 3300048903 | Bacteria | 847 |
| 465 | Ga0496101_0377369 | 3300048904 | Bacteria | 1115 |
| 466 | Ga0496102_0805644 | 3300048905 | Bacteria | 861 |
| 467 | Ga0496103_0412726 | 3300048906 | Bacteria | 867 |
| 468 | Ga0496103_0452843 | 3300048906 | Bacteria | 823 |
| 469 | Ga0496103_0475670 | 3300048906 | Bacteria | 800 |
| 470 | Ga0496103_0651391 | 3300048906 | Bacteria | 669 |
| 471 | Ga0496103_0904591 | 3300048906 | Bacteria | 553 |
| 472 | Ga0496104_0015898 | 3300048907 | Bacteria | 6829 |
| 473 | Ga0496104_0035111 | 3300048907 | Bacteria | 4680 |
| 474 | Ga0496104_0168127 | 3300048907 | Bacteria | 2103 |
| 475 | Ga0496104_0736053 | 3300048907 | Bacteria | 893 |
| 476 | Ga0496104_1348758 | 3300048907 | Bacteria | 616 |
| 477 | Ga0496105_0035087 | 3300048908 | Bacteria | 4127 |
| 478 | Ga0496105_0354302 | 3300048908 | Bacteria | 1172 |
| 479 | Ga0496105_0459905 | 3300048908 | Bacteria | 1003 |
| 480 | Ga0496108_0022189 | 3300048911 | Bacteria | 5219 |
| 481 | Ga0496108_0062707 | 3300048911 | Bacteria | 3130 |
| 482 | Ga0496108_0161956 | 3300048911 | Bacteria | 1934 |
| 483 | Ga0496108_0236129 | 3300048911 | Bacteria | 1590 |
| 484 | Ga0496109_0405811 | 3300048912 | Bacteria | 1287 |
| 485 | Ga0496109_0759482 | 3300048912 | Bacteria | 907 |
| 486 | Ga0496110_0186345 | 3300048913 | Bacteria | 1884 |
| 487 | Ga0496110_0342490 | 3300048913 | Bacteria | 1362 |
| 488 | Ga0496110_1084857 | 3300048913 | Bacteria | 709 |
| 489 | Ga0496111_0221141 | 3300048914 | Bacteria | 1407 |
| 490 | Ga0496111_0624328 | 3300048914 | Bacteria | 788 |
| 491 | Ga0496112_0046725 | 3300048915 | Bacteria | 4247 |
| 492 | Ga0496113_0029530 | 3300048916 | Bacteria | 3961 |
| 493 | Ga0496113_0068239 | 3300048916 | Bacteria | 2698 |
| 494 | Ga0496113_0407548 | 3300048916 | Bacteria | 1092 |
| 495 | Ga0496114_0028131 | 3300048917 | Bacteria | 4610 |
| 496 | Ga0496114_0243841 | 3300048917 | Bacteria | 1580 |
| 497 | Ga0496114_1528997 | 3300048917 | Bacteria | 555 |
| 498 | Ga0496117_0432116 | 3300048920 | Bacteria | 656 |
| 499 | Ga0496119_0209430 | 3300048922 | Bacteria | 1004 |
| 500 | Ga0496121_0000462 | 3300048924 | Bacteria | 79882 |
| 501 | Ga0496126_0015392 | 3300048929 | Bacteria | 7695 |
| 502 | Ga0501307_058698 | 3300049162 | Bacteria | 593 |
| 503 | Ga0501031_0296984 | 3300049568 | Bacteria | 1047 |
| 504 | Ga0501031_0420405 | 3300049568 | Bacteria | 864 |
| 505 | Ga0501031_0710353 | 3300049568 | Bacteria | 645 |
| 506 | Ga0501034_0588578 | 3300049571 | Bacteria | 1019 |
| 507 | Ga0501034_1568310 | 3300049571 | Bacteria | 532 |
| 508 | Ga0501036_0297305 | 3300049572 | Bacteria | 1350 |
| 509 | Ga0501036_1646473 | 3300049572 | Bacteria | 518 |
| 510 | Ga0501037_0566058 | 3300049573 | Bacteria | 766 |
| 511 | Ga0501038_0142536 | 3300049574 | Bacteria | 1959 |
| 512 | Ga0501038_1086101 | 3300049574 | Unclassified | 585 |
| 513 | Ga0501039_0396788 | 3300049575 | Bacteria | 1083 |
| 514 | Ga0501039_0739362 | 3300049575 | Bacteria | 768 |
| 515 | Ga0501040_0565936 | 3300049576 | Bacteria | 820 |
| 516 | Ga0501040_0606556 | 3300049576 | Bacteria | 791 |
| 517 | Ga0501040_0848427 | 3300049576 | Bacteria | 661 |
| 518 | Ga0501041_0044889 | 3300049577 | Bacteria | 2686 |
| 519 | Ga0501041_0071147 | 3300049577 | Bacteria | 2136 |
| 520 | Ga0501041_0550568 | 3300049577 | Bacteria | 735 |
| 521 | Ga0501041_0680642 | 3300049577 | Bacteria | 658 |
| 522 | Ga0501041_0989382 | 3300049577 | Bacteria | 541 |
| 523 | Ga0501042_0199104 | 3300049578 | Bacteria | 1444 |
| 524 | Ga0501042_0267056 | 3300049578 | Bacteria | 1235 |
| 525 | Ga0501042_0347525 | 3300049578 | Bacteria | 1073 |
| 526 | Ga0501042_0492756 | 3300049578 | Bacteria | 890 |
| 527 | Ga0501042_0756172 | 3300049578 | Bacteria | 707 |
| 528 | Ga0501043_0517424 | 3300049579 | Bacteria | 890 |
| 529 | Ga0501047_0101404 | 3300049581 | Bacteria | 2758 |
| 530 | Ga0501048_0148319 | 3300049582 | Bacteria | 1659 |
| 531 | Ga0501068_0035720 | 3300049584 | Bacteria | 2968 |
| 532 | Ga0501068_0327789 | 3300049584 | Bacteria | 982 |
| 533 | Ga0501069_0099433 | 3300049585 | Bacteria | 1651 |
| 534 | Ga0501070_0811490 | 3300049586 | Bacteria | 734 |
| 535 | Ga0501071_0011845 | 3300049587 | Bacteria | 5887 |
| 536 | Ga0501071_0120043 | 3300049587 | Bacteria | 1948 |
| 537 | Ga0501071_0410919 | 3300049587 | Bacteria | 1034 |
| 538 | Ga0501071_0483863 | 3300049587 | Bacteria | 949 |
| 539 | Ga0501071_0606729 | 3300049587 | Bacteria | 841 |
| 540 | Ga0501072_0125927 | 3300049588 | Bacteria | 2041 |
| 541 | Ga0501072_0297506 | 3300049588 | Bacteria | 1283 |
| 542 | Ga0501073_0444559 | 3300049589 | Unclassified | 896 |
| 543 | Ga0501074_0463661 | 3300049590 | Unclassified | 898 |
| 544 | Ga0501075_0021801 | 3300049591 | Bacteria | 4673 |
| 545 | Ga0501075_0705498 | 3300049591 | Unclassified | 768 |
| 546 | Ga0501076_0179595 | 3300049592 | Bacteria | 1725 |
| 547 | Ga0501076_0344961 | 3300049592 | Bacteria | 1223 |
| 548 | Ga0501076_0353632 | 3300049592 | Bacteria | 1206 |
| 549 | Ga0501076_0855024 | 3300049592 | Bacteria | 750 |
| 550 | Ga0501077_0018980 | 3300049593 | Bacteria | 4349 |
| 551 | Ga0501079_0330131 | 3300049741 | Bacteria | 1194 |
| 552 | Ga0501079_0716485 | 3300049741 | Bacteria | 787 |
| 553 | Ga0501080_1205756 | 3300049742 | Bacteria | 650 |
| 554 | Ga0501081_0021500 | 3300049743 | Bacteria | 4307 |
| 555 | Ga0501081_0439306 | 3300049743 | Unclassified | 968 |
| 556 | Ga0501035_0254346 | 3300049822 | Bacteria | 1491 |
| 557 | Ga0501035_0650122 | 3300049822 | Bacteria | 855 |
| 558 | Ga0501045_0011979 | 3300049824 | Bacteria | 6097 |
| 559 | Ga0501045_0244253 | 3300049824 | Bacteria | 1336 |
| 560 | Ga0501045_0572005 | 3300049824 | Unclassified | 837 |
| 561 | Ga0501045_0649522 | 3300049824 | Bacteria | 780 |
| 562 | Ga0501045_0704459 | 3300049824 | Bacteria | 745 |
| 563 | nmdc:mga03n38_175691_c1 | 3300050490 | Bacteria | 1094 |
| 564 | nmdc:mga00v17_13648_c1 | 3300050491 | Bacteria | 4515 |
| 565 | nmdc:mga00v17_16713_c1 | 3300050491 | Bacteria | 4138 |
| 566 | nmdc:mga00v17_507672_c1 | 3300050491 | Bacteria | 781 |
| 567 | nmdc:mga0yw44_701669_c1 | 3300050492 | Bacteria | 687 |
| 568 | nmdc:mga0yw44_977211_c1 | 3300050492 | Bacteria | 573 |
| 569 | nmdc:mga0yw44_98229_c1 | 3300050492 | Bacteria | 1861 |
| 570 | nmdc:mga05p37_1338829_c1 | 3300050507 | Bacteria | 726 |
| 571 | nmdc:mga05p37_284785_c1 | 3300050507 | Bacteria | 1969 |
| 572 | nmdc:mga05p37_288096_c1 | 3300050507 | Bacteria | 1955 |
| 573 | nmdc:mga05p37_4409_c1 | 3300050507 | Bacteria | 16450 |
| 574 | nmdc:mga05p37_673757_c2 | 3300050507 | Bacteria | 820 |
| 575 | nmdc:mga09592_299529_c1 | 3300050508 | Bacteria | 1394 |
| 576 | nmdc:mga09592_6114_c1 | 3300050508 | Bacteria | 9808 |
| 577 | nmdc:mga0qj67_200048_c1 | 3300050509 | Bacteria | 1623 |
| 578 | nmdc:mga0qj67_294038_c1 | 3300050509 | Bacteria | 1316 |
| 579 | nmdc:mga0qj67_3676_c1 | 3300050509 | Bacteria | 11072 |
| 580 | nmdc:mga06r32_1061508_c1 | 3300050510 | Unclassified | 760 |
| 581 | nmdc:mga06r32_107673_c1 | 3300050510 | Bacteria | 2739 |
