F470524
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 627 | 274 | 626 | 234 |
Family's Representative Sequence
| Representative Sequence | 3300001989|JGI24739J22299_10016731|JGI24739J22299_100167312 |
| Length | 277 |
| Sequence | MADKPGWRRCPVWLLHLIPDPAKNLNQAPTSEALPVADAPRNRNPMTNILLTGSSRGIGAAIAQVLSASDGIRLIGHGTASGIAADFADPAGPRQLWDKALAELGSIDVVINNAGVFEDNPIDLGDDDWVAGWERTMRINLTASAELCRFAVRHWQERQSGGRIVNVASRAAYRGDSPQHWHYAASKAGMVAMTKSIARGYAAQGILAFAVCPGFTMTGMAEEYLSSRGGDKLLADIPLGRVADPEEIANAVAYLATSAPPSMTGAVIDVNGASYVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 87 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 88 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 89 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 90 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 154 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 155 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 156 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 158 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 159 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 160 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 161 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 162 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 163 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 164 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 165 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 166 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 168 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 169 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 170 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 171 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 172 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 173 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 174 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 175 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 176 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 178 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 179 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 180 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 181 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 182 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 183 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 184 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 185 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 186 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 187 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 188 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 189 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 190 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 191 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 192 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 193 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 194 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 234 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 235 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 236 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 237 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 238 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 239 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 242 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 243 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 244 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 245 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 246 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 247 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 248 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 249 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 250 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 251 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 252 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 253 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 254 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 255 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 256 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 257 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 258 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 259 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 265 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 266 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 267 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 268 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 269 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 270 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 271 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 272 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 273 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 274 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.88 |
| Metatranscriptomes | 0.96 |
| Isolates | 0.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.9 |
| Nodule | 0 |
| Rhizoplane | 4.63 |
| Rhizosphere | 85.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1008888 | 3300001904 | Bacteria | 1666 |
| 2 | JGI24741J21665_1007812 | 3300001915 | Bacteria | 2053 |
| 3 | JGI24739J22299_10016731 | 3300001989 | Bacteria | 2651 |
| 4 | JGI24739J22299_10030728 | 3300001989 | Bacteria | 1860 |
| 5 | JGI24739J22299_10038800 | 3300001989 | Bacteria | 1599 |
| 6 | JGI24737J22298_10000693 | 3300001990 | Bacteria | 11841 |
| 7 | JGI24737J22298_10002430 | 3300001990 | Bacteria | 6640 |
| 8 | JGI24737J22298_10006127 | 3300001990 | Bacteria | 4119 |
| 9 | JGI25153J46596_10000034 | 3300003215 | Bacteria | 192215 |
| 10 | rootL2_10103814 | 3300003322 | Bacteria | 2616 |
| 11 | Ga0055525_1000118 | 3300003759 | Bacteria | 120652 |
| 12 | Ga0055542_1000012 | 3300003762 | Bacteria | 391808 |
| 13 | Ga0055529_1000004 | 3300003763 | Bacteria | 433331 |
| 14 | Ga0055524_1000409 | 3300003775 | Bacteria | 36411 |
| 15 | Ga0055528_1032533 | 3300003790 | Bacteria | 1328 |
| 16 | Ga0055530_10000638 | 3300003791 | Bacteria | 30190 |
| 17 | Ga0055531_10000640 | 3300003794 | Bacteria | 30187 |
| 18 | Ga0055531_10035174 | 3300003794 | Bacteria | 1573 |
| 19 | Ga0070658_10000754 | 3300005327 | Bacteria | 27776 |
| 20 | Ga0070658_10010209 | 3300005327 | Bacteria | 7530 |
| 21 | Ga0070658_10028140 | 3300005327 | Bacteria | 4511 |
| 22 | Ga0070658_10036358 | 3300005327 | Bacteria | 3969 |
| 23 | Ga0070658_10037099 | 3300005327 | Bacteria | 3927 |
| 24 | Ga0070658_10067263 | 3300005327 | Bacteria | 2927 |
| 25 | Ga0070658_10068348 | 3300005327 | Bacteria | 2904 |
| 26 | Ga0070658_10090281 | 3300005327 | Bacteria | 2524 |
| 27 | Ga0070658_10179251 | 3300005327 | Bacteria | 1782 |
| 28 | Ga0070658_10529124 | 3300005327 | Bacteria | 1019 |
| 29 | Ga0070676_10003403 | 3300005328 | Bacteria | 8279 |
| 30 | Ga0070676_10028033 | 3300005328 | Bacteria | 3197 |
| 31 | Ga0070670_100001616 | 3300005331 | Bacteria | 18214 |
| 32 | Ga0070670_100160705 | 3300005331 | Bacteria | 1947 |
| 33 | Ga0070670_100258809 | 3300005331 | Bacteria | 1517 |
| 34 | Ga0070670_100439856 | 3300005331 | Bacteria | 1155 |
| 35 | Ga0070670_100484795 | 3300005331 | Bacteria | 1098 |
| 36 | Ga0070677_10146964 | 3300005333 | Bacteria | 1093 |
| 37 | Ga0070666_10214656 | 3300005335 | Bacteria | 1356 |
| 38 | Ga0070680_100009968 | 3300005336 | Bacteria | 7319 |
| 39 | Ga0070680_100019844 | 3300005336 | Bacteria | 5329 |
| 40 | Ga0068868_100093610 | 3300005338 | Bacteria | 2423 |
| 41 | Ga0070660_100035536 | 3300005339 | Bacteria | 3772 |
| 42 | Ga0070660_100042929 | 3300005339 | Bacteria | 3453 |
| 43 | Ga0070660_100055731 | 3300005339 | Bacteria | 3056 |
| 44 | Ga0070660_100066893 | 3300005339 | Bacteria | 2799 |
| 45 | Ga0070660_100076595 | 3300005339 | Bacteria | 2620 |
| 46 | Ga0070660_100187314 | 3300005339 | Bacteria | 1676 |
| 47 | Ga0070660_100270638 | 3300005339 | Bacteria | 1388 |
| 48 | Ga0070660_100568269 | 3300005339 | Bacteria | 947 |
| 49 | Ga0070661_100024122 | 3300005344 | Bacteria | 4363 |
| 50 | Ga0070661_100056748 | 3300005344 | Bacteria | 2869 |
| 51 | Ga0070661_100128181 | 3300005344 | Bacteria | 1904 |
| 52 | Ga0070661_100316753 | 3300005344 | Bacteria | 1217 |
| 53 | Ga0070668_100004873 | 3300005347 | Bacteria | 9944 |
| 54 | Ga0070668_100220882 | 3300005347 | Bacteria | 1563 |
| 55 | Ga0070668_100463273 | 3300005347 | Bacteria | 1092 |
| 56 | Ga0070669_100010130 | 3300005353 | Bacteria | 6704 |
| 57 | Ga0070669_100154451 | 3300005353 | Bacteria | 1779 |
| 58 | Ga0070671_100001670 | 3300005355 | Bacteria | 16795 |
| 59 | Ga0070671_100002301 | 3300005355 | Bacteria | 14752 |
| 60 | Ga0070671_100011559 | 3300005355 | Bacteria | 7101 |
| 61 | Ga0070671_100017420 | 3300005355 | Bacteria | 5819 |
| 62 | Ga0070671_100023096 | 3300005355 | Bacteria | 5084 |
| 63 | Ga0070671_100042665 | 3300005355 | Bacteria | 3770 |
| 64 | Ga0070671_100195462 | 3300005355 | Bacteria | 1715 |
| 65 | Ga0070674_100020454 | 3300005356 | Bacteria | 4230 |
| 66 | Ga0070674_100030096 | 3300005356 | Bacteria | 3584 |
| 67 | Ga0070674_100091528 | 3300005356 | Bacteria | 2197 |
| 68 | Ga0070673_100038330 | 3300005364 | Bacteria | 3659 |
| 69 | Ga0070673_100066413 | 3300005364 | Bacteria | 2881 |
| 70 | Ga0070673_100114615 | 3300005364 | Bacteria | 2240 |
| 71 | Ga0070673_100176872 | 3300005364 | Bacteria | 1825 |
| 72 | Ga0070659_100008434 | 3300005366 | Bacteria | 7528 |
| 73 | Ga0070659_100019549 | 3300005366 | Bacteria | 5135 |
| 74 | Ga0070659_100043977 | 3300005366 | Bacteria | 3495 |
| 75 | Ga0070659_100075882 | 3300005366 | Bacteria | 2680 |
| 76 | Ga0070667_100002998 | 3300005367 | Bacteria | 14505 |
| 77 | Ga0070667_100038852 | 3300005367 | Bacteria | 3990 |
| 78 | Ga0070667_100052267 | 3300005367 | Bacteria | 3447 |
| 79 | Ga0070667_100052950 | 3300005367 | Bacteria | 3425 |
| 80 | Ga0070714_100204247 | 3300005435 | Bacteria | 1809 |
| 81 | Ga0070714_100293540 | 3300005435 | Bacteria | 1514 |
| 82 | Ga0070663_100494519 | 3300005455 | Bacteria | 1015 |
| 83 | Ga0070663_100765256 | 3300005455 | Bacteria | 826 |
| 84 | Ga0070678_100001009 | 3300005456 | Bacteria | 14629 |
| 85 | Ga0070678_100001266 | 3300005456 | Bacteria | 13416 |
| 86 | Ga0070678_100022762 | 3300005456 | Bacteria | 4160 |
| 87 | Ga0070678_100050397 | 3300005456 | Bacteria | 3011 |
| 88 | Ga0070662_100006947 | 3300005457 | Bacteria | 7325 |
| 89 | Ga0070662_100021124 | 3300005457 | Bacteria | 4442 |
| 90 | Ga0070662_100126142 | 3300005457 | Bacteria | 1968 |
| 91 | Ga0070662_100146151 | 3300005457 | Bacteria | 1837 |
| 92 | Ga0070662_100254961 | 3300005457 | Bacteria | 1412 |
| 93 | Ga0070681_10112452 | 3300005458 | Bacteria | 2663 |
| 94 | Ga0070681_10436387 | 3300005458 | Bacteria | 1222 |
| 95 | Ga0068867_100090577 | 3300005459 | Bacteria | 2320 |
| 96 | Ga0068867_100098368 | 3300005459 | Bacteria | 2231 |
| 97 | Ga0070706_100262434 | 3300005467 | Bacteria | 1612 |
| 98 | Ga0070679_100319653 | 3300005530 | Bacteria | 1501 |
| 99 | Ga0070684_100657695 | 3300005535 | Bacteria | 976 |
| 100 | Ga0068853_100040493 | 3300005539 | Bacteria | 3975 |
| 101 | Ga0068853_100048087 | 3300005539 | Bacteria | 3662 |
| 102 | Ga0070672_100032060 | 3300005543 | Bacteria | 3963 |
| 103 | Ga0070672_100324004 | 3300005543 | Bacteria | 1310 |
| 104 | Ga0070672_100364319 | 3300005543 | Bacteria | 1234 |
| 105 | Ga0070672_100443326 | 3300005543 | Bacteria | 1118 |
| 106 | Ga0070695_100013031 | 3300005545 | Bacteria | 4994 |
| 107 | Ga0070665_100000084 | 3300005548 | Bacteria | 180481 |
| 108 | Ga0070704_100373167 | 3300005549 | Bacteria | 1210 |
| 109 | Ga0068855_100211839 | 3300005563 | Bacteria | 2177 |
| 110 | Ga0068855_100352940 | 3300005563 | Bacteria | 1620 |
| 111 | Ga0068855_100590333 | 3300005563 | Bacteria | 1199 |
| 112 | Ga0070664_100000675 | 3300005564 | Bacteria | 26078 |
| 113 | Ga0070664_100042795 | 3300005564 | Bacteria | 3822 |
| 114 | Ga0070664_100050108 | 3300005564 | Bacteria | 3533 |
| 115 | Ga0070664_100137964 | 3300005564 | Bacteria | 2146 |
| 116 | Ga0068857_100016405 | 3300005577 | Bacteria | 6491 |
| 117 | Ga0068857_100085484 | 3300005577 | Bacteria | 2819 |
| 118 | Ga0068854_100035398 | 3300005578 | Bacteria | 3494 |
| 119 | Ga0068854_100053546 | 3300005578 | Bacteria | 2898 |
| 120 | Ga0068854_100117337 | 3300005578 | Bacteria | 2015 |
| 121 | Ga0068854_100126818 | 3300005578 | Bacteria | 1945 |
| 122 | Ga0068854_100177711 | 3300005578 | Bacteria | 1661 |
| 123 | Ga0068856_100103385 | 3300005614 | Bacteria | 2842 |
| 124 | Ga0068856_100118569 | 3300005614 | Bacteria | 2647 |
| 125 | Ga0068856_100894110 | 3300005614 | Bacteria | 907 |
| 126 | Ga0068856_101211868 | 3300005614 | Bacteria | 771 |
| 127 | Ga0068852_100008231 | 3300005616 | Bacteria | 7665 |
| 128 | Ga0068852_100011477 | 3300005616 | Bacteria | 6671 |
| 129 | Ga0068859_100003695 | 3300005617 | Bacteria | 15598 |
| 130 | Ga0068859_100044184 | 3300005617 | Bacteria | 4477 |
| 131 | Ga0068859_100258709 | 3300005617 | Bacteria | 1831 |
| 132 | Ga0068864_100034399 | 3300005618 | Bacteria | 4310 |
| 133 | Ga0068864_100074102 | 3300005618 | Bacteria | 2970 |
| 134 | Ga0068863_100002582 | 3300005841 | Bacteria | 17960 |
| 135 | Ga0068863_100059852 | 3300005841 | Bacteria | 3603 |
| 136 | Ga0068858_100059188 | 3300005842 | Bacteria | 3541 |
| 137 | Ga0068858_100078820 | 3300005842 | Bacteria | 3061 |
| 138 | Ga0068858_100092411 | 3300005842 | Bacteria | 2816 |
| 139 | Ga0068860_100006703 | 3300005843 | Bacteria | 11558 |
| 140 | Ga0068860_100014445 | 3300005843 | Bacteria | 7735 |
| 141 | Ga0068860_100086477 | 3300005843 | Bacteria | 2984 |
| 142 | Ga0068862_100050427 | 3300005844 | Bacteria | 3557 |
| 143 | Ga0068862_100132068 | 3300005844 | Bacteria | 2209 |
| 144 | Ga0068862_100522627 | 3300005844 | Bacteria | 1129 |
| 145 | Ga0081539_10197483 | 3300005985 | Bacteria | 932 |
| 146 | Ga0097621_100027147 | 3300006237 | Bacteria | 4499 |
| 147 | Ga0068871_100044832 | 3300006358 | Bacteria | 3558 |
| 148 | Ga0068871_100210400 | 3300006358 | Bacteria | 1682 |
| 149 | Ga0075429_100352699 | 3300006880 | Bacteria | 1288 |
| 150 | Ga0068865_100207258 | 3300006881 | Bacteria | 1525 |
| 151 | Ga0097620_100003694 | 3300006931 | Bacteria | 15598 |
| 152 | Ga0097620_100044180 | 3300006931 | Bacteria | 4477 |
| 153 | Ga0097620_100258706 | 3300006931 | Bacteria | 1831 |
| 154 | Ga0105250_10007339 | 3300009092 | Bacteria | 4739 |
| 155 | Ga0105240_10042240 | 3300009093 | Bacteria | 5811 |
| 156 | Ga0105240_10472610 | 3300009093 | Bacteria | 1399 |
| 157 | Ga0111539_10020298 | 3300009094 | Bacteria | 8185 |
| 158 | Ga0105245_10101888 | 3300009098 | Bacteria | 2658 |
| 159 | Ga0114129_10387600 | 3300009147 | Bacteria | 1844 |
| 160 | Ga0114129_10440981 | 3300009147 | Bacteria | 1709 |
| 161 | Ga0105243_10000483 | 3300009148 | Bacteria | 40744 |
| 162 | Ga0105248_10000621 | 3300009177 | Bacteria | 40351 |
| 163 | Ga0105248_10211631 | 3300009177 | Bacteria | 2184 |
| 164 | Ga0105248_10956561 | 3300009177 | Bacteria | 967 |
| 165 | Ga0105237_10282592 | 3300009545 | Bacteria | 1662 |
| 166 | Ga0105237_10466594 | 3300009545 | Bacteria | 1269 |
| 167 | Ga0105238_10014999 | 3300009551 | Bacteria | 7845 |
| 168 | Ga0105249_10040895 | 3300009553 | Bacteria | 4212 |
| 169 | Ga0105246_10310785 | 3300011119 | Bacteria | 1277 |
| 170 | Ga0105246_10811393 | 3300011119 | Bacteria | 831 |
| 171 | Ga0157373_10295535 | 3300013100 | Bacteria | 1149 |
| 172 | Ga0157373_10354164 | 3300013100 | Bacteria | 1047 |
| 173 | Ga0157373_10413159 | 3300013100 | Bacteria | 968 |
| 174 | Ga0157371_10000197 | 3300013102 | Bacteria | 88423 |
| 175 | Ga0157371_10216383 | 3300013102 | Bacteria | 1375 |
| 176 | Ga0157371_10388944 | 3300013102 | Bacteria | 1019 |
| 177 | Ga0157371_10432192 | 3300013102 | Bacteria | 966 |
| 178 | Ga0157370_10024985 | 3300013104 | Bacteria | 5912 |
| 179 | Ga0157370_10045418 | 3300013104 | Bacteria | 4215 |
| 180 | Ga0157369_10002175 | 3300013105 | Bacteria | 23611 |
| 181 | Ga0157369_10010869 | 3300013105 | Bacteria | 10370 |
| 182 | Ga0157369_10064124 | 3300013105 | Bacteria | 3957 |
| 183 | Ga0157369_10119551 | 3300013105 | Bacteria | 2796 |
| 184 | Ga0157369_10630986 | 3300013105 | Bacteria | 1105 |
| 185 | Ga0163162_10447777 | 3300013306 | Bacteria | 1423 |
| 186 | Ga0163162_10497746 | 3300013306 | Bacteria | 1349 |
| 187 | Ga0157372_10228222 | 3300013307 | Bacteria | 2158 |
| 188 | Ga0157375_10052488 | 3300013308 | Bacteria | 4008 |
| 189 | Ga0163163_10000282 | 3300014325 | Bacteria | 50623 |
| 190 | Ga0163163_10202012 | 3300014325 | Bacteria | 2036 |
| 191 | Ga0157379_10002202 | 3300014968 | Bacteria | 16219 |
| 192 | Ga0157379_10024258 | 3300014968 | Bacteria | 5384 |
| 193 | Ga0197907_10778048 | 3300020069 | Bacteria | 1234 |
| 194 | Ga0206354_10185466 | 3300020081 | Bacteria | 1125 |
| 195 | Ga0206354_10229693 | 3300020081 | Bacteria | 9840 |
| 196 | Ga0206354_11061492 | 3300020081 | Bacteria | 2492 |
| 197 | Ga0206353_11730299 | 3300020082 | Bacteria | 1455 |
| 198 | Ga0206353_11805231 | 3300020082 | Bacteria | 7432 |
| 199 | Ga0213873_10000017 | 3300021358 | Bacteria | 123962 |
| 200 | Ga0213874_10088014 | 3300021377 | Bacteria | 1016 |
| 201 | Ga0213876_10000071 | 3300021384 | Bacteria | 123962 |
| 202 | Ga0213876_10004712 | 3300021384 | Bacteria | 7589 |
| 203 | Ga0213875_10002567 | 3300021388 | Bacteria | 10819 |
| 204 | Ga0209674_108297 | 3300025226 | Bacteria | 1241 |
| 205 | Ga0209563_100070 | 3300025230 | Bacteria | 249779 |
| 206 | Ga0207425_1013908 | 3300025245 | Bacteria | 1842 |
| 207 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 208 | Ga0209233_1025638 | 3300025261 | Bacteria | 1455 |
| 209 | Ga0209565_1000007 | 3300025263 | Bacteria | 784361 |
| 210 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 211 | Ga0209673_1003346 | 3300025273 | Bacteria | 9581 |
| 212 | Ga0209675_1005065 | 3300025291 | Bacteria | 5636 |
| 213 | Ga0209758_1000007 | 3300025297 | Bacteria | 1270410 |
| 214 | Ga0209758_1013158 | 3300025297 | Bacteria | 4544 |
| 215 | Ga0209050_1000010 | 3300025298 | Bacteria | 980454 |
| 216 | Ga0209050_1028318 | 3300025298 | Bacteria | 1821 |
| 217 | Ga0209256_1000008 | 3300025299 | Bacteria | 975723 |
| 218 | Ga0209257_1000027 | 3300025304 | Bacteria | 703541 |
| 219 | Ga0209257_1000820 | 3300025304 | Bacteria | 45043 |
| 220 | Ga0209257_1019962 | 3300025304 | Bacteria | 2498 |
| 221 | Ga0207697_10140921 | 3300025315 | Bacteria | 1046 |
| 222 | Ga0207656_10017502 | 3300025321 | Bacteria | 2809 |
| 223 | Ga0207682_10062223 | 3300025893 | Bacteria | 1564 |
| 224 | Ga0207682_10071084 | 3300025893 | Bacteria | 1475 |
| 225 | Ga0207642_10156573 | 3300025899 | Bacteria | 1219 |
| 226 | Ga0207688_10015571 | 3300025901 | Bacteria | 4123 |
| 227 | Ga0207688_10134322 | 3300025901 | Bacteria | 1452 |
| 228 | Ga0207680_10082463 | 3300025903 | Bacteria | 2024 |
| 229 | Ga0207647_10008080 | 3300025904 | Bacteria | 7562 |
| 230 | Ga0207647_10034298 | 3300025904 | Bacteria | 3241 |
| 231 | Ga0207645_10012375 | 3300025907 | Bacteria | 5788 |
| 232 | Ga0207645_10020296 | 3300025907 | Bacteria | 4351 |
| 233 | Ga0207643_10208782 | 3300025908 | Bacteria | 1191 |
| 234 | Ga0207643_10330978 | 3300025908 | Bacteria | 953 |
| 235 | Ga0207705_10002878 | 3300025909 | Bacteria | 13168 |
| 236 | Ga0207705_10006763 | 3300025909 | Bacteria | 8476 |
| 237 | Ga0207705_10011161 | 3300025909 | Bacteria | 6513 |
| 238 | Ga0207705_10079988 | 3300025909 | Bacteria | 2381 |
| 239 | Ga0207705_10155627 | 3300025909 | Bacteria | 1715 |
| 240 | Ga0207705_10267229 | 3300025909 | Bacteria | 1307 |
| 241 | Ga0207705_10292442 | 3300025909 | Bacteria | 1248 |
| 242 | Ga0207654_10000926 | 3300025911 | Bacteria | 16210 |
| 243 | Ga0207707_10346080 | 3300025912 | Bacteria | 1281 |
| 244 | Ga0207695_10014755 | 3300025913 | Bacteria | 9236 |
| 245 | Ga0207695_10016672 | 3300025913 | Bacteria | 8585 |
| 246 | Ga0207671_10051379 | 3300025914 | Bacteria | 3055 |
| 247 | Ga0207660_10005359 | 3300025917 | Bacteria | 8328 |
| 248 | Ga0207660_10341581 | 3300025917 | Bacteria | 1198 |
| 249 | Ga0207657_10009851 | 3300025919 | Bacteria | 9569 |
| 250 | Ga0207657_10082386 | 3300025919 | Bacteria | 2701 |
| 251 | Ga0207657_10157896 | 3300025919 | Bacteria | 1843 |
| 252 | Ga0207657_10288688 | 3300025919 | Bacteria | 1301 |
| 253 | Ga0207649_10004939 | 3300025920 | Bacteria | 7211 |
| 254 | Ga0207649_10014509 | 3300025920 | Bacteria | 4413 |
| 255 | Ga0207649_10198862 | 3300025920 | Bacteria | 1414 |
| 256 | Ga0207652_10222850 | 3300025921 | Bacteria | 1699 |
| 257 | Ga0207694_10006461 | 3300025924 | Bacteria | 8931 |
| 258 | Ga0207694_10036745 | 3300025924 | Bacteria | 3759 |
| 259 | Ga0207650_10066669 | 3300025925 | Bacteria | 2700 |
| 260 | Ga0207650_10345440 | 3300025925 | Bacteria | 1223 |
| 261 | Ga0207650_10491014 | 3300025925 | Bacteria | 1025 |
| 262 | Ga0207650_10497446 | 3300025925 | Bacteria | 1018 |
| 263 | Ga0207664_10121453 | 3300025929 | Bacteria | 2187 |
| 264 | Ga0207664_10259529 | 3300025929 | Bacteria | 1519 |
| 265 | Ga0207644_10000090 | 3300025931 | Bacteria | 65122 |
| 266 | Ga0207644_10004166 | 3300025931 | Bacteria | 9377 |
| 267 | Ga0207644_10035622 | 3300025931 | Bacteria | 3488 |
| 268 | Ga0207644_10481574 | 3300025931 | Bacteria | 1022 |
| 269 | Ga0207690_10002426 | 3300025932 | Bacteria | 11279 |
| 270 | Ga0207690_10017183 | 3300025932 | Bacteria | 4414 |
| 271 | Ga0207690_10258945 | 3300025932 | Bacteria | 1347 |
| 272 | Ga0207690_10339400 | 3300025932 | Bacteria | 1185 |
| 273 | Ga0207706_10019644 | 3300025933 | Bacteria | 6078 |
| 274 | Ga0207706_10033286 | 3300025933 | Bacteria | 4589 |
| 275 | Ga0207706_10047381 | 3300025933 | Bacteria | 3803 |
| 276 | Ga0207706_10051278 | 3300025933 | Bacteria | 3644 |
| 277 | Ga0207706_10064965 | 3300025933 | Bacteria | 3213 |
| 278 | Ga0207706_10389731 | 3300025933 | Bacteria | 1208 |
| 279 | Ga0207709_10000005 | 3300025935 | Bacteria | 806813 |
| 280 | Ga0207669_10000114 | 3300025937 | Bacteria | 40433 |
| 281 | Ga0207669_10008496 | 3300025937 | Bacteria | 4824 |
| 282 | Ga0207691_10122014 | 3300025940 | Bacteria | 2308 |
| 283 | Ga0207691_10236307 | 3300025940 | Bacteria | 1581 |
| 284 | Ga0207691_10311357 | 3300025940 | Bacteria | 1351 |
| 285 | Ga0207711_10000440 | 3300025941 | Bacteria | 43290 |
| 286 | Ga0207711_10004825 | 3300025941 | Bacteria | 11457 |