| 582 | nmdc:mga06r32_352789_c1 | 3300050510 | Bacteria | 1455 |
| 583 | nmdc:mga06r32_56331_c1 | 3300050510 | Bacteria | 3774 |
| 584 | nmdc:mga08y16_161196_c1 | 3300050511 | Bacteria | 2331 |
| 585 | nmdc:mga08y16_53056_c1 | 3300050511 | Bacteria | 4241 |
| 586 | nmdc:mga0n895_298253_c1 | 3300050512 | Bacteria | 1634 |
| 587 | nmdc:mga0rr50_1187936_c1 | 3300050513 | Unclassified | 648 |
| 588 | nmdc:mga0rr50_1862274_c1 | 3300050513 | Bacteria | 506 |
| 589 | nmdc:mga0a205_21405_c1 | 3300050515 | Bacteria | 6118 |
| 590 | nmdc:mga0a205_621920_c1 | 3300050515 | Bacteria | 932 |
| 591 | nmdc:mga0sz30_421898_c1 | 3300050516 | Bacteria | 598 |
| 592 | nmdc:mga0sz30_543392_c1 | 3300050516 | Bacteria | 524 |
| 593 | Ga0495601_0008295 | 3300053077 | Bacteria | 6132 |
| 594 | Ga0495601_0059717 | 3300053077 | Bacteria | 2419 |
| 595 | Ga0495612_0081715 | 3300053078 | Bacteria | 1358 |
| 596 | Ga0495612_0121432 | 3300053078 | Bacteria | 1124 |
| 597 | Ga0495595_0013826 | 3300053084 | Bacteria | 3416 |
| 598 | Ga0495619_0108417 | 3300053085 | Bacteria | 1895 |
| 599 | Ga0495619_0255250 | 3300053085 | Bacteria | 1215 |
| 600 | Ga0500651_0190842 | 3300053093 | Unclassified | 1213 |
| 601 | Ga0500616_0029799 | 3300053153 | Bacteria | 3000 |
| 602 | Ga0501084_0054419 | 3300054114 | Bacteria | 3348 |
| 603 | Ga0501084_0213264 | 3300054114 | Bacteria | 1629 |
| 604 | Ga0501084_0714460 | 3300054114 | Bacteria | 845 |
| 605 | Ga0501084_1475821 | 3300054114 | Bacteria | 569 |
| 606 | Ga0501084_1507178 | 3300054114 | Bacteria | 563 |
| 607 | Ga0501082_0706982 | 3300060353 | Bacteria | 882 |
| 608 | Ga0530510_0006116 | 3300061734 | Bacteria | 8358 |
| 609 | Ga0530510_0696241 | 3300061734 | Bacteria | 774 |
| 610 | Ga0530510_0904226 | 3300061734 | Bacteria | 675 |
| 611 | Ga0530510_1234812 | 3300061734 | Bacteria | 573 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006038 | Ga0075365_10042099 | Ga0075365_100420994 | 113 |
| 2 | 3300006051 | Ga0075364_10132281 | Ga0075364_101322811 | 113 |
| 3 | 3300050491 | nmdc:mga00v17_16713_c1 | nmdc:mga00v17_16713_c1_1200_1589 | 113 |
| 4 | 3300050492 | nmdc:mga0yw44_98229_c1 | nmdc:mga0yw44_98229_c1_531_920 | 113 |
| 5 | 3300041460 | Ga0451802_0922775 | Ga0451802_0922775_303_650 | 114 |
| 6 | iso_pu_bacteria | 2904765812 | 2904768799 | 116 |
| 7 | iso_pu_bacteria | 2904770941 | 2904771911 | 116 |
| 8 | iso_pu_bacteria | 2908811453 | 2908812864 | 116 |
| 9 | iso_pu_bacteria | 2919420072 | 2919422160 | 116 |
| 10 | iso_pu_bacteria | 2919432681 | 2919434282 | 116 |
| 11 | iso_pu_bacteria | 2862382967 | 2862390206 | 118 |
| 12 | iso_pu_bacteria | 2863404153 | 2863411052 | 118 |
| 13 | 3300038443 | Ga0395901_0797420 | Ga0395901_0797420_549_917 | 119 |
| 14 | iso_pu_bacteria | 2947224130 | 2947232207 | 119 |
| 15 | iso_pu_bacteria | 3006486233 | 3006492786 | 119 |
| 16 | iso_pu_bacteria | 8004025490 | 8004027063 | 119 |
| 17 | 3300005471 | Ga0070698_100127283 | Ga0070698_1001272832 | 120 |
| 18 | 3300005518 | Ga0070699_100067213 | Ga0070699_1000672133 | 120 |
| 19 | 3300005937 | Ga0081455_10035272 | Ga0081455_100352727 | 120 |
| 20 | 3300005937 | Ga0081455_10142346 | Ga0081455_101423462 | 120 |
| 21 | 3300037466 | Ga0395898_0748088 | Ga0395898_0748088_239_625 | 120 |
| 22 | 3300037466 | Ga0395898_1137370 | Ga0395898_1137370_240_626 | 120 |
| 23 | 3300038443 | Ga0395901_0494412 | Ga0395901_0494412_536_922 | 120 |
| 24 | 3300041501 | Ga0451845_0928093 | Ga0451845_0928093_188_604 | 120 |
| 25 | iso_pu_bacteria | 2675903059 | 2676481495 | 120 |
| 26 | iso_pu_bacteria | 2884693830 | 2884694098 | 120 |
| 27 | iso_pu_bacteria | 2895442618 | 2895444557 | 120 |
| 28 | iso_pu_bacteria | 2919446982 | 2919450063 | 120 |
| 29 | 3300003203 | JGI25406J46586_10001433 | JGI25406J46586_100014337 | 121 |
| 30 | 3300005367 | Ga0070667_100006798 | Ga0070667_1000067983 | 121 |
| 31 | 3300005467 | Ga0070706_100136278 | Ga0070706_1001362783 | 121 |
| 32 | 3300005468 | Ga0070707_100000150 | Ga0070707_10000015072 | 121 |
| 33 | 3300005471 | Ga0070698_100001980 | Ga0070698_10000198029 | 121 |
| 34 | 3300005985 | Ga0081539_10006008 | Ga0081539_100060087 | 121 |
| 35 | 3300006028 | Ga0070717_10160923 | Ga0070717_101609232 | 121 |
| 36 | 3300025910 | Ga0207684_10003088 | Ga0207684_100030888 | 121 |
| 37 | 3300025922 | Ga0207646_10000096 | Ga0207646_1000009673 | 121 |
| 38 | 3300031901 | Ga0307406_11943253 | Ga0307406_119432531 | 121 |
| 39 | 3300031903 | Ga0307407_10351992 | Ga0307407_103519922 | 121 |
| 40 | 3300031995 | Ga0307409_100131689 | Ga0307409_1001316894 | 121 |
| 41 | 3300031995 | Ga0307409_101183705 | Ga0307409_1011837052 | 121 |
| 42 | 3300032002 | Ga0307416_100257621 | Ga0307416_1002576213 | 121 |
| 43 | 3300032004 | Ga0307414_12159143 | Ga0307414_121591431 | 121 |
| 44 | 3300032005 | Ga0307411_11604080 | Ga0307411_116040801 | 121 |
| 45 | 3300032126 | Ga0307415_100366872 | Ga0307415_1003668721 | 121 |
| 46 | 3300037418 | Ga0395900_0244373 | Ga0395900_0244373_761_1153 | 121 |
| 47 | 3300037466 | Ga0395898_0288290 | Ga0395898_0288290_220_612 | 121 |
| 48 | 3300037471 | Ga0395905_0632932 | Ga0395905_0632932_455_847 | 121 |
| 49 | 3300038443 | Ga0395901_0405133 | Ga0395901_0405133_256_645 | 121 |
| 50 | 3300046460 | Ga0495638_0135607 | Ga0495638_0135607_609_974 | 121 |
| 51 | 3300046690 | Ga0495624_0780866 | Ga0495624_0780866_109_495 | 121 |
| 52 | 3300047315 | Ga0495581_0467842 | Ga0495581_0467842_72_437 | 121 |
| 53 | 3300050492 | nmdc:mga0yw44_701669_c1 | nmdc:mga0yw44_701669_c1_125_490 | 121 |
| 54 | 3300053078 | Ga0495612_0121432 | Ga0495612_0121432_348_713 | 121 |
| 55 | 3300053085 | Ga0495619_0108417 | Ga0495619_0108417_957_1322 | 121 |
| 56 | 3300053153 | Ga0500616_0029799 | Ga0500616_0029799_1679_2044 | 121 |
| 57 | iso_pu_bacteria | 2946080515 | 2946082895 | 121 |
| 58 | 3300005544 | Ga0070686_100629981 | Ga0070686_1006299811 | 122 |
| 59 | 3300005844 | Ga0068862_100872698 | Ga0068862_1008726982 | 122 |
| 60 | 3300005937 | Ga0081455_10166874 | Ga0081455_101668742 | 122 |
| 61 | 3300005981 | Ga0081538_10091189 | Ga0081538_100911893 | 122 |
| 62 | 3300005981 | Ga0081538_10091839 | Ga0081538_100918393 | 122 |
| 63 | 3300005983 | Ga0081540_1043706 | Ga0081540_10437063 | 122 |
| 64 | 3300006051 | Ga0075364_10598441 | Ga0075364_105984412 | 122 |
| 65 | 3300006058 | Ga0075432_10021722 | Ga0075432_100217223 | 122 |
| 66 | 3300006194 | Ga0075427_10044144 | Ga0075427_100441442 | 122 |
| 67 | 3300006846 | Ga0075430_100003194 | Ga0075430_1000031945 | 122 |
| 68 | 3300006846 | Ga0075430_100346266 | Ga0075430_1003462662 | 122 |
| 69 | 3300006847 | Ga0075431_100005917 | Ga0075431_10000591710 | 122 |
| 70 | 3300006852 | Ga0075433_10016161 | Ga0075433_100161613 | 122 |
| 71 | 3300006871 | Ga0075434_100454074 | Ga0075434_1004540743 | 122 |
| 72 | 3300006880 | Ga0075429_100165003 | Ga0075429_1001650033 | 122 |
| 73 | 3300007076 | Ga0075435_100912823 | Ga0075435_1009128232 | 122 |
| 74 | 3300009094 | Ga0111539_10025045 | Ga0111539_100250455 | 122 |
| 75 | 3300009094 | Ga0111539_11667775 | Ga0111539_116677751 | 122 |