| 287 | Ga0207711_10014217 | 3300025941 | Bacteria | 6610 |
| 288 | Ga0207711_10188335 | 3300025941 | Bacteria | 1879 |
| 289 | Ga0207689_10108220 | 3300025942 | Bacteria | 2284 |
| 290 | Ga0207661_10049671 | 3300025944 | Bacteria | 3339 |
| 291 | Ga0207679_10001267 | 3300025945 | Bacteria | 16008 |
| 292 | Ga0207679_10019457 | 3300025945 | Bacteria | 4561 |
| 293 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 294 | Ga0207667_10132048 | 3300025949 | Bacteria | 2572 |
| 295 | Ga0207667_10135294 | 3300025949 | Bacteria | 2538 |
| 296 | Ga0207667_10323464 | 3300025949 | Bacteria | 1575 |
| 297 | Ga0207667_10365508 | 3300025949 | Bacteria | 1471 |
| 298 | Ga0207651_10154552 | 3300025960 | Bacteria | 1790 |
| 299 | Ga0207651_10364638 | 3300025960 | Bacteria | 1220 |
| 300 | Ga0207651_10367197 | 3300025960 | Bacteria | 1216 |
| 301 | Ga0207668_10000107 | 3300025972 | Bacteria | 59177 |
| 302 | Ga0207668_10151800 | 3300025972 | Bacteria | 1794 |
| 303 | Ga0207668_10166385 | 3300025972 | Bacteria | 1724 |
| 304 | Ga0207640_10000856 | 3300025981 | Bacteria | 17266 |
| 305 | Ga0207640_10040908 | 3300025981 | Bacteria | 2945 |
| 306 | Ga0207640_10043861 | 3300025981 | Bacteria | 2861 |
| 307 | Ga0207640_10729360 | 3300025981 | Bacteria | 852 |
| 308 | Ga0207658_10001264 | 3300025986 | Bacteria | 19972 |
| 309 | Ga0207658_10004102 | 3300025986 | Bacteria | 10162 |
| 310 | Ga0207658_10048630 | 3300025986 | Bacteria | 3110 |
| 311 | Ga0207658_10274505 | 3300025986 | Bacteria | 1442 |
| 312 | Ga0207658_10577629 | 3300025986 | Bacteria | 1008 |
| 313 | Ga0207677_10127003 | 3300026023 | Bacteria | 1929 |
| 314 | Ga0207677_10925834 | 3300026023 | Bacteria | 787 |
| 315 | Ga0207703_10017075 | 3300026035 | Bacteria | 5659 |
| 316 | Ga0207703_10064504 | 3300026035 | Bacteria | 3007 |
| 317 | Ga0207639_10006031 | 3300026041 | Bacteria | 8220 |
| 318 | Ga0207639_10050361 | 3300026041 | Bacteria | 3163 |
| 319 | Ga0207639_10078654 | 3300026041 | Bacteria | 2604 |
| 320 | Ga0207639_10379347 | 3300026041 | Bacteria | 1269 |
| 321 | Ga0207639_10743171 | 3300026041 | Bacteria | 912 |
| 322 | Ga0207678_10007366 | 3300026067 | Bacteria | 9739 |
| 323 | Ga0207678_10083869 | 3300026067 | Bacteria | 2726 |
| 324 | Ga0207702_10013760 | 3300026078 | Bacteria | 6720 |
| 325 | Ga0207702_10159952 | 3300026078 | Bacteria | 2056 |
| 326 | Ga0207702_10186107 | 3300026078 | Bacteria | 1915 |
| 327 | Ga0207702_10292509 | 3300026078 | Bacteria | 1543 |
| 328 | Ga0207641_10000330 | 3300026088 | Bacteria | 58123 |
| 329 | Ga0207641_10086217 | 3300026088 | Bacteria | 2737 |
| 330 | Ga0207641_10167761 | 3300026088 | Bacteria | 2001 |
| 331 | Ga0207648_10059162 | 3300026089 | Bacteria | 3342 |
| 332 | Ga0207648_10091127 | 3300026089 | Bacteria | 2665 |
| 333 | Ga0207648_10203753 | 3300026089 | Bacteria | 1755 |
| 334 | Ga0207676_10001166 | 3300026095 | Bacteria | 19777 |
| 335 | Ga0207676_10015903 | 3300026095 | Bacteria | 5442 |
| 336 | Ga0207676_10019259 | 3300026095 | Bacteria | 4975 |
| 337 | Ga0207676_10704599 | 3300026095 | Bacteria | 978 |
| 338 | Ga0207674_10000583 | 3300026116 | Bacteria | 48003 |
| 339 | Ga0207674_10034199 | 3300026116 | Bacteria | 5316 |
| 340 | Ga0207674_10251162 | 3300026116 | Bacteria | 1716 |
| 341 | Ga0207683_10001252 | 3300026121 | Bacteria | 23031 |
| 342 | Ga0207683_10047465 | 3300026121 | Bacteria | 3761 |
| 343 | Ga0207683_10138015 | 3300026121 | Bacteria | 2195 |
| 344 | Ga0207683_10151840 | 3300026121 | Bacteria | 2090 |
| 345 | Ga0207698_10001191 | 3300026142 | Bacteria | 15162 |
| 346 | Ga0207698_10003162 | 3300026142 | Bacteria | 9874 |
| 347 | Ga0207698_10016505 | 3300026142 | Bacteria | 4979 |
| 348 | Ga0207698_10430731 | 3300026142 | Bacteria | 1268 |
| 349 | Ga0207698_10451263 | 3300026142 | Bacteria | 1241 |
| 350 | Ga0207698_10542344 | 3300026142 | Bacteria | 1139 |
| 351 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 352 | Ga0268266_10006543 | 3300028379 | Bacteria | 10664 |
| 353 | Ga0268266_10318620 | 3300028379 | Bacteria | 1455 |
| 354 | Ga0268266_10768106 | 3300028379 | Bacteria | 930 |
| 355 | Ga0268265_10010441 | 3300028380 | Bacteria | 6271 |
| 356 | Ga0268265_10021504 | 3300028380 | Bacteria | 4521 |
| 357 | Ga0268265_10270459 | 3300028380 | Bacteria | 1515 |
| 358 | Ga0268264_10107785 | 3300028381 | Bacteria | 2434 |
| 359 | Ga0268264_10332375 | 3300028381 | Bacteria | 1440 |
| 360 | Ga0307517_10016777 | 3300028786 | Bacteria | 9598 |
| 361 | Ga0307513_10022404 | 3300031456 | Bacteria | 7427 |
| 362 | Ga0307408_100044723 | 3300031548 | Bacteria | 3157 |
| 363 | Ga0307408_100658162 | 3300031548 | Bacteria | 937 |
| 364 | Ga0307405_10085845 | 3300031731 | Bacteria | 2070 |
| 365 | Ga0307413_10007419 | 3300031824 | Bacteria | 5093 |
| 366 | Ga0307413_10038941 | 3300031824 | Bacteria | 2759 |
| 367 | Ga0307413_10355759 | 3300031824 | Bacteria | 1132 |
| 368 | Ga0307410_10012832 | 3300031852 | Bacteria | 4863 |
| 369 | Ga0307410_10016345 | 3300031852 | Bacteria | 4424 |
| 370 | Ga0307410_10017877 | 3300031852 | Bacteria | 4270 |
| 371 | Ga0307410_10253470 | 3300031852 | Bacteria | 1369 |
| 372 | Ga0307406_10088798 | 3300031901 | Bacteria | 2075 |
| 373 | Ga0307406_10380550 | 3300031901 | Bacteria | 1113 |
| 374 | Ga0307407_10004081 | 3300031903 | Bacteria | 6136 |
| 375 | Ga0307407_10089451 | 3300031903 | Bacteria | 1883 |
| 376 | Ga0307407_10221723 | 3300031903 | Bacteria | 1279 |
| 377 | Ga0307412_10042047 | 3300031911 | Bacteria | 2966 |
| 378 | Ga0307412_10042825 | 3300031911 | Bacteria | 2945 |
| 379 | Ga0307412_10051773 | 3300031911 | Bacteria | 2715 |
| 380 | Ga0307416_100001948 | 3300032002 | Bacteria | 11561 |
| 381 | Ga0307416_100023625 | 3300032002 | Bacteria | 4466 |
| 382 | Ga0307416_100090508 | 3300032002 | Bacteria | 2624 |
| 383 | Ga0307416_100103747 | 3300032002 | Bacteria | 2484 |
| 384 | Ga0307416_100679389 | 3300032002 | Bacteria | 1117 |
| 385 | Ga0307416_100730115 | 3300032002 | Bacteria | 1082 |
| 386 | Ga0307414_10012727 | 3300032004 | Bacteria | 4988 |
| 387 | Ga0307414_10063034 | 3300032004 | Bacteria | 2633 |
| 388 | Ga0307411_10135347 | 3300032005 | Bacteria | 1808 |
| 389 | Ga0307411_10306153 | 3300032005 | Bacteria | 1277 |
| 390 | Ga0307415_100116755 | 3300032126 | Bacteria | 1991 |
| 391 | Ga0373925_0459704 | 3300037068 | Bacteria | 1043 |
| 392 | Ga0395899_0000981 | 3300037312 | Bacteria | 26323 |
| 393 | Ga0395899_0012115 | 3300037312 | Bacteria | 6603 |
| 394 | Ga0395899_0056894 | 3300037312 | Bacteria | 2889 |
| 395 | Ga0395899_0121269 | 3300037312 | Bacteria | 1873 |
| 396 | Ga0395899_0126052 | 3300037312 | Bacteria | 1831 |
| 397 | Ga0395899_0135213 | 3300037312 | Bacteria | 1757 |
| 398 | Ga0395899_0141110 | 3300037312 | Bacteria | 1714 |
| 399 | Ga0395899_0163975 | 3300037312 | Bacteria | 1568 |
| 400 | Ga0395899_0297843 | 3300037312 | Bacteria | 1092 |
| 401 | Ga0395899_0321283 | 3300037312 | Bacteria | 1042 |
| 402 | Ga0395899_0330953 | 3300037312 | Bacteria | 1023 |
| 403 | Ga0395900_0000912 | 3300037418 | Bacteria | 38872 |
| 404 | Ga0395900_0020065 | 3300037418 | Bacteria | 6816 |
| 405 | Ga0395900_0027048 | 3300037418 | Bacteria | 5872 |
| 406 | Ga0395900_0032140 | 3300037418 | Bacteria | 5395 |
| 407 | Ga0395900_0036348 | 3300037418 | Bacteria | 5077 |
| 408 | Ga0395900_0047865 | 3300037418 | Bacteria | 4404 |
| 409 | Ga0395900_0081258 | 3300037418 | Bacteria | 3329 |
| 410 | Ga0395900_0107923 | 3300037418 | Bacteria | 2860 |
| 411 | Ga0395900_0112561 | 3300037418 | Bacteria | 2794 |
| 412 | Ga0395900_0164139 | 3300037418 | Bacteria | 2264 |
| 413 | Ga0395900_0187970 | 3300037418 | Bacteria | 2096 |
| 414 | Ga0395900_0416815 | 3300037418 | Bacteria | 1304 |
| 415 | Ga0395900_0442655 | 3300037418 | Bacteria | 1257 |
| 416 | Ga0395900_0537241 | 3300037418 | Bacteria | 1115 |
| 417 | Ga0395900_0610467 | 3300037418 | Bacteria | 1030 |
| 418 | Ga0395898_0013658 | 3300037466 | Bacteria | 8355 |
| 419 | Ga0395898_0099509 | 3300037466 | Bacteria | 2792 |
| 420 | Ga0395898_0141917 | 3300037466 | Bacteria | 2299 |
| 421 | Ga0395898_0158387 | 3300037466 | Bacteria | 2165 |
| 422 | Ga0395905_0002176 | 3300037471 | Bacteria | 22155 |
| 423 | Ga0395905_0006103 | 3300037471 | Bacteria | 12175 |
| 424 | Ga0395905_0007538 | 3300037471 | Bacteria | 10820 |
| 425 | Ga0395905_0011267 | 3300037471 | Bacteria | 8646 |
| 426 | Ga0395905_0014142 | 3300037471 | Bacteria | 7626 |
| 427 | Ga0395905_0026223 | 3300037471 | Bacteria | 5495 |
| 428 | Ga0395905_0026524 | 3300037471 | Bacteria | 5462 |
| 429 | Ga0395905_0030086 | 3300037471 | Bacteria | 5117 |
| 430 | Ga0395905_0051975 | 3300037471 | Bacteria | 3838 |
| 431 | Ga0395905_0071421 | 3300037471 | Bacteria | 3254 |
| 432 | Ga0395905_0158062 | 3300037471 | Bacteria | 2131 |
| 433 | Ga0395905_0249480 | 3300037471 | Bacteria | 1658 |
| 434 | Ga0395905_0313387 | 3300037471 | Bacteria | 1457 |
| 435 | Ga0395905_0377802 | 3300037471 | Bacteria | 1310 |
| 436 | Ga0395905_0440892 | 3300037471 | Bacteria | 1199 |
| 437 | Ga0395905_0514530 | 3300037471 | Bacteria | 1097 |
| 438 | Ga0395905_0743477 | 3300037471 | Bacteria | 883 |
| 439 | Ga0436364_1537163 | 3300037853 | Bacteria | 27026 |
| 440 | Ga0395901_0011647 | 3300038443 | Bacteria | 8907 |
| 441 | Ga0395901_0018305 | 3300038443 | Bacteria | 7152 |
| 442 | Ga0395901_0026298 | 3300038443 | Bacteria | 5976 |
| 443 | Ga0395901_0028858 | 3300038443 | Bacteria | 5707 |
| 444 | Ga0395901_0054703 | 3300038443 | Bacteria | 4149 |
| 445 | Ga0395901_0096533 | 3300038443 | Bacteria | 3097 |
| 446 | Ga0395901_0135974 | 3300038443 | Bacteria | 2583 |
| 447 | Ga0395901_0148844 | 3300038443 | Bacteria | 2460 |
| 448 | Ga0395901_0148942 | 3300038443 | Bacteria | 2459 |
| 449 | Ga0395901_0169230 | 3300038443 | Bacteria | 2293 |
| 450 | Ga0395901_0184511 | 3300038443 | Bacteria | 2188 |
| 451 | Ga0395901_0202309 | 3300038443 | Bacteria | 2081 |
| 452 | Ga0395901_0257400 | 3300038443 | Bacteria | 1817 |
| 453 | Ga0395901_0341817 | 3300038443 | Bacteria | 1546 |
| 454 | Ga0436365_0646826 | 3300039437 | Bacteria | 110896 |
| 455 | Ga0436365_1094616 | 3300039437 | Bacteria | 7416 |
| 456 | Ga0436363_0623342 | 3300039450 | Bacteria | 1526 |
| 457 | Ga0436362_0285880 | 3300039453 | Bacteria | 61821 |
| 458 | Ga0451793_1227036 | 3300041452 | Bacteria | 1246 |
| 459 | Ga0451807_0286986 | 3300041486 | Bacteria | 955 |
| 460 | Ga0439445_0004822 | 3300042004 | Bacteria | 3061 |
| 461 | Ga0439432_021453 | 3300042006 | Bacteria | 2141 |
| 462 | Ga0450917_001777 | 3300042120 | Bacteria | 1527 |
| 463 | Ga0450905_006843 | 3300042142 | Bacteria | 1546 |
| 464 | Ga0450889_000007 | 3300042144 | Bacteria | 18930 |
| 465 | Ga0466969_0003940 | 3300044656 | Bacteria | 7884 |
| 466 | Ga0466969_0010066 | 3300044656 | Bacteria | 5015 |
| 467 | Ga0466969_0104173 | 3300044656 | Bacteria | 1333 |
| 468 | Ga0466965_0166433 | 3300044683 | Bacteria | 1158 |
| 469 | Ga0466966_0001131 | 3300044684 | Bacteria | 17137 |
| 470 | Ga0466966_0022363 | 3300044684 | Bacteria | 4150 |
| 471 | Ga0466966_0032948 | 3300044684 | Bacteria | 3354 |
| 472 | Ga0466966_0062609 | 3300044684 | Bacteria | 2345 |
| 473 | Ga0466966_0064417 | 3300044684 | Bacteria | 2307 |
| 474 | Ga0466961_0009596 | 3300044693 | Bacteria | 6160 |
| 475 | Ga0466961_0108161 | 3300044693 | Bacteria | 1750 |
| 476 | Ga0466963_0002122 | 3300044694 | Bacteria | 10968 |
| 477 | Ga0466971_0003496 | 3300044719 | Bacteria | 6710 |
| 478 | Ga0466971_0008191 | 3300044719 | Bacteria | 4557 |
| 479 | Ga0466970_0012351 | 3300044765 | Bacteria | 4365 |
| 480 | Ga0466970_0025859 | 3300044765 | Bacteria | 3075 |
| 481 | Ga0466970_0160804 | 3300044765 | Bacteria | 1242 |
| 482 | Ga0466957_0001498 | 3300044842 | Bacteria | 12248 |
| 483 | Ga0466957_0046226 | 3300044842 | Bacteria | 2642 |
| 484 | Ga0466957_0047041 | 3300044842 | Bacteria | 2620 |
| 485 | Ga0466957_0237211 | 3300044842 | Bacteria | 1209 |
| 486 | Ga0466957_0592395 | 3300044842 | Bacteria | 776 |
| 487 | Ga0466959_0001847 | 3300045049 | Bacteria | 13294 |
| 488 | Ga0466959_0054064 | 3300045049 | Bacteria | 2934 |
| 489 | Ga0466959_0413957 | 3300045049 | Bacteria | 915 |
| 490 | Ga0466958_0133086 | 3300045836 | Bacteria | 1562 |
| 491 | Ga0466958_0409094 | 3300045836 | Bacteria | 876 |
| 492 | Ga0466967_0109225 | 3300045976 | Bacteria | 2539 |
| 493 | Ga0466967_0144660 | 3300045976 | Bacteria | 2217 |
| 494 | Ga0495617_088585 | 3300046452 | Bacteria | 1011 |
| 495 | Ga0495627_016713 | 3300046453 | Bacteria | 2507 |
| 496 | Ga0495638_0000548 | 3300046460 | Bacteria | 42967 |
| 497 | Ga0495650_0004011 | 3300046471 | Bacteria | 10336 |
| 498 | Ga0495584_0026211 | 3300046491 | Bacteria | 2953 |
| 499 | Ga0495585_0002479 | 3300046492 | Bacteria | 13171 |
| 500 | Ga0495585_0052876 | 3300046492 | Bacteria | 2248 |
| 501 | Ga0495585_0176447 | 3300046492 | Bacteria | 1100 |
| 502 | Ga0495596_0008712 | 3300046500 | Bacteria | 4494 |
| 503 | Ga0495596_0125314 | 3300046500 | Bacteria | 997 |
| 504 | Ga0495607_0062511 | 3300046501 | Bacteria | 2110 |
| 505 | Ga0495583_0007235 | 3300046506 | Bacteria | 7027 |
| 506 | Ga0495583_0008885 | 3300046506 | Bacteria | 6076 |
| 507 | Ga0495583_0012795 | 3300046506 | Bacteria | 4724 |
| 508 | Ga0495583_0027811 | 3300046506 | Bacteria | 2787 |
| 509 | Ga0495583_0036310 | 3300046506 | Bacteria | 2346 |
| 510 | Ga0495606_0002454 | 3300046507 | Bacteria | 21514 |
| 511 | Ga0495606_0210645 | 3300046507 | Bacteria | 1101 |
| 512 | Ga0495616_0067776 | 3300046513 | Bacteria | 1734 |
| 513 | Ga0495631_0003600 | 3300046518 | Bacteria | 8452 |
| 514 | Ga0495631_0231223 | 3300046518 | Bacteria | 789 |
| 515 | Ga0495637_0053327 | 3300046520 | Bacteria | 1684 |
| 516 | Ga0495643_0001592 | 3300046522 | Bacteria | 20138 |
| 517 | Ga0495643_0013217 | 3300046522 | Bacteria | 4950 |
| 518 | Ga0495643_0133447 | 3300046522 | Bacteria | 1244 |
| 519 | Ga0495643_0175191 | 3300046522 | Bacteria | 1046 |
| 520 | Ga0495648_0000123 | 3300046524 | Bacteria | 92159 |
| 521 | Ga0495663_0001632 | 3300046525 | Bacteria | 7012 |
| 522 | Ga0495663_0017669 | 3300046525 | Bacteria | 2026 |
| 523 | Ga0495642_0060173 | 3300046528 | Bacteria | 1575 |
| 524 | Ga0495642_0067631 | 3300046528 | Bacteria | 1490 |
| 525 | Ga0495598_0017390 | 3300046537 | Bacteria | 1852 |
| 526 | Ga0495609_0108701 | 3300046538 | Bacteria | 1198 |
| 527 | Ga0495621_0016869 | 3300046539 | Bacteria | 2351 |
| 528 | Ga0495597_0023110 | 3300046542 | Bacteria | 2878 |
| 529 | Ga0495622_0032968 | 3300046557 | Bacteria | 2418 |
| 530 | Ga0495633_0001543 | 3300046558 | Bacteria | 17680 |
| 531 | Ga0495633_0023118 | 3300046558 | Bacteria | 3081 |
| 532 | Ga0495633_0035831 | 3300046558 | Bacteria | 2381 |
| 533 | Ga0495668_0000149 | 3300046616 | Bacteria | 105826 |
| 534 | Ga0495668_0124387 | 3300046616 | Bacteria | 1411 |
| 535 | Ga0495668_0135690 | 3300046616 | Bacteria | 1347 |
| 536 | Ga0495668_0165207 | 3300046616 | Bacteria | 1212 |
| 537 | Ga0495611_0023834 | 3300046648 | Bacteria | 2659 |
| 538 | Ga0495611_0053851 | 3300046648 | Bacteria | 1817 |
| 539 | Ga0495625_0000287 | 3300046660 | Bacteria | 78023 |
| 540 | Ga0495625_0000866 | 3300046660 | Bacteria | 41162 |
| 541 | Ga0495625_0030662 | 3300046660 | Bacteria | 4009 |
| 542 | Ga0495625_0083735 | 3300046660 | Bacteria | 2216 |
| 543 | Ga0495625_0166555 | 3300046660 | Bacteria | 1473 |
| 544 | Ga0495625_0343994 | 3300046660 | Bacteria | 944 |
| 545 | Ga0495661_0080684 | 3300046665 | Bacteria | 1877 |
| 546 | Ga0495669_0000043 | 3300046684 | Bacteria | 86386 |
| 547 | Ga0495669_0023548 | 3300046684 | Bacteria | 2681 |
| 548 | Ga0495669_0068870 | 3300046684 | Bacteria | 1610 |
| 549 | Ga0495669_0074696 | 3300046684 | Bacteria | 1550 |
| 550 | Ga0495669_0077457 | 3300046684 | Bacteria | 1522 |
| 551 | Ga0495669_0155189 | 3300046684 | Bacteria | 1085 |
| 552 | Ga0495669_0200976 | 3300046684 | Bacteria | 952 |
| 553 | Ga0495670_0006982 | 3300046691 | Bacteria | 5564 |
| 554 | Ga0495670_0013710 | 3300046691 | Bacteria | 3985 |
| 555 | Ga0495649_0023596 | 3300046694 | Bacteria | 3436 |
| 556 | Ga0495600_0082007 | 3300046809 | Bacteria | 2104 |
| 557 | Ga0495660_0030707 | 3300046810 | Bacteria | 3026 |
| 558 | Ga0495636_0168785 | 3300047318 | Bacteria | 989 |
| 559 | Ga0495683_0008149 | 3300047323 | Bacteria | 5622 |
| 560 | Ga0495683_0102700 | 3300047323 | Bacteria | 1373 |
| 561 | Ga0495687_000597 | 3300047443 | Bacteria | 42130 |
| 562 | Ga0495687_000662 | 3300047443 | Bacteria | 39551 |
| 563 | Ga0495677_0007513 | 3300047445 | Bacteria | 4070 |
| 564 | Ga0495677_0011550 | 3300047445 | Bacteria | 3229 |
| 565 | Ga0495677_0135386 | 3300047445 | Bacteria | 944 |
| 566 | Ga0495681_0005807 | 3300047470 | Bacteria | 8200 |
| 567 | Ga0495686_0025393 | 3300047472 | Bacteria | 3884 |
| 568 | Ga0496101_0234871 | 3300048904 | Bacteria | 1426 |
| 569 | Ga0496101_0638471 | 3300048904 | Bacteria | 841 |
| 570 | Ga0496102_0000671 | 3300048905 | Bacteria | 34255 |
| 571 | Ga0496102_0011386 | 3300048905 | Bacteria | 7664 |
| 572 | Ga0496103_0001496 | 3300048906 | Bacteria | 15636 |
| 573 | Ga0496103_0155002 | 3300048906 | Bacteria | 1468 |
| 574 | Ga0496104_0008531 | 3300048907 | Bacteria | 9109 |
| 575 | Ga0496104_0075755 | 3300048907 | Bacteria | 3204 |
| 576 | Ga0496105_0001988 | 3300048908 | Bacteria | 14734 |
| 577 | Ga0496106_0036147 | 3300048909 | Bacteria | 3695 |
| 578 | Ga0496106_0067486 | 3300048909 | Bacteria | 2727 |
| 579 | Ga0496107_0011979 | 3300048910 | Bacteria | 6051 |
| 580 | Ga0496107_0042833 | 3300048910 | Bacteria | 3252 |
| 581 | Ga0496107_0516548 | 3300048910 | Bacteria | 886 |
| 582 | Ga0496108_0009406 | 3300048911 | Bacteria | 7914 |
| 583 | Ga0496109_0010251 | 3300048912 | Bacteria | 8002 |
| 584 | Ga0496109_0016692 | 3300048912 | Bacteria | 6423 |
| 585 | Ga0496110_0009283 | 3300048913 | Bacteria | 7955 |
| 586 | Ga0496110_0018126 | 3300048913 | Bacteria | 5897 |
| 587 | Ga0496110_0387147 | 3300048913 | Bacteria | 1274 |
| 588 | Ga0496111_0002535 | 3300048914 | Bacteria | 11025 |
| 589 | Ga0496111_0004353 | 3300048914 | Bacteria | 8935 |
| 590 | Ga0496112_0115595 | 3300048915 | Bacteria | 2653 |
| 591 | Ga0496113_0097723 | 3300048916 | Bacteria | 2272 |
| 592 | Ga0496113_0149219 | 3300048916 | Bacteria | 1843 |
| 593 | Ga0496114_0006150 | 3300048917 | Bacteria | 9448 |
| 594 | Ga0496115_0002116 | 3300048918 | Bacteria | 14197 |
| 595 | Ga0496116_0004138 | 3300048919 | Bacteria | 13977 |
| 596 | Ga0496117_0001647 | 3300048920 | Bacteria | 31391 |
| 597 | Ga0496118_0000039 | 3300048921 | Bacteria | 305458 |
| 598 | Ga0496119_0044262 | 3300048922 | Bacteria | 2805 |
| 599 | Ga0496121_0006371 | 3300048924 | Bacteria | 14695 |
| 600 | Ga0496121_0006793 | 3300048924 | Bacteria | 14018 |
| 601 | Ga0496122_0018532 | 3300048925 | Bacteria | 6423 |
| 602 | Ga0496123_0012968 | 3300048926 | Bacteria | 7043 |
| 603 | Ga0496124_0000232 | 3300048927 | Bacteria | 108986 |
| 604 | Ga0496125_0005898 | 3300048928 | Bacteria | 13428 |
| 605 | Ga0496126_0001592 | 3300048929 | Bacteria | 34561 |
| 606 | Ga0501242_007975 | 3300049674 | Bacteria | 1231 |
| 607 | Ga0501263_004726 | 3300049760 | Bacteria | 1514 |
| 608 | Ga0501035_0044606 | 3300049822 | Bacteria | 3992 |
| 609 | Ga0501044_0099738 | 3300049823 | Bacteria | 2922 |
| 610 | nmdc:mga05p37_321727_c1 | 3300050507 | Bacteria | 1830 |
| 611 | nmdc:mga05p37_658265_c1 | 3300050507 | Bacteria | 1171 |
| 612 | nmdc:mga08y16_97889_c1 | 3300050511 | Bacteria | 3055 |
| 613 | nmdc:mga0rr50_460663_c1 | 3300050513 | Bacteria | 1078 |
| 614 | Ga0500610_0000270 | 3300053079 | Bacteria | 15792 |
| 615 | Ga0500643_016290 | 3300053087 | Bacteria | 2521 |
| 616 | Ga0500566_0014559 | 3300053094 | Bacteria | 4622 |
| 617 | Ga0500595_004552 | 3300053119 | Bacteria | 6193 |
| 618 | Ga0500642_0000853 | 3300053130 | Bacteria | 8884 |
| 619 | Ga0500658_0000497 | 3300053134 | Bacteria | 16778 |
| 620 | Ga0500658_0030705 | 3300053134 | Bacteria | 2097 |
| 621 | Ga0500568_0007329 | 3300053139 | Bacteria | 5423 |
| 622 | Ga0500636_0001359 | 3300053177 | Bacteria | 13286 |
| 623 | Ga0500645_000267 | 3300053730 | Bacteria | 37622 |
| 624 | Ga0500596_000275 | 3300053735 | Bacteria | 9135 |
| 625 | Ga0466962_0024055 | 3300061719 | Bacteria | 2926 |
| 626 | Ga0466962_0268173 | 3300061719 | Bacteria | 841 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025925 | Ga0207650_10491014 | Ga0207650_104910142 | 212 |
| 2 | 3300046684 | Ga0495669_0200976 | Ga0495669_0200976_289_939 | 216 |
| 3 | 3300005327 | Ga0070658_10037099 | Ga0070658_100370995 | 219 |
| 4 | 3300005539 | Ga0068853_100040493 | Ga0068853_1000404933 | 219 |
| 5 | 3300005578 | Ga0068854_100177711 | Ga0068854_1001777112 | 219 |
| 6 | 3300005614 | Ga0068856_101211868 | Ga0068856_1012118681 | 219 |
| 7 | 3300005616 | Ga0068852_100011477 | Ga0068852_1000114772 | 219 |
| 8 | 3300009551 | Ga0105238_10014999 | Ga0105238_100149995 | 219 |
| 9 | 3300013104 | Ga0157370_10045418 | Ga0157370_100454181 | 219 |
| 10 | 3300013105 | Ga0157369_10002175 | Ga0157369_1000217518 | 219 |
| 11 | 3300025909 | Ga0207705_10079988 | Ga0207705_100799882 | 219 |
| 12 | 3300025924 | Ga0207694_10006461 | Ga0207694_100064615 | 219 |
| 13 | 3300025949 | Ga0207667_10135294 | Ga0207667_101352942 | 219 |
| 14 | 3300026041 | Ga0207639_10078654 | Ga0207639_100786542 | 219 |
| 15 | 3300026142 | Ga0207698_10003162 | Ga0207698_100031627 | 219 |
| 16 | 3300025909 | Ga0207705_10267229 | Ga0207705_102672292 | 224 |
| 17 | 3300026041 | Ga0207639_10743171 | Ga0207639_107431711 | 224 |
| 18 | 3300044842 | Ga0466957_0592395 | Ga0466957_0592395_61_765 | 224 |
| 19 | 3300046660 | Ga0495625_0343994 | Ga0495625_0343994_176_880 | 224 |
| 20 | 3300046684 | Ga0495669_0068870 | Ga0495669_0068870_140_844 | 224 |
| 21 | 3300005367 | Ga0070667_100052267 | Ga0070667_1000522674 | 225 |
| 22 | 3300005844 | Ga0068862_100132068 | Ga0068862_1001320683 | 225 |
| 23 | 3300025986 | Ga0207658_10004102 | Ga0207658_100041029 | 225 |
| 24 | 3300028380 | Ga0268265_10270459 | Ga0268265_102704592 | 225 |
| 25 | 3300046506 | Ga0495583_0036310 | Ga0495583_0036310_39_758 | 225 |
| 26 | 3300041452 | Ga0451793_1227036 | Ga0451793_1227036_376_1185 | 226 |
| 27 | 3300005327 | Ga0070658_10067263 | Ga0070658_100672632 | 227 |
| 28 | 3300005338 | Ga0068868_100093610 | Ga0068868_1000936103 | 227 |
| 29 | 3300005347 | Ga0070668_100463273 | Ga0070668_1004632731 | 227 |
| 30 | 3300005353 | Ga0070669_100154451 | Ga0070669_1001544512 | 227 |