| 76 | 3300009147 | Ga0114129_10304614 | Ga0114129_103046142 | 122 |
| 77 | 3300009551 | Ga0105238_10000248 | Ga0105238_1000024832 | 122 |
| 78 | 3300025901 | Ga0207688_10169842 | Ga0207688_101698422 | 122 |
| 79 | 3300025924 | Ga0207694_10000814 | Ga0207694_100008141 | 122 |
| 80 | 3300027907 | Ga0207428_10045877 | Ga0207428_100458772 | 122 |
| 81 | 3300031548 | Ga0307408_100080031 | Ga0307408_1000800313 | 122 |
| 82 | 3300031731 | Ga0307405_10037357 | Ga0307405_100373574 | 122 |
| 83 | 3300031731 | Ga0307405_10274059 | Ga0307405_102740592 | 122 |
| 84 | 3300031852 | Ga0307410_10817600 | Ga0307410_108176002 | 122 |
| 85 | 3300031901 | Ga0307406_10168389 | Ga0307406_101683891 | 122 |
| 86 | 3300031901 | Ga0307406_10247389 | Ga0307406_102473892 | 122 |
| 87 | 3300031903 | Ga0307407_10221237 | Ga0307407_102212372 | 122 |
| 88 | 3300031911 | Ga0307412_11440727 | Ga0307412_114407271 | 122 |
| 89 | 3300031995 | Ga0307409_100035148 | Ga0307409_1000351482 | 122 |
| 90 | 3300032002 | Ga0307416_100034612 | Ga0307416_1000346124 | 122 |
| 91 | 3300032002 | Ga0307416_101463507 | Ga0307416_1014635072 | 122 |
| 92 | 3300032004 | Ga0307414_10138243 | Ga0307414_101382433 | 122 |
| 93 | 3300032005 | Ga0307411_10835040 | Ga0307411_108350401 | 122 |
| 94 | 3300032126 | Ga0307415_100004962 | Ga0307415_1000049628 | 122 |
| 95 | 3300032126 | Ga0307415_100016891 | Ga0307415_1000168914 | 122 |
| 96 | 3300032126 | Ga0307415_101316278 | Ga0307415_1013162782 | 122 |
| 97 | 3300037312 | Ga0395899_0028975 | Ga0395899_0028975_1602_1970 | 122 |
| 98 | 3300037312 | Ga0395899_0195150 | Ga0395899_0195150_486_854 | 122 |
| 99 | 3300037418 | Ga0395900_0017479 | Ga0395900_0017479_3611_3979 | 122 |
| 100 | 3300037418 | Ga0395900_0058297 | Ga0395900_0058297_1467_1835 | 122 |
| 101 | 3300037418 | Ga0395900_0357575 | Ga0395900_0357575_744_1118 | 122 |
| 102 | 3300037418 | Ga0395900_0369486 | Ga0395900_0369486_225_593 | 122 |
| 103 | 3300037466 | Ga0395898_0048071 | Ga0395898_0048071_675_1043 | 122 |
| 104 | 3300037466 | Ga0395898_0059776 | Ga0395898_0059776_697_1065 | 122 |
| 105 | 3300037466 | Ga0395898_0078126 | Ga0395898_0078126_1716_2084 | 122 |
| 106 | 3300037466 | Ga0395898_0251090 | Ga0395898_0251090_943_1317 | 122 |
| 107 | 3300037466 | Ga0395898_1635104 | Ga0395898_1635104_124_492 | 122 |
| 108 | 3300037471 | Ga0395905_0031454 | Ga0395905_0031454_244_612 | 122 |
| 109 | 3300037471 | Ga0395905_0078883 | Ga0395905_0078883_2347_2715 | 122 |
| 110 | 3300037471 | Ga0395905_0458884 | Ga0395905_0458884_283_651 | 122 |
| 111 | 3300037471 | Ga0395905_1192430 | Ga0395905_1192430_281_649 | 122 |
| 112 | 3300038443 | Ga0395901_0020985 | Ga0395901_0020985_3729_4097 | 122 |
| 113 | 3300038443 | Ga0395901_0038248 | Ga0395901_0038248_3871_4239 | 122 |
| 114 | 3300038443 | Ga0395901_0050343 | Ga0395901_0050343_3920_4288 | 122 |
| 115 | 3300042007 | Ga0439449_0160627 | Ga0439449_0160627_427_795 | 122 |
| 116 | 3300044765 | Ga0466970_0130148 | Ga0466970_0130148_929_1297 | 122 |
| 117 | 3300046615 | Ga0495656_0199118 | Ga0495656_0199118_228_602 | 122 |
| 118 | 3300049568 | Ga0501031_0710353 | Ga0501031_0710353_103_477 | 122 |
| 119 | 3300049574 | Ga0501038_1086101 | Ga0501038_1086101_165_536 | 122 |
| 120 | 3300049577 | Ga0501041_0680642 | Ga0501041_0680642_142_513 | 122 |
| 121 | 3300049578 | Ga0501042_0756172 | Ga0501042_0756172_110_484 | 122 |
| 122 | 3300049587 | Ga0501071_0410919 | Ga0501071_0410919_70_444 | 122 |
| 123 | 3300049587 | Ga0501071_0483863 | Ga0501071_0483863_340_711 | 122 |
| 124 | 3300049588 | Ga0501072_0297506 | Ga0501072_0297506_394_810 | 122 |
| 125 | 3300049822 | Ga0501035_0650122 | Ga0501035_0650122_456_830 | 122 |
| 126 | 3300049824 | Ga0501045_0649522 | Ga0501045_0649522_340_708 | 122 |
| 127 | 3300049824 | Ga0501045_0704459 | Ga0501045_0704459_312_683 | 122 |
| 128 | 3300050491 | nmdc:mga00v17_507672_c1 | nmdc:mga00v17_507672_c1_219_620 | 122 |
| 129 | 3300050507 | nmdc:mga05p37_4409_c1 | nmdc:mga05p37_4409_c1_11732_12100 | 122 |
| 130 | 3300050508 | nmdc:mga09592_6114_c1 | nmdc:mga09592_6114_c1_1913_2281 | 122 |
| 131 | 3300050509 | nmdc:mga0qj67_3676_c1 | nmdc:mga0qj67_3676_c1_10443_10811 | 122 |
| 132 | 3300050510 | nmdc:mga06r32_56331_c1 | nmdc:mga06r32_56331_c1_828_1196 | 122 |
| 133 | 3300050511 | nmdc:mga08y16_161196_c1 | nmdc:mga08y16_161196_c1_343_711 | 122 |
| 134 | 3300050512 | nmdc:mga0n895_298253_c1 | nmdc:mga0n895_298253_c1_415_783 | 122 |
| 135 | 3300050513 | nmdc:mga0rr50_1862274_c1 | nmdc:mga0rr50_1862274_c1_112_480 | 122 |
| 136 | 3300050515 | nmdc:mga0a205_21405_c1 | nmdc:mga0a205_21405_c1_4233_4601 | 122 |
| 137 | 3300054114 | Ga0501084_1475821 | Ga0501084_1475821_87_503 | 122 |
| 138 | 3300061734 | Ga0530510_1234812 | Ga0530510_1234812_38_406 | 122 |
| 139 | iso_pu_bacteria | 2643221711 | 2644608278 | 122 |
| 140 | 3300005329 | Ga0070683_100037838 | Ga0070683_1000378382 | 123 |
| 141 | 3300005337 | Ga0070682_100097982 | Ga0070682_1000979822 | 123 |
| 142 | 3300005339 | Ga0070660_100335145 | Ga0070660_1003351453 | 123 |
| 143 | 3300005341 | Ga0070691_10255127 | Ga0070691_102551271 | 123 |
| 144 | 3300005343 | Ga0070687_101261660 | Ga0070687_1012616602 | 123 |
| 145 | 3300005345 | Ga0070692_10358584 | Ga0070692_103585842 | 123 |
| 146 | 3300005347 | Ga0070668_100552655 | Ga0070668_1005526552 | 123 |
| 147 | 3300005353 | Ga0070669_100274065 | Ga0070669_1002740653 | 123 |
| 148 | 3300005354 | Ga0070675_100670167 | Ga0070675_1006701672 | 123 |
| 149 | 3300005365 | Ga0070688_100176303 | Ga0070688_1001763032 | 123 |
| 150 | 3300005366 | Ga0070659_100066151 | Ga0070659_1000661513 | 123 |
| 151 | 3300005435 | Ga0070714_100362115 | Ga0070714_1003621152 | 123 |
| 152 | 3300005436 | Ga0070713_100078833 | Ga0070713_1000788333 | 123 |
| 153 | 3300005437 | Ga0070710_10033155 | Ga0070710_100331551 | 123 |
| 154 | 3300005438 | Ga0070701_10403664 | Ga0070701_104036642 | 123 |
| 155 | 3300005438 | Ga0070701_10497148 | Ga0070701_104971481 | 123 |
| 156 | 3300005441 | Ga0070700_100021958 | Ga0070700_1000219586 | 123 |
| 157 | 3300005441 | Ga0070700_100204794 | Ga0070700_1002047942 | 123 |
| 158 | 3300005441 | Ga0070700_100750438 | Ga0070700_1007504382 | 123 |
| 159 | 3300005455 | Ga0070663_101698638 | Ga0070663_1016986381 | 123 |
| 160 | 3300005456 | Ga0070678_102075892 | Ga0070678_1020758921 | 123 |
| 161 | 3300005457 | Ga0070662_100063774 | Ga0070662_1000637744 | 123 |
| 162 | 3300005459 | Ga0068867_100053534 | Ga0068867_1000535341 | 123 |
| 163 | 3300005530 | Ga0070679_100576805 | Ga0070679_1005768052 | 123 |
| 164 | 3300005535 | Ga0070684_100240650 | Ga0070684_1002406502 | 123 |
| 165 | 3300005535 | Ga0070684_100474513 | Ga0070684_1004745132 | 123 |
| 166 | 3300005543 | Ga0070672_101949889 | Ga0070672_1019498891 | 123 |
| 167 | 3300005546 | Ga0070696_100548416 | Ga0070696_1005484162 | 123 |
| 168 | 3300005547 | Ga0070693_101511660 | Ga0070693_1015116601 | 123 |
| 169 | 3300005549 | Ga0070704_100458820 | Ga0070704_1004588202 | 123 |
| 170 | 3300005564 | Ga0070664_100051363 | Ga0070664_1000513632 | 123 |
| 171 | 3300005564 | Ga0070664_100725788 | Ga0070664_1007257882 | 123 |
| 172 | 3300005578 | Ga0068854_100929991 | Ga0068854_1009299912 | 123 |
| 173 | 3300005614 | Ga0068856_100138311 | Ga0068856_1001383114 | 123 |
| 174 | 3300005616 | Ga0068852_101632337 | Ga0068852_1016323371 | 123 |
| 175 | 3300005718 | Ga0068866_10220587 | Ga0068866_102205873 | 123 |
| 176 | 3300005719 | Ga0068861_100044522 | Ga0068861_1000445224 | 123 |
| 177 | 3300005719 | Ga0068861_101408854 | Ga0068861_1014088541 | 123 |
| 178 | 3300005843 | Ga0068860_100506063 | Ga0068860_1005060632 | 123 |
| 179 | 3300005937 | Ga0081455_10055205 | Ga0081455_100552053 | 123 |
| 180 | 3300005981 | Ga0081538_10057974 | Ga0081538_100579744 | 123 |
| 181 | 3300005981 | Ga0081538_10146035 | Ga0081538_101460352 | 123 |
| 182 | 3300006051 | Ga0075364_10024550 | Ga0075364_100245505 | 123 |
| 183 | 3300006173 | Ga0070716_100063407 | Ga0070716_1000634073 | 123 |
| 184 | 3300006186 | Ga0075369_10466967 | Ga0075369_104669671 | 123 |
| 185 | 3300006844 | Ga0075428_100533610 | Ga0075428_1005336103 | 123 |
| 186 | 3300006844 | Ga0075428_102060083 | Ga0075428_1020600831 | 123 |
| 187 | 3300006846 | Ga0075430_100047186 | Ga0075430_1000471864 | 123 |
| 188 | 3300006846 | Ga0075430_101562207 | Ga0075430_1015622071 | 123 |
| 189 | 3300006847 | Ga0075431_100159360 | Ga0075431_1001593602 | 123 |
| 190 | 3300006852 | Ga0075433_10397043 | Ga0075433_103970432 | 123 |
| 191 | 3300006880 | Ga0075429_100125435 | Ga0075429_1001254352 | 123 |
| 192 | 3300006881 | Ga0068865_100592666 | Ga0068865_1005926662 | 123 |
| 193 | 3300006881 | Ga0068865_101132910 | Ga0068865_1011329102 | 123 |
| 194 | 3300009094 | Ga0111539_10449923 | Ga0111539_104499233 | 123 |
| 195 | 3300009094 | Ga0111539_11571193 | Ga0111539_115711932 | 123 |
| 196 | 3300009094 | Ga0111539_11589686 | Ga0111539_115896862 | 123 |
| 197 | 3300009094 | Ga0111539_11741811 | Ga0111539_117418112 | 123 |
| 198 | 3300009094 | Ga0111539_12000593 | Ga0111539_120005931 | 123 |
| 199 | 3300009147 | Ga0114129_10202515 | Ga0114129_102025154 | 123 |
| 200 | 3300009147 | Ga0114129_10559141 | Ga0114129_105591412 | 123 |
| 201 | 3300009147 | Ga0114129_10692124 | Ga0114129_106921242 | 123 |
| 202 | 3300009147 | Ga0114129_10844099 | Ga0114129_108440992 | 123 |
| 203 | 3300009148 | Ga0105243_10535869 | Ga0105243_105358692 | 123 |
| 204 | 3300009148 | Ga0105243_13045395 | Ga0105243_130453951 | 123 |
| 205 | 3300009177 | Ga0105248_10294931 | Ga0105248_102949313 | 123 |
| 206 | 3300009551 | Ga0105238_11316716 | Ga0105238_113167162 | 123 |
| 207 | 3300009553 | Ga0105249_10400604 | Ga0105249_104006042 | 123 |
| 208 | 3300009553 | Ga0105249_10463457 | Ga0105249_104634573 | 123 |
| 209 | 3300010375 | Ga0105239_10975970 | Ga0105239_109759701 | 123 |
| 210 | 3300013104 | Ga0157370_10482816 | Ga0157370_104828162 | 123 |
| 211 | 3300013105 | Ga0157369_10005654 | Ga0157369_100056545 | 123 |
| 212 | 3300013105 | Ga0157369_10529178 | Ga0157369_105291782 | 123 |
| 213 | 3300013296 | Ga0157374_10634244 | Ga0157374_106342442 | 123 |
| 214 | 3300013306 | Ga0163162_10261469 | Ga0163162_102614694 | 123 |
| 215 | 3300013307 | Ga0157372_10936721 | Ga0157372_109367212 | 123 |
| 216 | 3300013308 | Ga0157375_10668985 | Ga0157375_106689852 | 123 |
| 217 | 3300014325 | Ga0163163_11766053 | Ga0163163_117660532 | 123 |
| 218 | 3300014326 | Ga0157380_10235508 | Ga0157380_102355082 | 123 |
| 219 | 3300014326 | Ga0157380_11250606 | Ga0157380_112506062 | 123 |
| 220 | 3300014745 | Ga0157377_10074830 | Ga0157377_100748302 | 123 |
| 221 | 3300014745 | Ga0157377_10678981 | Ga0157377_106789812 | 123 |
| 222 | 3300014969 | Ga0157376_11024196 | Ga0157376_110241962 | 123 |
| 223 | 3300020069 | Ga0197907_10057455 | Ga0197907_100574552 | 123 |
| 224 | 3300020070 | Ga0206356_10248501 | Ga0206356_102485012 | 123 |
| 225 | 3300020077 | Ga0206351_10146550 | Ga0206351_101465502 | 123 |
| 226 | 3300020078 | Ga0206352_11312785 | Ga0206352_113127851 | 123 |
| 227 | 3300020081 | Ga0206354_11555507 | Ga0206354_115555072 | 123 |
| 228 | 3300025904 | Ga0207647_10137471 | Ga0207647_101374711 | 123 |
| 229 | 3300025908 | Ga0207643_10575349 | Ga0207643_105753492 | 123 |
| 230 | 3300025909 | Ga0207705_10014201 | Ga0207705_100142014 | 123 |
| 231 | 3300025918 | Ga0207662_11053599 | Ga0207662_110535991 | 123 |
| 232 | 3300025919 | Ga0207657_10212583 | Ga0207657_102125833 | 123 |
| 233 | 3300025920 | Ga0207649_10053522 | Ga0207649_100535223 | 123 |
| 234 | 3300025921 | Ga0207652_10069339 | Ga0207652_100693393 | 123 |
| 235 | 3300025925 | Ga0207650_10707866 | Ga0207650_107078662 | 123 |
| 236 | 3300025926 | Ga0207659_10676550 | Ga0207659_106765501 | 123 |
| 237 | 3300025926 | Ga0207659_11779542 | Ga0207659_117795421 | 123 |
| 238 | 3300025929 | Ga0207664_10105345 | Ga0207664_101053453 | 123 |
| 239 | 3300025935 | Ga0207709_10076390 | Ga0207709_100763901 | 123 |
| 240 | 3300025938 | Ga0207704_10198568 | Ga0207704_101985682 | 123 |
| 241 | 3300025938 | Ga0207704_10636799 | Ga0207704_106367992 | 123 |
| 242 | 3300025940 | Ga0207691_10418588 | Ga0207691_104185883 | 123 |
| 243 | 3300025940 | Ga0207691_11255812 | Ga0207691_112558122 | 123 |
| 244 | 3300025942 | Ga0207689_11539452 | Ga0207689_115394521 | 123 |
| 245 | 3300025944 | Ga0207661_10009084 | Ga0207661_100090847 | 123 |
| 246 | 3300025945 | Ga0207679_10615263 | Ga0207679_106152632 | 123 |
| 247 | 3300025949 | Ga0207667_10097975 | Ga0207667_100979753 | 123 |
| 248 | 3300025961 | Ga0207712_10229545 | Ga0207712_102295451 | 123 |
| 249 | 3300025961 | Ga0207712_10948571 | Ga0207712_109485712 | 123 |
| 250 | 3300025972 | Ga0207668_10131176 | Ga0207668_101311762 | 123 |
| 251 | 3300025972 | Ga0207668_10292032 | Ga0207668_102920322 | 123 |
| 252 | 3300025981 | Ga0207640_10187648 | Ga0207640_101876483 | 123 |
| 253 | 3300026035 | Ga0207703_12427624 | Ga0207703_124276241 | 123 |
| 254 | 3300026075 | Ga0207708_10041438 | Ga0207708_100414384 | 123 |
| 255 | 3300026075 | Ga0207708_10193789 | Ga0207708_101937892 | 123 |
| 256 | 3300026075 | Ga0207708_10254252 | Ga0207708_102542523 | 123 |
| 257 | 3300026078 | Ga0207702_10310155 | Ga0207702_103101553 | 123 |
| 258 | 3300026116 | Ga0207674_10200596 | Ga0207674_102005962 | 123 |
| 259 | 3300026118 | Ga0207675_100065615 | Ga0207675_1000656154 | 123 |
| 260 | 3300026118 | Ga0207675_100072031 | Ga0207675_1000720313 | 123 |
| 261 | 3300026142 | Ga0207698_12490993 | Ga0207698_124909932 | 123 |
| 262 | 3300027876 | Ga0209974_10317046 | Ga0209974_103170461 | 123 |
| 263 | 3300027907 | Ga0207428_10264939 | Ga0207428_102649392 | 123 |
| 264 | 3300028381 | Ga0268264_10380543 | Ga0268264_103805432 | 123 |
| 265 | 3300031731 | Ga0307405_10167849 | Ga0307405_101678492 | 123 |
| 266 | 3300031731 | Ga0307405_10562399 | Ga0307405_105623992 | 123 |
| 267 | 3300031824 | Ga0307413_10181759 | Ga0307413_101817593 | 123 |
| 268 | 3300031824 | Ga0307413_10219847 | Ga0307413_102198472 | 123 |
| 269 | 3300031852 | Ga0307410_11645206 | Ga0307410_116452062 | 123 |
| 270 | 3300031901 | Ga0307406_10000435 | Ga0307406_1000043512 | 123 |