| 31 | 3300005364 | Ga0070673_100114615 | Ga0070673_1001146152 | 227 |
| 32 | 3300005367 | Ga0070667_100002998 | Ga0070667_1000029982 | 227 |
| 33 | 3300005455 | Ga0070663_100765256 | Ga0070663_1007652561 | 227 |
| 34 | 3300005543 | Ga0070672_100324004 | Ga0070672_1003240042 | 227 |
| 35 | 3300005617 | Ga0068859_100003695 | Ga0068859_10000369516 | 227 |
| 36 | 3300005841 | Ga0068863_100002582 | Ga0068863_10000258219 | 227 |
| 37 | 3300005842 | Ga0068858_100059188 | Ga0068858_1000591882 | 227 |
| 38 | 3300005843 | Ga0068860_100006703 | Ga0068860_10000670312 | 227 |
| 39 | 3300006931 | Ga0097620_100003694 | Ga0097620_10000369416 | 227 |
| 40 | 3300009092 | Ga0105250_10007339 | Ga0105250_100073393 | 227 |
| 41 | 3300009177 | Ga0105248_10000621 | Ga0105248_1000062114 | 227 |
| 42 | 3300009553 | Ga0105249_10040895 | Ga0105249_100408954 | 227 |
| 43 | 3300013306 | Ga0163162_10497746 | Ga0163162_104977462 | 227 |
| 44 | 3300014325 | Ga0163163_10000282 | Ga0163163_1000028246 | 227 |
| 45 | 3300014968 | Ga0157379_10002202 | Ga0157379_1000220215 | 227 |
| 46 | 3300025909 | Ga0207705_10292442 | Ga0207705_102924421 | 227 |
| 47 | 3300025940 | Ga0207691_10236307 | Ga0207691_102363072 | 227 |
| 48 | 3300025941 | Ga0207711_10000440 | Ga0207711_100004404 | 227 |
| 49 | 3300025960 | Ga0207651_10154552 | Ga0207651_101545522 | 227 |
| 50 | 3300025972 | Ga0207668_10166385 | Ga0207668_101663852 | 227 |
| 51 | 3300025986 | Ga0207658_10001264 | Ga0207658_1000126417 | 227 |
| 52 | 3300026035 | Ga0207703_10017075 | Ga0207703_100170752 | 227 |
| 53 | 3300026088 | Ga0207641_10000330 | Ga0207641_1000033050 | 227 |
| 54 | 3300026095 | Ga0207676_10001166 | Ga0207676_1000116615 | 227 |
| 55 | 3300028380 | Ga0268265_10021504 | Ga0268265_100215042 | 227 |
| 56 | 3300048924 | Ga0496121_0006371 | Ga0496121_0006371_9966_10667 | 227 |
| 57 | 3300046684 | Ga0495669_0077457 | Ga0495669_0077457_261_965 | 228 |
| 58 | 3300049822 | Ga0501035_0044606 | Ga0501035_0044606_2720_3412 | 228 |
| 59 | 3300049823 | Ga0501044_0099738 | Ga0501044_0099738_1401_2093 | 228 |
| 60 | iso_pu_bacteria | 2643221622 | 2644125518 | 228 |
| 61 | 3300046522 | Ga0495643_0175191 | Ga0495643_0175191_101_808 | 229 |
| 62 | 3300001915 | JGI24741J21665_1007812 | JGI24741J21665_10078122 | 230 |
| 63 | 3300001989 | JGI24739J22299_10016731 | JGI24739J22299_100167312 | 230 |
| 64 | 3300001990 | JGI24737J22298_10000693 | JGI24737J22298_100006935 | 230 |
| 65 | 3300003215 | JGI25153J46596_10000034 | JGI25153J46596_10000034105 | 230 |
| 66 | 3300003322 | rootL2_10103814 | rootL2_101038142 | 230 |
| 67 | 3300003759 | Ga0055525_1000118 | Ga0055525_10001182 | 230 |
| 68 | 3300003762 | Ga0055542_1000012 | Ga0055542_100001232 | 230 |
| 69 | 3300003763 | Ga0055529_1000004 | Ga0055529_1000004175 | 230 |
| 70 | 3300005327 | Ga0070658_10000754 | Ga0070658_1000075414 | 230 |
| 71 | 3300005328 | Ga0070676_10028033 | Ga0070676_100280332 | 230 |
| 72 | 3300005331 | Ga0070670_100160705 | Ga0070670_1001607053 | 230 |
| 73 | 3300005339 | Ga0070660_100035536 | Ga0070660_1000355364 | 230 |
| 74 | 3300005355 | Ga0070671_100195462 | Ga0070671_1001954621 | 230 |
| 75 | 3300005356 | Ga0070674_100020454 | Ga0070674_1000204545 | 230 |
| 76 | 3300005356 | Ga0070674_100030096 | Ga0070674_1000300964 | 230 |
| 77 | 3300005366 | Ga0070659_100008434 | Ga0070659_1000084348 | 230 |
| 78 | 3300005456 | Ga0070678_100001266 | Ga0070678_1000012662 | 230 |
| 79 | 3300005457 | Ga0070662_100126142 | Ga0070662_1001261422 | 230 |
| 80 | 3300005548 | Ga0070665_100000084 | Ga0070665_100000084158 | 230 |
| 81 | 3300005564 | Ga0070664_100137964 | Ga0070664_1001379642 | 230 |
| 82 | 3300005577 | Ga0068857_100085484 | Ga0068857_1000854844 | 230 |
| 83 | 3300005578 | Ga0068854_100035398 | Ga0068854_1000353982 | 230 |
| 84 | 3300009148 | Ga0105243_10000483 | Ga0105243_100004832 | 230 |
| 85 | 3300009545 | Ga0105237_10466594 | Ga0105237_104665942 | 230 |
| 86 | 3300013100 | Ga0157373_10295535 | Ga0157373_102955351 | 230 |
| 87 | 3300013102 | Ga0157371_10000197 | Ga0157371_100001977 | 230 |
| 88 | 3300025226 | Ga0209674_108297 | Ga0209674_1082972 | 230 |
| 89 | 3300025230 | Ga0209563_100070 | Ga0209563_100070121 | 230 |
| 90 | 3300025254 | Ga0209148_1000008 | Ga0209148_1000008665 | 230 |
| 91 | 3300025261 | Ga0209233_1025638 | Ga0209233_10256381 | 230 |
| 92 | 3300025272 | Ga0209455_1000002 | Ga0209455_1000002759 | 230 |
| 93 | 3300025297 | Ga0209758_1000007 | Ga0209758_1000007576 | 230 |
| 94 | 3300025321 | Ga0207656_10017502 | Ga0207656_100175022 | 230 |
| 95 | 3300025901 | Ga0207688_10015571 | Ga0207688_100155712 | 230 |
| 96 | 3300025904 | Ga0207647_10034298 | Ga0207647_100342981 | 230 |
| 97 | 3300025907 | Ga0207645_10020296 | Ga0207645_100202964 | 230 |
| 98 | 3300025908 | Ga0207643_10330978 | Ga0207643_103309782 | 230 |
| 99 | 3300025909 | Ga0207705_10002878 | Ga0207705_1000287814 | 230 |
| 100 | 3300025911 | Ga0207654_10000926 | Ga0207654_100009265 | 230 |
| 101 | 3300025913 | Ga0207695_10014755 | Ga0207695_100147556 | 230 |
| 102 | 3300025914 | Ga0207671_10051379 | Ga0207671_100513794 | 230 |
| 103 | 3300025919 | Ga0207657_10009851 | Ga0207657_100098514 | 230 |
| 104 | 3300025920 | Ga0207649_10004939 | Ga0207649_100049392 | 230 |
| 105 | 3300025924 | Ga0207694_10036745 | Ga0207694_100367454 | 230 |
| 106 | 3300025932 | Ga0207690_10002426 | Ga0207690_100024269 | 230 |
| 107 | 3300025933 | Ga0207706_10051278 | Ga0207706_100512785 | 230 |
| 108 | 3300025935 | Ga0207709_10000005 | Ga0207709_10000005432 | 230 |
| 109 | 3300025937 | Ga0207669_10000114 | Ga0207669_1000011419 | 230 |
| 110 | 3300025937 | Ga0207669_10008496 | Ga0207669_100084965 | 230 |
| 111 | 3300025949 | Ga0207667_10000001 | Ga0207667_10000001877 | 230 |
| 112 | 3300025981 | Ga0207640_10000856 | Ga0207640_100008568 | 230 |
| 113 | 3300026041 | Ga0207639_10006031 | Ga0207639_1000603110 | 230 |
| 114 | 3300026078 | Ga0207702_10186107 | Ga0207702_101861072 | 230 |
| 115 | 3300026121 | Ga0207683_10138015 | Ga0207683_101380152 | 230 |
| 116 | 3300026142 | Ga0207698_10430731 | Ga0207698_104307312 | 230 |
| 117 | 3300028379 | Ga0268266_10000002 | Ga0268266_10000002884 | 230 |
| 118 | 3300028786 | Ga0307517_10016777 | Ga0307517_100167776 | 230 |
| 119 | 3300031456 | Ga0307513_10022404 | Ga0307513_100224042 | 230 |
| 120 | 3300037312 | Ga0395899_0121269 | Ga0395899_0121269_512_1210 | 230 |
| 121 | 3300046452 | Ga0495617_088585 | Ga0495617_088585_209_907 | 230 |
| 122 | 3300046460 | Ga0495638_0000548 | Ga0495638_0000548_32668_33378 | 230 |
| 123 | 3300046471 | Ga0495650_0004011 | Ga0495650_0004011_5997_6695 | 230 |
| 124 | 3300046491 | Ga0495584_0026211 | Ga0495584_0026211_1048_1746 | 230 |
| 125 | 3300046492 | Ga0495585_0002479 | Ga0495585_0002479_7312_8010 | 230 |
| 126 | 3300046492 | Ga0495585_0052876 | Ga0495585_0052876_1084_1782 | 230 |
| 127 | 3300046492 | Ga0495585_0176447 | Ga0495585_0176447_147_845 | 230 |
| 128 | 3300046500 | Ga0495596_0008712 | Ga0495596_0008712_3016_3714 | 230 |
| 129 | 3300046500 | Ga0495596_0125314 | Ga0495596_0125314_21_719 | 230 |
| 130 | 3300046501 | Ga0495607_0062511 | Ga0495607_0062511_592_1290 | 230 |
| 131 | 3300046506 | Ga0495583_0007235 | Ga0495583_0007235_352_1050 | 230 |
| 132 | 3300046506 | Ga0495583_0008885 | Ga0495583_0008885_1990_2688 | 230 |
| 133 | 3300046506 | Ga0495583_0012795 | Ga0495583_0012795_3827_4525 | 230 |
| 134 | 3300046506 | Ga0495583_0027811 | Ga0495583_0027811_275_973 | 230 |
| 135 | 3300046507 | Ga0495606_0002454 | Ga0495606_0002454_1011_1709 | 230 |
| 136 | 3300046507 | Ga0495606_0210645 | Ga0495606_0210645_379_1077 | 230 |
| 137 | 3300046513 | Ga0495616_0067776 | Ga0495616_0067776_940_1638 | 230 |
| 138 | 3300046518 | Ga0495631_0003600 | Ga0495631_0003600_7667_8365 | 230 |
| 139 | 3300046518 | Ga0495631_0231223 | Ga0495631_0231223_37_735 | 230 |
| 140 | 3300046520 | Ga0495637_0053327 | Ga0495637_0053327_43_741 | 230 |
| 141 | 3300046522 | Ga0495643_0001592 | Ga0495643_0001592_9272_9970 | 230 |
| 142 | 3300046522 | Ga0495643_0013217 | Ga0495643_0013217_114_812 | 230 |
| 143 | 3300046522 | Ga0495643_0133447 | Ga0495643_0133447_511_1209 | 230 |
| 144 | 3300046524 | Ga0495648_0000123 | Ga0495648_0000123_8428_9126 | 230 |
| 145 | 3300046525 | Ga0495663_0001632 | Ga0495663_0001632_3753_4451 | 230 |
| 146 | 3300046525 | Ga0495663_0017669 | Ga0495663_0017669_1279_1989 | 230 |
| 147 | 3300046528 | Ga0495642_0067631 | Ga0495642_0067631_326_1024 | 230 |
| 148 | 3300046538 | Ga0495609_0108701 | Ga0495609_0108701_406_1104 | 230 |
| 149 | 3300046542 | Ga0495597_0023110 | Ga0495597_0023110_2110_2808 | 230 |
| 150 | 3300046557 | Ga0495622_0032968 | Ga0495622_0032968_1229_1927 | 230 |
| 151 | 3300046558 | Ga0495633_0001543 | Ga0495633_0001543_2953_3651 | 230 |
| 152 | 3300046558 | Ga0495633_0023118 | Ga0495633_0023118_2063_2761 | 230 |
| 153 | 3300046616 | Ga0495668_0000149 | Ga0495668_0000149_79318_80016 | 230 |
| 154 | 3300046616 | Ga0495668_0165207 | Ga0495668_0165207_431_1129 | 230 |
| 155 | 3300046648 | Ga0495611_0023834 | Ga0495611_0023834_1069_1767 | 230 |
| 156 | 3300046648 | Ga0495611_0053851 | Ga0495611_0053851_617_1315 | 230 |
| 157 | 3300046660 | Ga0495625_0000287 | Ga0495625_0000287_43502_44212 | 230 |
| 158 | 3300046660 | Ga0495625_0000866 | Ga0495625_0000866_19356_20054 | 230 |
| 159 | 3300046660 | Ga0495625_0030662 | Ga0495625_0030662_2966_3664 | 230 |
| 160 | 3300046660 | Ga0495625_0083735 | Ga0495625_0083735_1118_1816 | 230 |
| 161 | 3300046660 | Ga0495625_0166555 | Ga0495625_0166555_527_1225 | 230 |
| 162 | 3300046665 | Ga0495661_0080684 | Ga0495661_0080684_683_1381 | 230 |
| 163 | 3300046684 | Ga0495669_0000043 | Ga0495669_0000043_59635_60333 | 230 |
| 164 | 3300046691 | Ga0495670_0013710 | Ga0495670_0013710_386_1084 | 230 |
| 165 | 3300046694 | Ga0495649_0023596 | Ga0495649_0023596_2648_3346 | 230 |
| 166 | 3300046809 | Ga0495600_0082007 | Ga0495600_0082007_1309_2007 | 230 |
| 167 | 3300046810 | Ga0495660_0030707 | Ga0495660_0030707_1448_2146 | 230 |
| 168 | 3300047318 | Ga0495636_0168785 | Ga0495636_0168785_28_726 | 230 |
| 169 | 3300047323 | Ga0495683_0008149 | Ga0495683_0008149_1127_1825 | 230 |
| 170 | 3300047443 | Ga0495687_000597 | Ga0495687_000597_26038_26736 | 230 |
| 171 | 3300047443 | Ga0495687_000662 | Ga0495687_000662_12922_13620 | 230 |
| 172 | 3300047445 | Ga0495677_0007513 | Ga0495677_0007513_3073_3771 | 230 |
| 173 | 3300047470 | Ga0495681_0005807 | Ga0495681_0005807_552_1250 | 230 |
| 174 | 3300048904 | Ga0496101_0638471 | Ga0496101_0638471_57_755 | 230 |
| 175 | 3300048905 | Ga0496102_0000671 | Ga0496102_0000671_25733_26431 | 230 |
| 176 | 3300048906 | Ga0496103_0001496 | Ga0496103_0001496_7060_7758 | 230 |
| 177 | 3300048907 | Ga0496104_0008531 | Ga0496104_0008531_5500_6198 | 230 |
| 178 | 3300048908 | Ga0496105_0001988 | Ga0496105_0001988_10942_11640 | 230 |
| 179 | 3300048913 | Ga0496110_0009283 | Ga0496110_0009283_1828_2526 | 230 |
| 180 | 3300048914 | Ga0496111_0002535 | Ga0496111_0002535_4748_5446 | 230 |
| 181 | 3300048916 | Ga0496113_0097723 | Ga0496113_0097723_365_1063 | 230 |
| 182 | 3300048917 | Ga0496114_0006150 | Ga0496114_0006150_7082_7780 | 230 |
| 183 | 3300048918 | Ga0496115_0002116 | Ga0496115_0002116_5571_6269 | 230 |
| 184 | 3300048919 | Ga0496116_0004138 | Ga0496116_0004138_5434_6132 | 230 |