| 271 | 3300031901 | Ga0307406_10189728 | Ga0307406_101897281 | 123 |
| 272 | 3300031901 | Ga0307406_10386652 | Ga0307406_103866522 | 123 |
| 273 | 3300031911 | Ga0307412_11112290 | Ga0307412_111122902 | 123 |
| 274 | 3300031995 | Ga0307409_100027473 | Ga0307409_1000274735 | 123 |
| 275 | 3300031995 | Ga0307409_100345924 | Ga0307409_1003459244 | 123 |
| 276 | 3300031995 | Ga0307409_100758537 | Ga0307409_1007585372 | 123 |
| 277 | 3300032002 | Ga0307416_100463950 | Ga0307416_1004639502 | 123 |
| 278 | 3300032002 | Ga0307416_100612889 | Ga0307416_1006128892 | 123 |
| 279 | 3300032002 | Ga0307416_100783551 | Ga0307416_1007835512 | 123 |
| 280 | 3300032002 | Ga0307416_102248474 | Ga0307416_1022484742 | 123 |
| 281 | 3300032004 | Ga0307414_10235890 | Ga0307414_102358902 | 123 |
| 282 | 3300032005 | Ga0307411_10274266 | Ga0307411_102742662 | 123 |
| 283 | 3300032126 | Ga0307415_100501880 | Ga0307415_1005018802 | 123 |
| 284 | 3300032126 | Ga0307415_100697659 | Ga0307415_1006976592 | 123 |
| 285 | 3300032126 | Ga0307415_100742041 | Ga0307415_1007420412 | 123 |
| 286 | 3300037418 | Ga0395900_0551491 | Ga0395900_0551491_96_470 | 123 |
| 287 | 3300037466 | Ga0395898_0372506 | Ga0395898_0372506_236_610 | 123 |
| 288 | 3300037471 | Ga0395905_1222968 | Ga0395905_1222968_145_519 | 123 |
| 289 | 3300037853 | Ga0436364_0957520 | Ga0436364_0957520_2334_2705 | 123 |
| 290 | 3300038443 | Ga0395901_0428047 | Ga0395901_0428047_573_947 | 123 |
| 291 | 3300041408 | Ga0439453_0002006 | Ga0439453_0002006_1528_1905 | 123 |
| 292 | 3300042009 | Ga0439451_013023 | Ga0439451_013023_817_1194 | 123 |
| 293 | 3300042009 | Ga0439451_117251 | Ga0439451_117251_134_523 | 123 |
| 294 | 3300042011 | Ga0439454_000186 | Ga0439454_000186_171_548 | 123 |
| 295 | 3300042013 | Ga0439456_047142 | Ga0439456_047142_433_810 | 123 |
| 296 | 3300042436 | Ga0439435_0104773 | Ga0439435_0104773_78_467 | 123 |
| 297 | 3300044901 | Ga0466960_0283302 | Ga0466960_0283302_537_908 | 123 |
| 298 | 3300046692 | Ga0495671_0326414 | Ga0495671_0326414_215_613 | 123 |
| 299 | 3300048906 | Ga0496103_0412726 | Ga0496103_0412726_46_420 | 123 |
| 300 | 3300048913 | Ga0496110_0342490 | Ga0496110_0342490_378_749 | 123 |
| 301 | 3300048915 | Ga0496112_0046725 | Ga0496112_0046725_1463_1834 | 123 |
| 302 | 3300048920 | Ga0496117_0432116 | Ga0496117_0432116_44_415 | 123 |
| 303 | 3300048924 | Ga0496121_0000462 | Ga0496121_0000462_76882_77253 | 123 |
| 304 | 3300048929 | Ga0496126_0015392 | Ga0496126_0015392_983_1366 | 123 |
| 305 | 3300049568 | Ga0501031_0420405 | Ga0501031_0420405_380_754 | 123 |
| 306 | 3300049571 | Ga0501034_0588578 | Ga0501034_0588578_605_979 | 123 |
| 307 | 3300049571 | Ga0501034_1568310 | Ga0501034_1568310_72_443 | 123 |
| 308 | 3300049572 | Ga0501036_0297305 | Ga0501036_0297305_14_388 | 123 |
| 309 | 3300049573 | Ga0501037_0566058 | Ga0501037_0566058_114_488 | 123 |
| 310 | 3300049574 | Ga0501038_0142536 | Ga0501038_0142536_1143_1517 | 123 |
| 311 | 3300049575 | Ga0501039_0396788 | Ga0501039_0396788_123_497 | 123 |
| 312 | 3300049575 | Ga0501039_0739362 | Ga0501039_0739362_370_744 | 123 |
| 313 | 3300049576 | Ga0501040_0848427 | Ga0501040_0848427_35_409 | 123 |
| 314 | 3300049577 | Ga0501041_0989382 | Ga0501041_0989382_52_441 | 123 |
| 315 | 3300049578 | Ga0501042_0267056 | Ga0501042_0267056_841_1215 | 123 |
| 316 | 3300049578 | Ga0501042_0347525 | Ga0501042_0347525_422_811 | 123 |
| 317 | 3300049584 | Ga0501068_0035720 | Ga0501068_0035720_1170_1544 | 123 |
| 318 | 3300049585 | Ga0501069_0099433 | Ga0501069_0099433_526_900 | 123 |
| 319 | 3300049586 | Ga0501070_0811490 | Ga0501070_0811490_16_390 | 123 |
| 320 | 3300049587 | Ga0501071_0011845 | Ga0501071_0011845_5429_5803 | 123 |
| 321 | 3300049587 | Ga0501071_0120043 | Ga0501071_0120043_1220_1594 | 123 |
| 322 | 3300049588 | Ga0501072_0125927 | Ga0501072_0125927_1644_2018 | 123 |
| 323 | 3300049589 | Ga0501073_0444559 | Ga0501073_0444559_166_540 | 123 |
| 324 | 3300049590 | Ga0501074_0463661 | Ga0501074_0463661_407_781 | 123 |
| 325 | 3300049591 | Ga0501075_0705498 | Ga0501075_0705498_257_631 | 123 |
| 326 | 3300049592 | Ga0501076_0179595 | Ga0501076_0179595_49_423 | 123 |
| 327 | 3300049592 | Ga0501076_0353632 | Ga0501076_0353632_595_969 | 123 |
| 328 | 3300049592 | Ga0501076_0855024 | Ga0501076_0855024_72_443 | 123 |
| 329 | 3300049593 | Ga0501077_0018980 | Ga0501077_0018980_1717_2091 | 123 |
| 330 | 3300049741 | Ga0501079_0716485 | Ga0501079_0716485_370_744 | 123 |
| 331 | 3300049742 | Ga0501080_1205756 | Ga0501080_1205756_259_633 | 123 |
| 332 | 3300049743 | Ga0501081_0439306 | Ga0501081_0439306_524_898 | 123 |
| 333 | 3300049824 | Ga0501045_0244253 | Ga0501045_0244253_190_564 | 123 |
| 334 | 3300049824 | Ga0501045_0572005 | Ga0501045_0572005_349_723 | 123 |
| 335 | 3300050491 | nmdc:mga00v17_13648_c1 | nmdc:mga00v17_13648_c1_3904_4296 | 123 |
| 336 | 3300050507 | nmdc:mga05p37_1338829_c1 | nmdc:mga05p37_1338829_c1_184_558 | 123 |
| 337 | 3300050507 | nmdc:mga05p37_284785_c1 | nmdc:mga05p37_284785_c1_997_1368 | 123 |
| 338 | 3300050507 | nmdc:mga05p37_288096_c1 | nmdc:mga05p37_288096_c1_483_854 | 123 |
| 339 | 3300050509 | nmdc:mga0qj67_200048_c1 | nmdc:mga0qj67_200048_c1_1076_1447 | 123 |
| 340 | 3300050509 | nmdc:mga0qj67_294038_c1 | nmdc:mga0qj67_294038_c1_167_556 | 123 |
| 341 | 3300050510 | nmdc:mga06r32_107673_c1 | nmdc:mga06r32_107673_c1_2318_2689 | 123 |
| 342 | 3300050511 | nmdc:mga08y16_53056_c1 | nmdc:mga08y16_53056_c1_3520_3894 | 123 |
| 343 | 3300050515 | nmdc:mga0a205_621920_c1 | nmdc:mga0a205_621920_c1_70_444 | 123 |
| 344 | 3300050516 | nmdc:mga0sz30_421898_c1 | nmdc:mga0sz30_421898_c1_144_521 | 123 |
| 345 | 3300050516 | nmdc:mga0sz30_543392_c1 | nmdc:mga0sz30_543392_c1_40_432 | 123 |
| 346 | 3300054114 | Ga0501084_0213264 | Ga0501084_0213264_1071_1445 | 123 |
| 347 | 3300054114 | Ga0501084_1507178 | Ga0501084_1507178_70_441 | 123 |
| 348 | 3300060353 | Ga0501082_0706982 | Ga0501082_0706982_38_412 | 123 |
| 349 | 3300061734 | Ga0530510_0696241 | Ga0530510_0696241_381_755 | 123 |
| 350 | 3300061734 | Ga0530510_0904226 | Ga0530510_0904226_63_452 | 123 |
| 351 | 3300003203 | JGI25406J46586_10062661 | JGI25406J46586_100626612 | 124 |
| 352 | 3300003373 | JGI25407J50210_10006655 | JGI25407J50210_100066554 | 124 |
| 353 | 3300003578 | Ga0006562J51391_1149020 | Ga0006562J51391_11490202 | 124 |
| 354 | 3300003578 | Ga0006562J51391_1149021 | Ga0006562J51391_11490211 | 124 |
| 355 | 3300005327 | Ga0070658_10741427 | Ga0070658_107414272 | 124 |
| 356 | 3300005327 | Ga0070658_10814886 | Ga0070658_108148862 | 124 |
| 357 | 3300005329 | Ga0070683_100591625 | Ga0070683_1005916252 | 124 |
| 358 | 3300005331 | Ga0070670_102143570 | Ga0070670_1021435701 | 124 |
| 359 | 3300005334 | Ga0068869_100929078 | Ga0068869_1009290782 | 124 |
| 360 | 3300005337 | Ga0070682_100066096 | Ga0070682_1000660963 | 124 |
| 361 | 3300005338 | Ga0068868_100856041 | Ga0068868_1008560412 | 124 |
| 362 | 3300005339 | Ga0070660_100812719 | Ga0070660_1008127192 | 124 |
| 363 | 3300005340 | Ga0070689_100114650 | Ga0070689_1001146502 | 124 |