| 185 | 3300048920 | Ga0496117_0001647 | Ga0496117_0001647_7124_7822 | 230 |
| 186 | 3300048921 | Ga0496118_0000039 | Ga0496118_0000039_63663_64361 | 230 |
| 187 | 3300048922 | Ga0496119_0044262 | Ga0496119_0044262_1959_2657 | 230 |
| 188 | 3300048924 | Ga0496121_0006793 | Ga0496121_0006793_5456_6154 | 230 |
| 189 | 3300048925 | Ga0496122_0018532 | Ga0496122_0018532_3899_4597 | 230 |
| 190 | 3300048926 | Ga0496123_0012968 | Ga0496123_0012968_2860_3558 | 230 |
| 191 | 3300048927 | Ga0496124_0000232 | Ga0496124_0000232_82464_83162 | 230 |
| 192 | 3300048928 | Ga0496125_0005898 | Ga0496125_0005898_7476_8174 | 230 |
| 193 | 3300048929 | Ga0496126_0001592 | Ga0496126_0001592_7893_8591 | 230 |
| 194 | 3300049674 | Ga0501242_007975 | Ga0501242_007975_496_1188 | 230 |
| 195 | 3300053079 | Ga0500610_0000270 | Ga0500610_0000270_12226_12924 | 230 |
| 196 | 3300053119 | Ga0500595_004552 | Ga0500595_004552_5383_6081 | 230 |
| 197 | 3300053130 | Ga0500642_0000853 | Ga0500642_0000853_327_1025 | 230 |
| 198 | 3300053134 | Ga0500658_0000497 | Ga0500658_0000497_4625_5335 | 230 |
| 199 | 3300053177 | Ga0500636_0001359 | Ga0500636_0001359_10667_11365 | 230 |
| 200 | 3300053730 | Ga0500645_000267 | Ga0500645_000267_10823_11521 | 230 |
| 201 | 3300053735 | Ga0500596_000275 | Ga0500596_000275_80_778 | 230 |
| 202 | 3300003775 | Ga0055524_1000409 | Ga0055524_100040929 | 231 |
| 203 | 3300003790 | Ga0055528_1032533 | Ga0055528_10325332 | 231 |
| 204 | 3300003791 | Ga0055530_10000638 | Ga0055530_1000063827 | 231 |
| 205 | 3300003794 | Ga0055531_10000640 | Ga0055531_100006406 | 231 |
| 206 | 3300003794 | Ga0055531_10035174 | Ga0055531_100351742 | 231 |
| 207 | 3300013100 | Ga0157373_10413159 | Ga0157373_104131591 | 231 |
| 208 | 3300020081 | Ga0206354_10229693 | Ga0206354_1022969310 | 231 |
| 209 | 3300020082 | Ga0206353_11805231 | Ga0206353_118052315 | 231 |
| 210 | 3300025245 | Ga0207425_1013908 | Ga0207425_10139082 | 231 |
| 211 | 3300025263 | Ga0209565_1000007 | Ga0209565_1000007377 | 231 |
| 212 | 3300025273 | Ga0209673_1003346 | Ga0209673_10033464 | 231 |
| 213 | 3300025291 | Ga0209675_1005065 | Ga0209675_10050653 | 231 |
| 214 | 3300025297 | Ga0209758_1013158 | Ga0209758_10131584 | 231 |
| 215 | 3300025298 | Ga0209050_1000010 | Ga0209050_1000010795 | 231 |
| 216 | 3300025298 | Ga0209050_1028318 | Ga0209050_10283182 | 231 |
| 217 | 3300025299 | Ga0209256_1000008 | Ga0209256_1000008219 | 231 |
| 218 | 3300025304 | Ga0209257_1000027 | Ga0209257_1000027437 | 231 |
| 219 | 3300025304 | Ga0209257_1000820 | Ga0209257_100082039 | 231 |
| 220 | 3300025304 | Ga0209257_1019962 | Ga0209257_10199622 | 231 |
| 221 | 3300026142 | Ga0207698_10542344 | Ga0207698_105423442 | 231 |
| 222 | 3300046453 | Ga0495627_016713 | Ga0495627_016713_937_1635 | 231 |
| 223 | 3300047472 | Ga0495686_0025393 | Ga0495686_0025393_50_754 | 231 |
| 224 | 3300053087 | Ga0500643_016290 | Ga0500643_016290_822_1520 | 231 |
| 225 | 3300053094 | Ga0500566_0014559 | Ga0500566_0014559_3615_4313 | 231 |
| 226 | 3300053134 | Ga0500658_0030705 | Ga0500658_0030705_1048_1746 | 231 |
| 227 | 3300053139 | Ga0500568_0007329 | Ga0500568_0007329_659_1357 | 231 |
| 228 | 3300005331 | Ga0070670_100439856 | Ga0070670_1004398562 | 232 |
| 229 | 3300005543 | Ga0070672_100364319 | Ga0070672_1003643191 | 232 |
| 230 | 3300021358 | Ga0213873_10000017 | Ga0213873_1000001755 | 232 |
| 231 | 3300021384 | Ga0213876_10000071 | Ga0213876_1000007182 | 232 |
| 232 | 3300021388 | Ga0213875_10002567 | Ga0213875_100025678 | 232 |
| 233 | 3300025925 | Ga0207650_10345440 | Ga0207650_103454402 | 232 |
| 234 | 3300031548 | Ga0307408_100044723 | Ga0307408_1000447232 | 232 |
| 235 | 3300031903 | Ga0307407_10089451 | Ga0307407_100894511 | 232 |
| 236 | 3300031911 | Ga0307412_10051773 | Ga0307412_100517733 | 232 |
| 237 | 3300032004 | Ga0307414_10012727 | Ga0307414_100127274 | 232 |
| 238 | 3300032005 | Ga0307411_10135347 | Ga0307411_101353473 | 232 |
| 239 | 3300037471 | Ga0395905_0743477 | Ga0395905_0743477_161_862 | 232 |
| 240 | 3300037853 | Ga0436364_1537163 | Ga0436364_1537163_19382_20083 | 232 |
| 241 | 3300039437 | Ga0436365_0646826 | Ga0436365_0646826_79240_79956 | 232 |
| 242 | 3300039453 | Ga0436362_0285880 | Ga0436362_0285880_18745_19461 | 232 |
| 243 | 3300044842 | Ga0466957_0046226 | Ga0466957_0046226_1628_2329 | 232 |
| 244 | 3300046616 | Ga0495668_0124387 | Ga0495668_0124387_169_873 | 232 |
| 245 | 3300061719 | Ga0466962_0268173 | Ga0466962_0268173_32_733 | 232 |
| 246 | 3300005327 | Ga0070658_10529124 | Ga0070658_105291242 | 233 |
| 247 | 3300005331 | Ga0070670_100484795 | Ga0070670_1004847951 | 233 |
| 248 | 3300005355 | Ga0070671_100017420 | Ga0070671_1000174205 | 233 |
| 249 | 3300005355 | Ga0070671_100042665 | Ga0070671_1000426653 | 233 |
| 250 | 3300005364 | Ga0070673_100176872 | Ga0070673_1001768721 | 233 |
| 251 | 3300005367 | Ga0070667_100038852 | Ga0070667_1000388523 | 233 |
| 252 | 3300005539 | Ga0068853_100048087 | Ga0068853_1000480872 | 233 |
| 253 | 3300005563 | Ga0068855_100352940 | Ga0068855_1003529402 | 233 |
| 254 | 3300005564 | Ga0070664_100050108 | Ga0070664_1000501082 | 233 |
| 255 | 3300005577 | Ga0068857_100016405 | Ga0068857_1000164052 | 233 |
| 256 | 3300005614 | Ga0068856_100103385 | Ga0068856_1001033852 | 233 |
| 257 | 3300005617 | Ga0068859_100044184 | Ga0068859_1000441844 | 233 |
| 258 | 3300005618 | Ga0068864_100074102 | Ga0068864_1000741022 | 233 |
| 259 | 3300005841 | Ga0068863_100059852 | Ga0068863_1000598522 | 233 |
| 260 | 3300005842 | Ga0068858_100092411 | Ga0068858_1000924113 | 233 |
| 261 | 3300005843 | Ga0068860_100086477 | Ga0068860_1000864772 | 233 |
| 262 | 3300005985 | Ga0081539_10197483 | Ga0081539_101974831 | 233 |
| 263 | 3300006358 | Ga0068871_100044832 | Ga0068871_1000448324 | 233 |
| 264 | 3300006931 | Ga0097620_100044180 | Ga0097620_1000441803 | 233 |
| 265 | 3300009545 | Ga0105237_10282592 | Ga0105237_102825922 | 233 |
| 266 | 3300011119 | Ga0105246_10310785 | Ga0105246_103107852 | 233 |
| 267 | 3300013102 | Ga0157371_10216383 | Ga0157371_102163832 | 233 |
| 268 | 3300014325 | Ga0163163_10202012 | Ga0163163_102020122 | 233 |
| 269 | 3300014968 | Ga0157379_10024258 | Ga0157379_100242585 | 233 |
| 270 | 3300025925 | Ga0207650_10497446 | Ga0207650_104974461 | 233 |
| 271 | 3300025931 | Ga0207644_10035622 | Ga0207644_100356223 | 233 |
| 272 | 3300025931 | Ga0207644_10481574 | Ga0207644_104815742 | 233 |
| 273 | 3300025932 | Ga0207690_10339400 | Ga0207690_103394002 | 233 |
| 274 | 3300025933 | Ga0207706_10019644 | Ga0207706_100196444 | 233 |
| 275 | 3300025945 | Ga0207679_10019457 | Ga0207679_100194574 | 233 |
| 276 | 3300025972 | Ga0207668_10151800 | Ga0207668_101518002 | 233 |
| 277 | 3300026041 | Ga0207639_10050361 | Ga0207639_100503611 | 233 |
| 278 | 3300026078 | Ga0207702_10013760 | Ga0207702_100137604 | 233 |
| 279 | 3300026088 | Ga0207641_10086217 | Ga0207641_100862174 | 233 |
| 280 | 3300026095 | Ga0207676_10019259 | Ga0207676_100192592 | 233 |
| 281 | 3300026095 | Ga0207676_10704599 | Ga0207676_107045992 | 233 |
| 282 | 3300026116 | Ga0207674_10000583 | Ga0207674_1000058318 | 233 |
| 283 | 3300028379 | Ga0268266_10318620 | Ga0268266_103186202 | 233 |
| 284 | 3300028381 | Ga0268264_10332375 | Ga0268264_103323752 | 233 |
| 285 | 3300031731 | Ga0307405_10085845 | Ga0307405_100858452 | 233 |
| 286 | 3300031824 | Ga0307413_10007419 | Ga0307413_100074194 | 233 |
| 287 | 3300031824 | Ga0307413_10038941 | Ga0307413_100389413 | 233 |
| 288 | 3300031852 | Ga0307410_10012832 | Ga0307410_100128323 | 233 |
| 289 | 3300031852 | Ga0307410_10016345 | Ga0307410_100163455 | 233 |
| 290 | 3300031852 | Ga0307410_10253470 | Ga0307410_102534702 | 233 |
| 291 | 3300031901 | Ga0307406_10088798 | Ga0307406_100887982 | 233 |
| 292 | 3300031901 | Ga0307406_10380550 | Ga0307406_103805502 | 233 |
| 293 | 3300031903 | Ga0307407_10004081 | Ga0307407_100040814 | 233 |
| 294 | 3300031911 | Ga0307412_10042047 | Ga0307412_100420472 | 233 |
| 295 | 3300032002 | Ga0307416_100023625 | Ga0307416_1000236252 | 233 |
| 296 | 3300032002 | Ga0307416_100090508 | Ga0307416_1000905083 | 233 |
| 297 | 3300032002 | Ga0307416_100103747 | Ga0307416_1001037471 | 233 |
| 298 | 3300032004 | Ga0307414_10063034 | Ga0307414_100630342 | 233 |
| 299 | 3300037312 | Ga0395899_0012115 | Ga0395899_0012115_26_730 | 233 |
| 300 | 3300037312 | Ga0395899_0135213 | Ga0395899_0135213_972_1676 | 233 |
| 301 | 3300037312 | Ga0395899_0330953 | Ga0395899_0330953_177_881 | 233 |
| 302 | 3300037418 | Ga0395900_0000912 | Ga0395900_0000912_30119_30823 | 233 |
| 303 | 3300037418 | Ga0395900_0036348 | Ga0395900_0036348_4217_4921 | 233 |
| 304 | 3300037418 | Ga0395900_0081258 | Ga0395900_0081258_904_1608 | 233 |
| 305 | 3300037418 | Ga0395900_0610467 | Ga0395900_0610467_150_854 | 233 |
| 306 | 3300037466 | Ga0395898_0099509 | Ga0395898_0099509_1399_2103 | 233 |
| 307 | 3300037466 | Ga0395898_0141917 | Ga0395898_0141917_425_1129 | 233 |
| 308 | 3300037471 | Ga0395905_0002176 | Ga0395905_0002176_13373_14077 | 233 |
| 309 | 3300037471 | Ga0395905_0011267 | Ga0395905_0011267_2852_3556 | 233 |
| 310 | 3300037471 | Ga0395905_0026223 | Ga0395905_0026223_2997_3701 | 233 |
| 311 | 3300037471 | Ga0395905_0313387 | Ga0395905_0313387_82_786 | 233 |
| 312 | 3300037471 | Ga0395905_0377802 | Ga0395905_0377802_150_854 | 233 |
| 313 | 3300037471 | Ga0395905_0440892 | Ga0395905_0440892_124_828 | 233 |
| 314 | 3300038443 | Ga0395901_0054703 | Ga0395901_0054703_1611_2315 | 233 |
| 315 | 3300038443 | Ga0395901_0096533 | Ga0395901_0096533_672_1376 | 233 |
| 316 | 3300038443 | Ga0395901_0135974 | Ga0395901_0135974_1017_1721 | 233 |
| 317 | 3300038443 | Ga0395901_0148942 | Ga0395901_0148942_864_1568 | 233 |
| 318 | 3300038443 | Ga0395901_0169230 | Ga0395901_0169230_558_1262 | 233 |
| 319 | 3300041486 | Ga0451807_0286986 | Ga0451807_0286986_214_915 | 233 |
| 320 | 3300042004 | Ga0439445_0004822 | Ga0439445_0004822_323_1024 | 233 |
| 321 | 3300042006 | Ga0439432_021453 | Ga0439432_021453_1057_1758 | 233 |
| 322 | 3300044656 | Ga0466969_0003940 | Ga0466969_0003940_3234_3938 | 233 |
| 323 | 3300044684 | Ga0466966_0001131 | Ga0466966_0001131_8553_9257 | 233 |
| 324 | 3300044684 | Ga0466966_0032948 | Ga0466966_0032948_1798_2502 | 233 |
| 325 | 3300044694 | Ga0466963_0002122 | Ga0466963_0002122_9538_10242 | 233 |
| 326 | 3300044719 | Ga0466971_0008191 | Ga0466971_0008191_1336_2040 | 233 |
| 327 | 3300044765 | Ga0466970_0012351 | Ga0466970_0012351_3355_4059 | 233 |
| 328 | 3300044842 | Ga0466957_0001498 | Ga0466957_0001498_493_1197 | 233 |
| 329 | 3300045049 | Ga0466959_0001847 | Ga0466959_0001847_5937_6641 | 233 |
| 330 | 3300048905 | Ga0496102_0011386 | Ga0496102_0011386_3231_3935 | 233 |
| 331 | 3300048907 | Ga0496104_0075755 | Ga0496104_0075755_819_1523 | 233 |
| 332 | 3300048909 | Ga0496106_0036147 | Ga0496106_0036147_235_939 | 233 |
| 333 | 3300048910 | Ga0496107_0011979 | Ga0496107_0011979_4692_5396 | 233 |
| 334 | 3300048911 | Ga0496108_0009406 | Ga0496108_0009406_1264_1968 | 233 |
| 335 | 3300048912 | Ga0496109_0010251 | Ga0496109_0010251_6077_6781 | 233 |
| 336 | 3300048913 | Ga0496110_0018126 | Ga0496110_0018126_1258_1962 | 233 |
| 337 | 3300048914 | Ga0496111_0004353 | Ga0496111_0004353_3272_3976 | 233 |
| 338 | 3300048915 | Ga0496112_0115595 | Ga0496112_0115595_1280_1984 | 233 |
| 339 | 3300048916 | Ga0496113_0149219 | Ga0496113_0149219_943_1647 | 233 |
| 340 | 3300050513 | nmdc:mga0rr50_460663_c1 | nmdc:mga0rr50_460663_c1_340_1041 | 233 |
| 341 | 3300061719 | Ga0466962_0024055 | Ga0466962_0024055_1829_2533 | 233 |
| 342 | 3300001904 | JGI24736J21556_1008888 | JGI24736J21556_10088882 | 234 |
| 343 | 3300001989 | JGI24739J22299_10030728 | JGI24739J22299_100307282 | 234 |
| 344 | 3300001989 | JGI24739J22299_10038800 | JGI24739J22299_100388001 | 234 |
| 345 | 3300001990 | JGI24737J22298_10002430 | JGI24737J22298_100024307 | 234 |
| 346 | 3300001990 | JGI24737J22298_10006127 | JGI24737J22298_100061271 | 234 |
| 347 | 3300005327 | Ga0070658_10010209 | Ga0070658_100102095 | 234 |
| 348 | 3300005327 | Ga0070658_10028140 | Ga0070658_100281403 | 234 |
| 349 | 3300005327 | Ga0070658_10036358 | Ga0070658_100363581 | 234 |
| 350 | 3300005327 | Ga0070658_10068348 | Ga0070658_100683483 | 234 |
| 351 | 3300005327 | Ga0070658_10090281 | Ga0070658_100902813 | 234 |
| 352 | 3300005327 | Ga0070658_10179251 | Ga0070658_101792512 | 234 |
| 353 | 3300005328 | Ga0070676_10003403 | Ga0070676_100034036 | 234 |
| 354 | 3300005331 | Ga0070670_100001616 | Ga0070670_1000016169 | 234 |
| 355 | 3300005331 | Ga0070670_100258809 | Ga0070670_1002588091 | 234 |
| 356 | 3300005333 | Ga0070677_10146964 | Ga0070677_101469641 | 234 |
| 357 | 3300005335 | Ga0070666_10214656 | Ga0070666_102146561 | 234 |
| 358 | 3300005336 | Ga0070680_100009968 | Ga0070680_1000099687 | 234 |
| 359 | 3300005336 | Ga0070680_100019844 | Ga0070680_1000198444 | 234 |
| 360 | 3300005339 | Ga0070660_100042929 | Ga0070660_1000429293 | 234 |
| 361 | 3300005339 | Ga0070660_100055731 | Ga0070660_1000557312 | 234 |
| 362 | 3300005339 | Ga0070660_100066893 | Ga0070660_1000668933 | 234 |
| 363 | 3300005339 | Ga0070660_100076595 | Ga0070660_1000765951 | 234 |
| 364 | 3300005339 | Ga0070660_100187314 | Ga0070660_1001873142 | 234 |
| 365 | 3300005339 | Ga0070660_100270638 | Ga0070660_1002706381 | 234 |
| 366 | 3300005339 | Ga0070660_100568269 | Ga0070660_1005682691 | 234 |
| 367 | 3300005344 | Ga0070661_100024122 | Ga0070661_1000241223 | 234 |
| 368 | 3300005344 | Ga0070661_100056748 | Ga0070661_1000567482 | 234 |
| 369 | 3300005344 | Ga0070661_100128181 | Ga0070661_1001281813 | 234 |
| 370 | 3300005344 | Ga0070661_100316753 | Ga0070661_1003167531 | 234 |
| 371 | 3300005347 | Ga0070668_100004873 | Ga0070668_1000048739 | 234 |
| 372 | 3300005347 | Ga0070668_100220882 | Ga0070668_1002208822 | 234 |
| 373 | 3300005353 | Ga0070669_100010130 | Ga0070669_1000101306 | 234 |
| 374 | 3300005355 | Ga0070671_100001670 | Ga0070671_1000016708 | 234 |
| 375 | 3300005355 | Ga0070671_100002301 | Ga0070671_1000023018 | 234 |
| 376 | 3300005355 | Ga0070671_100011559 | Ga0070671_1000115593 | 234 |
| 377 | 3300005355 | Ga0070671_100023096 | Ga0070671_1000230965 | 234 |
| 378 | 3300005356 | Ga0070674_100091528 | Ga0070674_1000915283 | 234 |
| 379 | 3300005364 | Ga0070673_100038330 | Ga0070673_1000383304 | 234 |
| 380 | 3300005364 | Ga0070673_100066413 | Ga0070673_1000664132 | 234 |
| 381 | 3300005366 | Ga0070659_100019549 | Ga0070659_1000195496 | 234 |
| 382 | 3300005366 | Ga0070659_100043977 | Ga0070659_1000439772 | 234 |
| 383 | 3300005366 | Ga0070659_100075882 | Ga0070659_1000758822 | 234 |
| 384 | 3300005367 | Ga0070667_100052950 | Ga0070667_1000529505 | 234 |
| 385 | 3300005435 | Ga0070714_100204247 | Ga0070714_1002042472 | 234 |
| 386 | 3300005435 | Ga0070714_100293540 | Ga0070714_1002935402 | 234 |
| 387 | 3300005455 | Ga0070663_100494519 | Ga0070663_1004945191 | 234 |
| 388 | 3300005456 | Ga0070678_100001009 | Ga0070678_10000100915 | 234 |
| 389 | 3300005456 | Ga0070678_100022762 | Ga0070678_1000227623 | 234 |
| 390 | 3300005456 | Ga0070678_100050397 | Ga0070678_1000503974 | 234 |
| 391 | 3300005457 | Ga0070662_100006947 | Ga0070662_1000069473 | 234 |
| 392 | 3300005457 | Ga0070662_100021124 | Ga0070662_1000211244 | 234 |
| 393 | 3300005457 | Ga0070662_100146151 | Ga0070662_1001461512 | 234 |
| 394 | 3300005457 | Ga0070662_100254961 | Ga0070662_1002549611 | 234 |
| 395 | 3300005458 | Ga0070681_10112452 | Ga0070681_101124523 | 234 |
| 396 | 3300005458 | Ga0070681_10436387 | Ga0070681_104363871 | 234 |
| 397 | 3300005459 | Ga0068867_100090577 | Ga0068867_1000905771 | 234 |
| 398 | 3300005459 | Ga0068867_100098368 | Ga0068867_1000983683 | 234 |
| 399 | 3300005467 | Ga0070706_100262434 | Ga0070706_1002624341 | 234 |
| 400 | 3300005530 | Ga0070679_100319653 | Ga0070679_1003196532 | 234 |
| 401 | 3300005535 | Ga0070684_100657695 | Ga0070684_1006576951 | 234 |
| 402 | 3300005543 | Ga0070672_100032060 | Ga0070672_1000320602 | 234 |
| 403 | 3300005543 | Ga0070672_100443326 | Ga0070672_1004433262 | 234 |
| 404 | 3300005545 | Ga0070695_100013031 | Ga0070695_1000130315 | 234 |
| 405 | 3300005549 | Ga0070704_100373167 | Ga0070704_1003731671 | 234 |
| 406 | 3300005563 | Ga0068855_100211839 | Ga0068855_1002118392 | 234 |
| 407 | 3300005563 | Ga0068855_100590333 | Ga0068855_1005903331 | 234 |
| 408 | 3300005564 | Ga0070664_100000675 | Ga0070664_1000006757 | 234 |
| 409 | 3300005564 | Ga0070664_100042795 | Ga0070664_1000427955 | 234 |
| 410 | 3300005578 | Ga0068854_100053546 | Ga0068854_1000535462 | 234 |
| 411 | 3300005578 | Ga0068854_100117337 | Ga0068854_1001173372 | 234 |
| 412 | 3300005578 | Ga0068854_100126818 | Ga0068854_1001268182 | 234 |
| 413 | 3300005614 | Ga0068856_100118569 | Ga0068856_1001185693 | 234 |
| 414 | 3300005614 | Ga0068856_100894110 | Ga0068856_1008941102 | 234 |
| 415 | 3300005616 | Ga0068852_100008231 | Ga0068852_10000823111 | 234 |
| 416 | 3300005617 | Ga0068859_100258709 | Ga0068859_1002587092 | 234 |
| 417 | 3300005618 | Ga0068864_100034399 | Ga0068864_1000343995 | 234 |
| 418 | 3300005842 | Ga0068858_100078820 | Ga0068858_1000788202 | 234 |
| 419 | 3300005843 | Ga0068860_100014445 | Ga0068860_1000144455 | 234 |
| 420 | 3300005844 | Ga0068862_100050427 | Ga0068862_1000504275 | 234 |
| 421 | 3300005844 | Ga0068862_100522627 | Ga0068862_1005226272 | 234 |
| 422 | 3300006237 | Ga0097621_100027147 | Ga0097621_1000271473 | 234 |
| 423 | 3300006358 | Ga0068871_100210400 | Ga0068871_1002104002 | 234 |
| 424 | 3300006880 | Ga0075429_100352699 | Ga0075429_1003526992 | 234 |
| 425 | 3300006881 | Ga0068865_100207258 | Ga0068865_1002072582 | 234 |
| 426 | 3300006931 | Ga0097620_100258706 | Ga0097620_1002587062 | 234 |
| 427 | 3300009093 | Ga0105240_10042240 | Ga0105240_100422402 | 234 |
| 428 | 3300009093 | Ga0105240_10472610 | Ga0105240_104726102 | 234 |
| 429 | 3300009094 | Ga0111539_10020298 | Ga0111539_100202982 | 234 |
| 430 | 3300009098 | Ga0105245_10101888 | Ga0105245_101018882 | 234 |
| 431 | 3300009147 | Ga0114129_10387600 | Ga0114129_103876002 | 234 |
| 432 | 3300009147 | Ga0114129_10440981 | Ga0114129_104409812 | 234 |
| 433 | 3300009177 | Ga0105248_10211631 | Ga0105248_102116312 | 234 |
| 434 | 3300009177 | Ga0105248_10956561 | Ga0105248_109565612 | 234 |
| 435 | 3300011119 | Ga0105246_10811393 | Ga0105246_108113931 | 234 |
| 436 | 3300013100 | Ga0157373_10354164 | Ga0157373_103541642 | 234 |
| 437 | 3300013102 | Ga0157371_10388944 | Ga0157371_103889442 | 234 |
| 438 | 3300013102 | Ga0157371_10432192 | Ga0157371_104321922 | 234 |
| 439 | 3300013104 | Ga0157370_10024985 | Ga0157370_100249855 | 234 |
| 440 | 3300013105 | Ga0157369_10010869 | Ga0157369_100108694 | 234 |
| 441 | 3300013105 | Ga0157369_10064124 | Ga0157369_100641242 | 234 |
| 442 | 3300013105 | Ga0157369_10119551 | Ga0157369_101195513 | 234 |
| 443 | 3300013105 | Ga0157369_10630986 | Ga0157369_106309862 | 234 |
| 444 | 3300013306 | Ga0163162_10447777 | Ga0163162_104477772 | 234 |
| 445 | 3300013307 | Ga0157372_10228222 | Ga0157372_102282223 | 234 |
| 446 | 3300013308 | Ga0157375_10052488 | Ga0157375_100524883 | 234 |
| 447 | 3300020069 | Ga0197907_10778048 | Ga0197907_107780482 | 234 |
| 448 | 3300020081 | Ga0206354_10185466 | Ga0206354_101854661 | 234 |
| 449 | 3300020081 | Ga0206354_11061492 | Ga0206354_110614922 | 234 |
| 450 | 3300020082 | Ga0206353_11730299 | Ga0206353_117302992 | 234 |
| 451 | 3300021377 | Ga0213874_10088014 | Ga0213874_100880142 | 234 |
| 452 | 3300021384 | Ga0213876_10004712 | Ga0213876_100047122 | 234 |
| 453 | 3300025315 | Ga0207697_10140921 | Ga0207697_101409211 | 234 |
| 454 | 3300025893 | Ga0207682_10062223 | Ga0207682_100622232 | 234 |
| 455 | 3300025893 | Ga0207682_10071084 | Ga0207682_100710842 | 234 |
| 456 | 3300025899 | Ga0207642_10156573 | Ga0207642_101565732 | 234 |
| 457 | 3300025901 | Ga0207688_10134322 | Ga0207688_101343222 | 234 |
| 458 | 3300025903 | Ga0207680_10082463 | Ga0207680_100824632 | 234 |
| 459 | 3300025904 | Ga0207647_10008080 | Ga0207647_1000808010 | 234 |
| 460 | 3300025907 | Ga0207645_10012375 | Ga0207645_100123752 | 234 |
| 461 | 3300025908 | Ga0207643_10208782 | Ga0207643_102087822 | 234 |
| 462 | 3300025909 | Ga0207705_10006763 | Ga0207705_100067635 | 234 |
| 463 | 3300025909 | Ga0207705_10011161 | Ga0207705_100111614 | 234 |
| 464 | 3300025909 | Ga0207705_10155627 | Ga0207705_101556272 | 234 |
| 465 | 3300025912 | Ga0207707_10346080 | Ga0207707_103460801 | 234 |
| 466 | 3300025913 | Ga0207695_10016672 | Ga0207695_100166728 | 234 |
| 467 | 3300025917 | Ga0207660_10005359 | Ga0207660_100053597 | 234 |
| 468 | 3300025917 | Ga0207660_10341581 | Ga0207660_103415812 | 234 |
| 469 | 3300025919 | Ga0207657_10082386 | Ga0207657_100823862 | 234 |
| 470 | 3300025919 | Ga0207657_10157896 | Ga0207657_101578962 | 234 |
| 471 | 3300025919 | Ga0207657_10288688 | Ga0207657_102886882 | 234 |
| 472 | 3300025920 | Ga0207649_10014509 | Ga0207649_100145094 | 234 |
| 473 | 3300025920 | Ga0207649_10198862 | Ga0207649_101988622 | 234 |
| 474 | 3300025921 | Ga0207652_10222850 | Ga0207652_102228501 | 234 |
| 475 | 3300025925 | Ga0207650_10066669 | Ga0207650_100666692 | 234 |
| 476 | 3300025929 | Ga0207664_10121453 | Ga0207664_101214533 | 234 |
| 477 | 3300025929 | Ga0207664_10259529 | Ga0207664_102595292 | 234 |
| 478 | 3300025931 | Ga0207644_10000090 | Ga0207644_1000009057 | 234 |
| 479 | 3300025931 | Ga0207644_10004166 | Ga0207644_100041665 | 234 |
| 480 | 3300025932 | Ga0207690_10017183 | Ga0207690_100171835 | 234 |
| 481 | 3300025932 | Ga0207690_10258945 | Ga0207690_102589452 | 234 |
| 482 | 3300025933 | Ga0207706_10033286 | Ga0207706_100332862 | 234 |
| 483 | 3300025933 | Ga0207706_10047381 | Ga0207706_100473813 | 234 |
| 484 | 3300025933 | Ga0207706_10064965 | Ga0207706_100649652 | 234 |
| 485 | 3300025933 | Ga0207706_10389731 | Ga0207706_103897311 | 234 |
| 486 | 3300025940 | Ga0207691_10122014 | Ga0207691_101220142 | 234 |
| 487 | 3300025940 | Ga0207691_10311357 | Ga0207691_103113572 | 234 |
| 488 | 3300025941 | Ga0207711_10004825 | Ga0207711_100048257 | 234 |
| 489 | 3300025941 | Ga0207711_10014217 | Ga0207711_100142172 | 234 |
| 490 | 3300025941 | Ga0207711_10188335 | Ga0207711_101883352 | 234 |
| 491 | 3300025942 | Ga0207689_10108220 | Ga0207689_101082202 | 234 |
| 492 | 3300025944 | Ga0207661_10049671 | Ga0207661_100496712 | 234 |
| 493 | 3300025945 | Ga0207679_10001267 | Ga0207679_1000126713 | 234 |