| 364 | 3300005345 | Ga0070692_10328301 | Ga0070692_103283012 | 124 |
| 365 | 3300005347 | Ga0070668_100227718 | Ga0070668_1002277182 | 124 |
| 366 | 3300005356 | Ga0070674_100181166 | Ga0070674_1001811662 | 124 |
| 367 | 3300005366 | Ga0070659_100064596 | Ga0070659_1000645964 | 124 |
| 368 | 3300005438 | Ga0070701_11043039 | Ga0070701_110430391 | 124 |
| 369 | 3300005445 | Ga0070708_100371394 | Ga0070708_1003713943 | 124 |
| 370 | 3300005455 | Ga0070663_100174403 | Ga0070663_1001744032 | 124 |
| 371 | 3300005456 | Ga0070678_100076271 | Ga0070678_1000762713 | 124 |
| 372 | 3300005467 | Ga0070706_100522365 | Ga0070706_1005223651 | 124 |
| 373 | 3300005467 | Ga0070706_101230545 | Ga0070706_1012305451 | 124 |
| 374 | 3300005468 | Ga0070707_100161097 | Ga0070707_1001610973 | 124 |
| 375 | 3300005471 | Ga0070698_100058822 | Ga0070698_1000588223 | 124 |
| 376 | 3300005518 | Ga0070699_100285978 | Ga0070699_1002859782 | 124 |
| 377 | 3300005518 | Ga0070699_101669800 | Ga0070699_1016698001 | 124 |
| 378 | 3300005535 | Ga0070684_100087988 | Ga0070684_1000879886 | 124 |
| 379 | 3300005535 | Ga0070684_100365747 | Ga0070684_1003657472 | 124 |
| 380 | 3300005543 | Ga0070672_100031433 | Ga0070672_1000314334 | 124 |
| 381 | 3300005544 | Ga0070686_101208781 | Ga0070686_1012087811 | 124 |
| 382 | 3300005548 | Ga0070665_100080791 | Ga0070665_1000807913 | 124 |
| 383 | 3300005548 | Ga0070665_100488911 | Ga0070665_1004889112 | 124 |
| 384 | 3300005616 | Ga0068852_100306572 | Ga0068852_1003065722 | 124 |
| 385 | 3300005618 | Ga0068864_100180830 | Ga0068864_1001808303 | 124 |
| 386 | 3300005618 | Ga0068864_101431654 | Ga0068864_1014316542 | 124 |
| 387 | 3300005719 | Ga0068861_100109181 | Ga0068861_1001091811 | 124 |
| 388 | 3300005719 | Ga0068861_101467282 | Ga0068861_1014672822 | 124 |
| 389 | 3300005937 | Ga0081455_10053330 | Ga0081455_100533305 | 124 |
| 390 | 3300005937 | Ga0081455_10120016 | Ga0081455_101200162 | 124 |
| 391 | 3300005981 | Ga0081538_10000021 | Ga0081538_1000002179 | 124 |
| 392 | 3300005981 | Ga0081538_10000353 | Ga0081538_1000035341 | 124 |
| 393 | 3300005981 | Ga0081538_10094284 | Ga0081538_100942842 | 124 |
| 394 | 3300005985 | Ga0081539_10002270 | Ga0081539_1000227015 | 124 |
| 395 | 3300005985 | Ga0081539_10033238 | Ga0081539_100332382 | 124 |
| 396 | 3300006237 | Ga0097621_101734155 | Ga0097621_1017341552 | 124 |
| 397 | 3300006358 | Ga0068871_101114387 | Ga0068871_1011143872 | 124 |
| 398 | 3300006844 | Ga0075428_100027657 | Ga0075428_1000276574 | 124 |
| 399 | 3300006846 | Ga0075430_100811002 | Ga0075430_1008110022 | 124 |
| 400 | 3300006847 | Ga0075431_100314155 | Ga0075431_1003141553 | 124 |
| 401 | 3300006880 | Ga0075429_100240030 | Ga0075429_1002400302 | 124 |
| 402 | 3300009098 | Ga0105245_10128194 | Ga0105245_101281943 | 124 |
| 403 | 3300009101 | Ga0105247_11577100 | Ga0105247_115771001 | 124 |
| 404 | 3300009147 | Ga0114129_10284003 | Ga0114129_102840033 | 124 |
| 405 | 3300009148 | Ga0105243_10027123 | Ga0105243_100271235 | 124 |
| 406 | 3300009177 | Ga0105248_10153693 | Ga0105248_101536932 | 124 |
| 407 | 3300009545 | Ga0105237_10085990 | Ga0105237_100859905 | 124 |
| 408 | 3300010375 | Ga0105239_10568967 | Ga0105239_105689672 | 124 |
| 409 | 3300011119 | Ga0105246_10156181 | Ga0105246_101561813 | 124 |
| 410 | 3300013296 | Ga0157374_11339368 | Ga0157374_113393682 | 124 |
| 411 | 3300013306 | Ga0163162_10080807 | Ga0163162_100808074 | 124 |
| 412 | 3300013306 | Ga0163162_10201724 | Ga0163162_102017242 | 124 |
| 413 | 3300013306 | Ga0163162_10551516 | Ga0163162_105515162 | 124 |
| 414 | 3300013306 | Ga0163162_13231724 | Ga0163162_132317241 | 124 |
| 415 | 3300013307 | Ga0157372_11812149 | Ga0157372_118121492 | 124 |
| 416 | 3300013308 | Ga0157375_11152563 | Ga0157375_111525632 | 124 |
| 417 | 3300014325 | Ga0163163_10792081 | Ga0163163_107920812 | 124 |
| 418 | 3300014326 | Ga0157380_10045675 | Ga0157380_100456755 | 124 |
| 419 | 3300014745 | Ga0157377_10021633 | Ga0157377_100216333 | 124 |
| 420 | 3300025901 | Ga0207688_10567349 | Ga0207688_105673491 | 124 |
| 421 | 3300025901 | Ga0207688_10863034 | Ga0207688_108630342 | 124 |
| 422 | 3300025908 | Ga0207643_10044633 | Ga0207643_100446331 | 124 |
| 423 | 3300025909 | Ga0207705_10590216 | Ga0207705_105902162 | 124 |
| 424 | 3300025910 | Ga0207684_10037108 | Ga0207684_100371083 | 124 |
| 425 | 3300025919 | Ga0207657_10627041 | Ga0207657_106270412 | 124 |
| 426 | 3300025926 | Ga0207659_11180183 | Ga0207659_111801832 | 124 |
| 427 | 3300025927 | Ga0207687_10205290 | Ga0207687_102052902 | 124 |
| 428 | 3300025935 | Ga0207709_10233447 | Ga0207709_102334472 | 124 |
| 429 | 3300025935 | Ga0207709_11001418 | Ga0207709_110014182 | 124 |
| 430 | 3300025937 | Ga0207669_10330235 | Ga0207669_103302352 | 124 |
| 431 | 3300025940 | Ga0207691_10055564 | Ga0207691_100555645 | 124 |
| 432 | 3300025941 | Ga0207711_10395398 | Ga0207711_103953982 | 124 |
| 433 | 3300025942 | Ga0207689_10874868 | Ga0207689_108748682 | 124 |
| 434 | 3300025944 | Ga0207661_10290660 | Ga0207661_102906602 | 124 |
| 435 | 3300025944 | Ga0207661_10421951 | Ga0207661_104219512 | 124 |
| 436 | 3300025960 | Ga0207651_10263670 | Ga0207651_102636702 | 124 |
| 437 | 3300025972 | Ga0207668_10259329 | Ga0207668_102593292 | 124 |
| 438 | 3300026067 | Ga0207678_10226404 | Ga0207678_102264042 | 124 |
| 439 | 3300026095 | Ga0207676_11406932 | Ga0207676_114069322 | 124 |
| 440 | 3300026118 | Ga0207675_100341587 | Ga0207675_1003415872 | 124 |
| 441 | 3300026118 | Ga0207675_101963430 | Ga0207675_1019634301 | 124 |
| 442 | 3300026121 | Ga0207683_10178714 | Ga0207683_101787142 | 124 |
| 443 | 3300026121 | Ga0207683_10576945 | Ga0207683_105769452 | 124 |
| 444 | 3300026142 | Ga0207698_10444275 | Ga0207698_104442752 | 124 |
| 445 | 3300028379 | Ga0268266_10211279 | Ga0268266_102112792 | 124 |
| 446 | 3300028379 | Ga0268266_10272209 | Ga0268266_102722092 | 124 |
| 447 | 3300031616 | Ga0307508_10405683 | Ga0307508_104056832 | 124 |
| 448 | 3300035119 | Ga0373956_0016532 | Ga0373956_0016532_1768_2175 | 124 |
| 449 | 3300035172 | Ga0373955_0007506 | Ga0373955_0007506_811_1218 | 124 |
| 450 | 3300035724 | Ga0373933_0050302 | Ga0373933_0050302_1849_2256 | 124 |
| 451 | 3300036401 | Ga0373937_0024203 | Ga0373937_0024203_3767_4174 | 124 |
| 452 | 3300037068 | Ga0373925_0006813 | Ga0373925_0006813_7399_7785 | 124 |
| 453 | 3300037068 | Ga0373925_0023114 | Ga0373925_0023114_109_495 | 124 |
| 454 | 3300038443 | Ga0395901_0204838 | Ga0395901_0204838_538_912 | 124 |
| 455 | 3300041512 | Ga0451853_1546664 | Ga0451853_1546664_393_767 | 124 |
| 456 | 3300041512 | Ga0451853_3985726 | Ga0451853_3985726_60_434 | 124 |
| 457 | 3300042439 | Ga0439464_0053624 | Ga0439464_0053624_16_393 | 124 |
| 458 | 3300044693 | Ga0466961_0304093 | Ga0466961_0304093_567_950 | 124 |
| 459 | 3300044765 | Ga0466970_0068293 | Ga0466970_0068293_379_819 | 124 |
| 460 | 3300044901 | Ga0466960_0019661 | Ga0466960_0019661_1960_2337 | 124 |
| 461 | 3300046453 | Ga0495627_000603 | Ga0495627_000603_20577_20954 | 124 |
| 462 | 3300046455 | Ga0495603_0048547 | Ga0495603_0048547_1935_2309 | 124 |