| 494 | 3300025949 | Ga0207667_10132048 | Ga0207667_101320483 | 234 |
| 495 | 3300025949 | Ga0207667_10323464 | Ga0207667_103234642 | 234 |
| 496 | 3300025949 | Ga0207667_10365508 | Ga0207667_103655082 | 234 |
| 497 | 3300025960 | Ga0207651_10364638 | Ga0207651_103646382 | 234 |
| 498 | 3300025960 | Ga0207651_10367197 | Ga0207651_103671971 | 234 |
| 499 | 3300025972 | Ga0207668_10000107 | Ga0207668_1000010746 | 234 |
| 500 | 3300025981 | Ga0207640_10040908 | Ga0207640_100409084 | 234 |
| 501 | 3300025981 | Ga0207640_10043861 | Ga0207640_100438613 | 234 |
| 502 | 3300025981 | Ga0207640_10729360 | Ga0207640_107293601 | 234 |
| 503 | 3300025986 | Ga0207658_10048630 | Ga0207658_100486303 | 234 |
| 504 | 3300025986 | Ga0207658_10274505 | Ga0207658_102745052 | 234 |
| 505 | 3300025986 | Ga0207658_10577629 | Ga0207658_105776292 | 234 |
| 506 | 3300026023 | Ga0207677_10127003 | Ga0207677_101270033 | 234 |
| 507 | 3300026023 | Ga0207677_10925834 | Ga0207677_109258341 | 234 |
| 508 | 3300026035 | Ga0207703_10064504 | Ga0207703_100645043 | 234 |
| 509 | 3300026041 | Ga0207639_10379347 | Ga0207639_103793471 | 234 |
| 510 | 3300026067 | Ga0207678_10007366 | Ga0207678_100073666 | 234 |
| 511 | 3300026067 | Ga0207678_10083869 | Ga0207678_100838691 | 234 |
| 512 | 3300026078 | Ga0207702_10159952 | Ga0207702_101599522 | 234 |
| 513 | 3300026078 | Ga0207702_10292509 | Ga0207702_102925092 | 234 |
| 514 | 3300026088 | Ga0207641_10167761 | Ga0207641_101677612 | 234 |
| 515 | 3300026089 | Ga0207648_10059162 | Ga0207648_100591622 | 234 |
| 516 | 3300026089 | Ga0207648_10091127 | Ga0207648_100911272 | 234 |
| 517 | 3300026089 | Ga0207648_10203753 | Ga0207648_102037532 | 234 |
| 518 | 3300026095 | Ga0207676_10015903 | Ga0207676_100159033 | 234 |
| 519 | 3300026116 | Ga0207674_10034199 | Ga0207674_100341995 | 234 |
| 520 | 3300026116 | Ga0207674_10251162 | Ga0207674_102511622 | 234 |
| 521 | 3300026121 | Ga0207683_10001252 | Ga0207683_100012523 | 234 |
| 522 | 3300026121 | Ga0207683_10047465 | Ga0207683_100474654 | 234 |
| 523 | 3300026121 | Ga0207683_10151840 | Ga0207683_101518403 | 234 |
| 524 | 3300026142 | Ga0207698_10001191 | Ga0207698_100011913 | 234 |
| 525 | 3300026142 | Ga0207698_10016505 | Ga0207698_100165054 | 234 |
| 526 | 3300026142 | Ga0207698_10451263 | Ga0207698_104512632 | 234 |
| 527 | 3300028379 | Ga0268266_10006543 | Ga0268266_1000654311 | 234 |
| 528 | 3300028379 | Ga0268266_10768106 | Ga0268266_107681061 | 234 |
| 529 | 3300028380 | Ga0268265_10010441 | Ga0268265_100104415 | 234 |
| 530 | 3300028381 | Ga0268264_10107785 | Ga0268264_101077852 | 234 |
| 531 | 3300031548 | Ga0307408_100658162 | Ga0307408_1006581621 | 234 |
| 532 | 3300031824 | Ga0307413_10355759 | Ga0307413_103557592 | 234 |
| 533 | 3300031852 | Ga0307410_10017877 | Ga0307410_100178772 | 234 |
| 534 | 3300031903 | Ga0307407_10221723 | Ga0307407_102217232 | 234 |
| 535 | 3300031911 | Ga0307412_10042825 | Ga0307412_100428252 | 234 |
| 536 | 3300032002 | Ga0307416_100001948 | Ga0307416_1000019484 | 234 |
| 537 | 3300032002 | Ga0307416_100679389 | Ga0307416_1006793891 | 234 |
| 538 | 3300032002 | Ga0307416_100730115 | Ga0307416_1007301152 | 234 |
| 539 | 3300032005 | Ga0307411_10306153 | Ga0307411_103061532 | 234 |
| 540 | 3300032126 | Ga0307415_100116755 | Ga0307415_1001167552 | 234 |
| 541 | 3300037068 | Ga0373925_0459704 | Ga0373925_0459704_130_837 | 234 |
| 542 | 3300037312 | Ga0395899_0000981 | Ga0395899_0000981_15395_16099 | 234 |
| 543 | 3300037312 | Ga0395899_0056894 | Ga0395899_0056894_1251_1955 | 234 |
| 544 | 3300037312 | Ga0395899_0126052 | Ga0395899_0126052_866_1570 | 234 |
| 545 | 3300037312 | Ga0395899_0141110 | Ga0395899_0141110_438_1142 | 234 |
| 546 | 3300037312 | Ga0395899_0163975 | Ga0395899_0163975_604_1308 | 234 |
| 547 | 3300037312 | Ga0395899_0297843 | Ga0395899_0297843_54_758 | 234 |
| 548 | 3300037312 | Ga0395899_0321283 | Ga0395899_0321283_285_989 | 234 |
| 549 | 3300037418 | Ga0395900_0020065 | Ga0395900_0020065_2631_3335 | 234 |
| 550 | 3300037418 | Ga0395900_0027048 | Ga0395900_0027048_4472_5176 | 234 |
| 551 | 3300037418 | Ga0395900_0032140 | Ga0395900_0032140_1817_2521 | 234 |
| 552 | 3300037418 | Ga0395900_0047865 | Ga0395900_0047865_2054_2758 | 234 |
| 553 | 3300037418 | Ga0395900_0107923 | Ga0395900_0107923_1808_2512 | 234 |
| 554 | 3300037418 | Ga0395900_0112561 | Ga0395900_0112561_1487_2191 | 234 |
| 555 | 3300037418 | Ga0395900_0164139 | Ga0395900_0164139_1034_1738 | 234 |
| 556 | 3300037418 | Ga0395900_0187970 | Ga0395900_0187970_982_1686 | 234 |
| 557 | 3300037418 | Ga0395900_0416815 | Ga0395900_0416815_362_1066 | 234 |
| 558 | 3300037418 | Ga0395900_0442655 | Ga0395900_0442655_41_745 | 234 |
| 559 | 3300037418 | Ga0395900_0537241 | Ga0395900_0537241_21_725 | 234 |
| 560 | 3300037466 | Ga0395898_0013658 | Ga0395898_0013658_2281_2985 | 234 |
| 561 | 3300037466 | Ga0395898_0158387 | Ga0395898_0158387_358_1062 | 234 |
| 562 | 3300037471 | Ga0395905_0006103 | Ga0395905_0006103_7173_7877 | 234 |
| 563 | 3300037471 | Ga0395905_0007538 | Ga0395905_0007538_4732_5436 | 234 |
| 564 | 3300037471 | Ga0395905_0014142 | Ga0395905_0014142_3000_3704 | 234 |
| 565 | 3300037471 | Ga0395905_0026524 | Ga0395905_0026524_3392_4096 | 234 |
| 566 | 3300037471 | Ga0395905_0030086 | Ga0395905_0030086_1247_1951 | 234 |
| 567 | 3300037471 | Ga0395905_0051975 | Ga0395905_0051975_1130_1834 | 234 |
| 568 | 3300037471 | Ga0395905_0071421 | Ga0395905_0071421_77_781 | 234 |
| 569 | 3300037471 | Ga0395905_0158062 | Ga0395905_0158062_1081_1785 | 234 |
| 570 | 3300037471 | Ga0395905_0249480 | Ga0395905_0249480_446_1150 | 234 |
| 571 | 3300037471 | Ga0395905_0514530 | Ga0395905_0514530_110_814 | 234 |
| 572 | 3300038443 | Ga0395901_0011647 | Ga0395901_0011647_3371_4075 | 234 |
| 573 | 3300038443 | Ga0395901_0018305 | Ga0395901_0018305_1906_2610 | 234 |
| 574 | 3300038443 | Ga0395901_0026298 | Ga0395901_0026298_1006_1710 | 234 |
| 575 | 3300038443 | Ga0395901_0028858 | Ga0395901_0028858_170_874 | 234 |
| 576 | 3300038443 | Ga0395901_0148844 | Ga0395901_0148844_205_909 | 234 |
| 577 | 3300038443 | Ga0395901_0184511 | Ga0395901_0184511_56_760 | 234 |
| 578 | 3300038443 | Ga0395901_0202309 | Ga0395901_0202309_1232_1936 | 234 |
| 579 | 3300038443 | Ga0395901_0257400 | Ga0395901_0257400_176_880 | 234 |
| 580 | 3300038443 | Ga0395901_0341817 | Ga0395901_0341817_514_1218 | 234 |
| 581 | 3300039437 | Ga0436365_1094616 | Ga0436365_1094616_773_1477 | 234 |
| 582 | 3300039450 | Ga0436363_0623342 | Ga0436363_0623342_671_1375 | 234 |
| 583 | 3300042120 | Ga0450917_001777 | Ga0450917_001777_783_1487 | 234 |
| 584 | 3300042142 | Ga0450905_006843 | Ga0450905_006843_244_948 | 234 |
| 585 | 3300042144 | Ga0450889_000007 | Ga0450889_000007_14069_14773 | 234 |
| 586 | 3300044656 | Ga0466969_0010066 | Ga0466969_0010066_2844_3548 | 234 |
| 587 | 3300044656 | Ga0466969_0104173 | Ga0466969_0104173_195_899 | 234 |
| 588 | 3300044683 | Ga0466965_0166433 | Ga0466965_0166433_381_1085 | 234 |
| 589 | 3300044684 | Ga0466966_0022363 | Ga0466966_0022363_818_1522 | 234 |
| 590 | 3300044684 | Ga0466966_0062609 | Ga0466966_0062609_535_1239 | 234 |
| 591 | 3300044684 | Ga0466966_0064417 | Ga0466966_0064417_482_1186 | 234 |
| 592 | 3300044693 | Ga0466961_0009596 | Ga0466961_0009596_2170_2874 | 234 |
| 593 | 3300044693 | Ga0466961_0108161 | Ga0466961_0108161_363_1067 | 234 |
| 594 | 3300044719 | Ga0466971_0003496 | Ga0466971_0003496_3742_4446 | 234 |
| 595 | 3300044765 | Ga0466970_0025859 | Ga0466970_0025859_1648_2352 | 234 |
| 596 | 3300044765 | Ga0466970_0160804 | Ga0466970_0160804_111_815 | 234 |
| 597 | 3300044842 | Ga0466957_0047041 | Ga0466957_0047041_944_1648 | 234 |
| 598 | 3300044842 | Ga0466957_0237211 | Ga0466957_0237211_255_962 | 234 |
| 599 | 3300045049 | Ga0466959_0054064 | Ga0466959_0054064_1313_2017 | 234 |
| 600 | 3300045049 | Ga0466959_0413957 | Ga0466959_0413957_160_864 | 234 |
| 601 | 3300045836 | Ga0466958_0133086 | Ga0466958_0133086_739_1443 | 234 |
| 602 | 3300045836 | Ga0466958_0409094 | Ga0466958_0409094_40_744 | 234 |
| 603 | 3300045976 | Ga0466967_0109225 | Ga0466967_0109225_991_1743 | 234 |
| 604 | 3300045976 | Ga0466967_0144660 | Ga0466967_0144660_85_789 | 234 |
| 605 | 3300046528 | Ga0495642_0060173 | Ga0495642_0060173_270_974 | 234 |
| 606 | 3300046537 | Ga0495598_0017390 | Ga0495598_0017390_1052_1756 | 234 |
| 607 | 3300046539 | Ga0495621_0016869 | Ga0495621_0016869_1122_1826 | 234 |
| 608 | 3300046558 | Ga0495633_0035831 | Ga0495633_0035831_1594_2298 | 234 |
| 609 | 3300046616 | Ga0495668_0135690 | Ga0495668_0135690_459_1163 | 234 |
| 610 | 3300046684 | Ga0495669_0023548 | Ga0495669_0023548_765_1469 | 234 |
| 611 | 3300046684 | Ga0495669_0074696 | Ga0495669_0074696_89_793 | 234 |
| 612 | 3300046684 | Ga0495669_0155189 | Ga0495669_0155189_306_1010 | 234 |
| 613 | 3300046691 | Ga0495670_0006982 | Ga0495670_0006982_3826_4530 | 234 |
| 614 | 3300047323 | Ga0495683_0102700 | Ga0495683_0102700_94_798 | 234 |
| 615 | 3300047445 | Ga0495677_0011550 | Ga0495677_0011550_1073_1777 | 234 |
| 616 | 3300047445 | Ga0495677_0135386 | Ga0495677_0135386_24_728 | 234 |
| 617 | 3300048904 | Ga0496101_0234871 | Ga0496101_0234871_207_911 | 234 |
| 618 | 3300048906 | Ga0496103_0155002 | Ga0496103_0155002_263_967 | 234 |
| 619 | 3300048909 | Ga0496106_0067486 | Ga0496106_0067486_347_1066 | 234 |
| 620 | 3300048910 | Ga0496107_0042833 | Ga0496107_0042833_1662_2381 | 234 |
| 621 | 3300048910 | Ga0496107_0516548 | Ga0496107_0516548_138_845 | 234 |
| 622 | 3300048912 | Ga0496109_0016692 | Ga0496109_0016692_1249_1953 | 234 |
| 623 | 3300048913 | Ga0496110_0387147 | Ga0496110_0387147_318_1022 | 234 |
| 624 | 3300049760 | Ga0501263_004726 | Ga0501263_004726_476_1180 | 234 |
| 625 | 3300050507 | nmdc:mga05p37_321727_c1 | nmdc:mga05p37_321727_c1_527_1231 | 234 |
| 626 | 3300050507 | nmdc:mga05p37_658265_c1 | nmdc:mga05p37_658265_c1_106_810 | 234 |
| 627 | 3300050511 | nmdc:mga08y16_97889_c1 | nmdc:mga08y16_97889_c1_1330_2034 | 234 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1uzl-assembly1.cif.gz_B-2 | maba from mycobacterium tuberculosis | 0.9064 | 2 | 229 |
| 5ovl-assembly1.cif.gz_D | crystal structure of maba bound to nadp+ from m. smegmatis | 0.9024 | 2 | 229 |
| 1g6k-assembly1.cif.gz_A | crystal structure of glucose dehydrogenase mutant e96a complexed with nad+ | 0.9011 | 3 | 229 |
| 1gco-assembly1.cif.gz_A | crystal structure of glucose dehydrogenase complexed with nad+ | 0.8987 | 3 | 229 |
| 3aus-assembly1.cif.gz_A | crystal structure of bacillus megaterium glucose dehydrogenase 4 in ligand-free form | 0.8984 | 3 | 229 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6ED38_49_231_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9069 | 3 | 167 | 3.40.50.720 |
| 2ztuB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9022 | 6 | 229 | 3.40.50.720 |
| af_P76633_10_261_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.901 | 2 | 229 | 3.40.50.720 |
| af_Q9URX0_1_248_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9003 | 3 | 229 | 3.40.50.720 |
| 4ni5A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8971 | 2 | 229 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258C4U9-F1-model_v4 | deleted | 0.9865 | 2 | 105 |
|
| AF-A0A3D0WLM4-F1-model_v4 | deleted | 0.