| 463 | 3300046459 | Ga0495629_0438455 | Ga0495629_0438455_390_788 | 124 |
| 464 | 3300046459 | Ga0495629_0506098 | Ga0495629_0506098_187_594 | 124 |
| 465 | 3300046461 | Ga0495641_0072140 | Ga0495641_0072140_137_511 | 124 |
| 466 | 3300046462 | Ga0495651_0001161 | Ga0495651_0001161_10945_11352 | 124 |
| 467 | 3300046463 | Ga0495653_0059664 | Ga0495653_0059664_1287_1694 | 124 |
| 468 | 3300046463 | Ga0495653_0260712 | Ga0495653_0260712_615_998 | 124 |
| 469 | 3300046473 | Ga0495582_0260151 | Ga0495582_0260151_603_977 | 124 |
| 470 | 3300046476 | Ga0495662_0197737 | Ga0495662_0197737_357_737 | 124 |
| 471 | 3300046477 | Ga0495664_0105564 | Ga0495664_0105564_460_867 | 124 |
| 472 | 3300046511 | Ga0495608_0000210 | Ga0495608_0000210_19226_19633 | 124 |
| 473 | 3300046511 | Ga0495608_0296677 | Ga0495608_0296677_510_884 | 124 |
| 474 | 3300046514 | Ga0495618_0029610 | Ga0495618_0029610_1702_2109 | 124 |
| 475 | 3300046516 | Ga0495628_0037958 | Ga0495628_0037958_1905_2312 | 124 |
| 476 | 3300046516 | Ga0495628_0301762 | Ga0495628_0301762_314_712 | 124 |
| 477 | 3300046517 | Ga0495630_0002090 | Ga0495630_0002090_13175_13558 | 124 |
| 478 | 3300046529 | Ga0495652_0014485 | Ga0495652_0014485_2166_2573 | 124 |
| 479 | 3300046529 | Ga0495652_0116652 | Ga0495652_0116652_588_986 | 124 |
| 480 | 3300046533 | Ga0495640_0035580 | Ga0495640_0035580_665_1072 | 124 |
| 481 | 3300046536 | Ga0495587_0020463 | Ga0495587_0020463_2820_3227 | 124 |
| 482 | 3300046543 | Ga0495645_0007961 | Ga0495645_0007961_4707_5114 | 124 |
| 483 | 3300046543 | Ga0495645_0120740 | Ga0495645_0120740_1342_1740 | 124 |
| 484 | 3300046558 | Ga0495633_0000152 | Ga0495633_0000152_64914_65291 | 124 |
| 485 | 3300046559 | Ga0495667_0013576 | Ga0495667_0013576_2934_3341 | 124 |
| 486 | 3300046642 | Ga0495634_0096424 | Ga0495634_0096424_1013_1420 | 124 |
| 487 | 3300046663 | Ga0495635_0020024 | Ga0495635_0020024_2084_2491 | 124 |
| 488 | 3300046663 | Ga0495635_0302855 | Ga0495635_0302855_567_941 | 124 |
| 489 | 3300046675 | Ga0495657_0013341 | Ga0495657_0013341_2131_2514 | 124 |
| 490 | 3300046675 | Ga0495657_0021162 | Ga0495657_0021162_2118_2525 | 124 |
| 491 | 3300046678 | Ga0495599_0102357 | Ga0495599_0102357_509_916 | 124 |
| 492 | 3300046679 | Ga0495623_0077114 | Ga0495623_0077114_792_1199 | 124 |
| 493 | 3300046683 | Ga0495658_0655560 | Ga0495658_0655560_106_480 | 124 |
| 494 | 3300046809 | Ga0495600_0022163 | Ga0495600_0022163_2060_2467 | 124 |
| 495 | 3300047315 | Ga0495581_0787833 | Ga0495581_0787833_60_434 | 124 |
| 496 | 3300047317 | Ga0495604_0008487 | Ga0495604_0008487_4003_4410 | 124 |
| 497 | 3300047319 | Ga0495674_0008894 | Ga0495674_0008894_2375_2782 | 124 |
| 498 | 3300047321 | Ga0495676_0328206 | Ga0495676_0328206_143_535 | 124 |
| 499 | 3300047322 | Ga0495680_0039625 | Ga0495680_0039625_1178_1585 | 124 |
| 500 | 3300047322 | Ga0495680_0970743 | Ga0495680_0970743_28_402 | 124 |
| 501 | 3300047444 | Ga0495675_0017229 | Ga0495675_0017229_2172_2579 | 124 |
| 502 | 3300047471 | Ga0495684_0024249 | Ga0495684_0024249_2172_2579 | 124 |
| 503 | 3300047673 | Ga0495593_0321630 | Ga0495593_0321630_64_444 | 124 |
| 504 | 3300047673 | Ga0495593_0451962 | Ga0495593_0451962_186_578 | 124 |
| 505 | 3300048088 | Ga0495602_0088890 | Ga0495602_0088890_1072_1479 | 124 |
| 506 | 3300048903 | Ga0496100_0611816 | Ga0496100_0611816_181_555 | 124 |
| 507 | 3300048906 | Ga0496103_0452843 | Ga0496103_0452843_228_611 | 124 |
| 508 | 3300048906 | Ga0496103_0651391 | Ga0496103_0651391_128_502 | 124 |
| 509 | 3300048907 | Ga0496104_0168127 | Ga0496104_0168127_1670_2068 | 124 |
| 510 | 3300048907 | Ga0496104_0736053 | Ga0496104_0736053_183_581 | 124 |
| 511 | 3300048907 | Ga0496104_1348758 | Ga0496104_1348758_89_463 | 124 |
| 512 | 3300048908 | Ga0496105_0459905 | Ga0496105_0459905_259_657 | 124 |
| 513 | 3300048911 | Ga0496108_0062707 | Ga0496108_0062707_939_1313 | 124 |
| 514 | 3300048911 | Ga0496108_0161956 | Ga0496108_0161956_31_405 | 124 |
| 515 | 3300048912 | Ga0496109_0759482 | Ga0496109_0759482_11_385 | 124 |
| 516 | 3300048913 | Ga0496110_0186345 | Ga0496110_0186345_1440_1823 | 124 |
| 517 | 3300048914 | Ga0496111_0624328 | Ga0496111_0624328_284_658 | 124 |
| 518 | 3300048916 | Ga0496113_0029530 | Ga0496113_0029530_1390_1788 | 124 |
| 519 | 3300048917 | Ga0496114_1528997 | Ga0496114_1528997_22_399 | 124 |
| 520 | 3300049162 | Ga0501307_058698 | Ga0501307_058698_169_543 | 124 |
| 521 | 3300049568 | Ga0501031_0296984 | Ga0501031_0296984_140_532 | 124 |
| 522 | 3300049576 | Ga0501040_0565936 | Ga0501040_0565936_415_792 | 124 |
| 523 | 3300049576 | Ga0501040_0606556 | Ga0501040_0606556_196_582 | 124 |
| 524 | 3300049577 | Ga0501041_0044889 | Ga0501041_0044889_2073_2450 | 124 |
| 525 | 3300049578 | Ga0501042_0199104 | Ga0501042_0199104_151_528 | 124 |
| 526 | 3300049579 | Ga0501043_0517424 | Ga0501043_0517424_358_732 | 124 |
| 527 | 3300049581 | Ga0501047_0101404 | Ga0501047_0101404_2306_2680 | 124 |
| 528 | 3300049582 | Ga0501048_0148319 | Ga0501048_0148319_1246_1623 | 124 |
| 529 | 3300049587 | Ga0501071_0606729 | Ga0501071_0606729_131_508 | 124 |
| 530 | 3300049591 | Ga0501075_0021801 | Ga0501075_0021801_917_1294 | 124 |
| 531 | 3300049592 | Ga0501076_0344961 | Ga0501076_0344961_443_820 | 124 |
| 532 | 3300049741 | Ga0501079_0330131 | Ga0501079_0330131_774_1151 | 124 |
| 533 | 3300049743 | Ga0501081_0021500 | Ga0501081_0021500_1830_2207 | 124 |
| 534 | 3300049822 | Ga0501035_0254346 | Ga0501035_0254346_387_764 | 124 |
| 535 | 3300049824 | Ga0501045_0011979 | Ga0501045_0011979_4936_5313 | 124 |
| 536 | 3300050490 | nmdc:mga03n38_175691_c1 | nmdc:mga03n38_175691_c1_407_781 | 124 |
| 537 | 3300050492 | nmdc:mga0yw44_977211_c1 | nmdc:mga0yw44_977211_c1_18_398 | 124 |
| 538 | 3300050507 | nmdc:mga05p37_673757_c2 | nmdc:mga05p37_673757_c2_174_548 | 124 |
| 539 | 3300050508 | nmdc:mga09592_299529_c1 | nmdc:mga09592_299529_c1_480_854 | 124 |
| 540 | 3300050510 | nmdc:mga06r32_352789_c1 | nmdc:mga06r32_352789_c1_386_760 | 124 |
| 541 | 3300053077 | Ga0495601_0008295 | Ga0495601_0008295_633_1016 | 124 |
| 542 | 3300053077 | Ga0495601_0059717 | Ga0495601_0059717_1292_1699 | 124 |
| 543 | 3300053078 | Ga0495612_0081715 | Ga0495612_0081715_537_920 | 124 |
| 544 | 3300053084 | Ga0495595_0013826 | Ga0495595_0013826_1825_2232 | 124 |
| 545 | 3300053085 | Ga0495619_0255250 | Ga0495619_0255250_320_694 | 124 |
| 546 | 3300053093 | Ga0500651_0190842 | Ga0500651_0190842_398_775 | 124 |
| 547 | 3300054114 | Ga0501084_0054419 | Ga0501084_0054419_2416_2793 | 124 |
| 548 | 3300061734 | Ga0530510_0006116 | Ga0530510_0006116_7140_7517 | 124 |
| 549 | 3300005327 | Ga0070658_11433876 | Ga0070658_114338761 | 125 |
| 550 | 3300005347 | Ga0070668_100016307 | Ga0070668_1000163076 | 125 |
| 551 | 3300005356 | Ga0070674_100011194 | Ga0070674_1000111942 | 125 |
| 552 | 3300005364 | Ga0070673_100184860 | Ga0070673_1001848602 | 125 |
| 553 | 3300005434 | Ga0070709_10385256 | Ga0070709_103852562 | 125 |
| 554 | 3300005436 | Ga0070713_100023695 | Ga0070713_1000236954 | 125 |
| 555 | 3300005471 | Ga0070698_100677116 | Ga0070698_1006771161 | 125 |
| 556 | 3300005719 | Ga0068861_101035972 | Ga0068861_1010359722 | 125 |
| 557 | 3300006048 | Ga0075363_100193238 | Ga0075363_1001932382 | 125 |
| 558 | 3300006844 | Ga0075428_100685934 | Ga0075428_1006859341 | 125 |
| 559 | 3300009148 | Ga0105243_10049893 | Ga0105243_100498935 | 125 |
| 560 | 3300013308 | Ga0157375_10162961 | Ga0157375_101629611 | 125 |
| 561 | 3300025922 | Ga0207646_11125941 | Ga0207646_111259412 | 125 |
| 562 | 3300025928 | Ga0207700_10037916 | Ga0207700_100379164 | 125 |
| 563 | 3300025929 | Ga0207664_11444972 | Ga0207664_114449721 | 125 |
| 564 | 3300025937 | Ga0207669_10003482 | Ga0207669_100034826 | 125 |
| 565 | 3300025972 | Ga0207668_10144749 | Ga0207668_101447492 | 125 |
| 566 | 3300026023 | Ga0207677_11228368 | Ga0207677_112283682 | 125 |
| 567 | 3300032002 | Ga0307416_100422906 | Ga0307416_1004229062 | 125 |
| 568 | 3300032126 | Ga0307415_100215673 | Ga0307415_1002156732 | 125 |
| 569 | 3300041413 | Ga0439465_0090612 | Ga0439465_0090612_328_720 | 125 |
| 570 | 3300041509 | Ga0451843_1210050 | Ga0451843_1210050_234_623 | 125 |
| 571 | 3300041512 | Ga0451853_0368024 | Ga0451853_0368024_90_476 | 125 |
| 572 | 3300042007 | Ga0439449_0155469 | Ga0439449_0155469_84_479 | 125 |
| 573 | 3300047320 | Ga0495672_0101106 | Ga0495672_0101106_1162_1542 | 125 |
| 574 | 3300048911 | Ga0496108_0236129 | Ga0496108_0236129_159_545 | 125 |
| 575 | 3300049578 | Ga0501042_0492756 | Ga0501042_0492756_20_397 | 125 |
| 576 | 3300050510 | nmdc:mga06r32_1061508_c1 | nmdc:mga06r32_1061508_c1_251_628 | 125 |
| 577 | 3300001990 | JGI24737J22298_10184331 | JGI24737J22298_101843311 | 126 |
| 578 | 3300005344 | Ga0070661_101124887 | Ga0070661_1011248872 | 126 |
| 579 | 3300005455 | Ga0070663_100000310 | Ga0070663_10000031019 | 126 |
| 580 | 3300005564 | Ga0070664_101512762 | Ga0070664_1015127622 | 126 |
| 581 | 3300006871 | Ga0075434_100188077 | Ga0075434_1001880773 | 126 |
| 582 | 3300009177 | Ga0105248_11502830 | Ga0105248_115028302 | 126 |
| 583 | 3300009553 | Ga0105249_12313055 | Ga0105249_123130551 | 126 |
| 584 | 3300013102 | Ga0157371_10032288 | Ga0157371_100322883 | 126 |
| 585 | 3300013104 | Ga0157370_10325470 | Ga0157370_103254702 | 126 |
| 586 | 3300013105 | Ga0157369_10000393 | Ga0157369_100003937 | 126 |
| 587 | 3300013105 | Ga0157369_11037339 | Ga0157369_110373391 | 126 |
| 588 | 3300013307 | Ga0157372_10000034 | Ga0157372_10000034105 | 126 |
| 589 | 3300013307 | Ga0157372_10586926 | Ga0157372_105869262 | 126 |
| 590 | 3300013308 | Ga0157375_10366868 | Ga0157375_103668681 | 126 |
| 591 | 3300013308 | Ga0157375_10841606 | Ga0157375_108416062 | 126 |
| 592 | 3300025944 | Ga0207661_10142371 | Ga0207661_101423712 | 126 |
| 593 | 3300025944 | Ga0207661_10201566 | Ga0207661_102015662 | 126 |
| 594 | 3300026067 | Ga0207678_10011687 | Ga0207678_100116876 | 126 |
| 595 | 3300026121 | Ga0207683_10742838 | Ga0207683_107428382 | 126 |
| 596 | 3300037312 | Ga0395899_0000182 | Ga0395899_0000182_33277_33663 | 126 |
| 597 | 3300037418 | Ga0395900_0144161 | Ga0395900_0144161_1218_1604 | 126 |
| 598 | 3300037418 | Ga0395900_1445838 | Ga0395900_1445838_60_461 | 126 |
| 599 | 3300037471 | Ga0395905_1005070 | Ga0395905_1005070_244_630 | 126 |
| 600 | 3300038443 | Ga0395901_0080880 | Ga0395901_0080880_2301_2687 | 126 |
| 601 | 3300038443 | Ga0395901_0371480 | Ga0395901_0371480_580_987 | 126 |
| 602 | 3300044684 | Ga0466966_0011419 | Ga0466966_0011419_1057_1527 | 126 |
| 603 | 3300046689 | Ga0495613_0829293 | Ga0495613_0829293_112_507 | 126 |
| 604 | 3300048903 | Ga0496100_0020159 | Ga0496100_0020159_2372_2767 | 126 |
| 605 | 3300048904 | Ga0496101_0377369 | Ga0496101_0377369_267_662 | 126 |
| 606 | 3300048905 | Ga0496102_0805644 | Ga0496102_0805644_78_473 | 126 |
| 607 | 3300048906 | Ga0496103_0475670 | Ga0496103_0475670_359_754 | 126 |
| 608 | 3300048906 | Ga0496103_0904591 | Ga0496103_0904591_26_421 | 126 |
| 609 | 3300048907 | Ga0496104_0015898 | Ga0496104_0015898_5055_5450 | 126 |
| 610 | 3300048907 | Ga0496104_0035111 | Ga0496104_0035111_279_674 | 126 |
| 611 | 3300048908 | Ga0496105_0035087 | Ga0496105_0035087_320_715 | 126 |
| 612 | 3300048908 | Ga0496105_0354302 | Ga0496105_0354302_504_899 | 126 |
| 613 | 3300048911 | Ga0496108_0022189 | Ga0496108_0022189_2946_3332 | 126 |
| 614 | 3300048912 | Ga0496109_0405811 | Ga0496109_0405811_82_468 | 126 |
| 615 | 3300048913 | Ga0496110_1084857 | Ga0496110_1084857_230_625 | 126 |
| 616 | 3300048914 | Ga0496111_0221141 | Ga0496111_0221141_845_1240 | 126 |
| 617 | 3300048916 | Ga0496113_0068239 | Ga0496113_0068239_297_683 | 126 |
| 618 | 3300048916 | Ga0496113_0407548 | Ga0496113_0407548_399_794 | 126 |
| 619 | 3300048917 | Ga0496114_0028131 | Ga0496114_0028131_2861_3256 | 126 |
| 620 | 3300048917 | Ga0496114_0243841 | Ga0496114_0243841_1034_1429 | 126 |
| 621 | 3300048922 | Ga0496119_0209430 | Ga0496119_0209430_78_473 | 126 |
| 622 | 3300049572 | Ga0501036_1646473 | Ga0501036_1646473_74_463 | 126 |
| 623 | 3300049577 | Ga0501041_0071147 | Ga0501041_0071147_811_1191 | 126 |
| 624 | 3300049577 | Ga0501041_0550568 | Ga0501041_0550568_167_553 | 126 |
| 625 | 3300049584 | Ga0501068_0327789 | Ga0501068_0327789_20_412 | 126 |
| 626 | 3300050513 | nmdc:mga0rr50_1187936_c1 | nmdc:mga0rr50_1187936_c1_25_435 | 126 |
| 627 | 3300054114 | Ga0501084_0714460 | Ga0501084_0714460_209_589 | 126 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4nb0-assembly1.cif.gz_A | crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution | 0.8075 | 8 | 124 |
| 5wew-assembly1.cif.gz_A | crystal structure of klebsiella pneumoniae fosfomycin resistance protein (fosakp) with inhibitor (any1) bound | 0.8006 | 7 | 124 |
| 5wew-assembly3.cif.gz_E | crystal structure of klebsiella pneumoniae fosfomycin resistance protein (fosakp) with inhibitor (any1) bound | 0.7878 | 8 | 124 |
| 4nb1-assembly1.cif.gz_A | crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide | 0.785 | 8 | 124 |
| 4pav-assembly4.cif.gz_D | structure of hypothetical protein sa1046 from s. aureus. | 0.7842 | 7 | 124 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8244 | 61 | 122 | 3.30.720.110 |
| 3sk1C01 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8212 | 8 | 53 | 3.30.720.120 |
| af_O06412_6_120_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8163 | 7 | 123 | 3.10.180.10 |
| af_Q2FYM3_1_61_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7995 | 10 | 59 | 3.10.180.10 |
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.797 | 61 | 122 | 3.30.720.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A852WP69-F1-model_v4 | Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme | 0.9968 | 14 | 124 |
GO:0016829
GO:0051213 |
| AF-A0A0M4LD60-F1-model_v4 | Glyoxalase | 0.9955 | 1 | 124 |
|
| AF-A0A3M2IU54-F1-model_v4 | VOC domain-containing protein | 0.9879 | 7 | 124 |
|
| AF-A0A2W0CYU3-F1-model_v4 | deleted | 0.9872 | 7 | 123 |
|
| AF-A0A445ND58-F1-model_v4 | deleted | 0.9844 | 1 | 124 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar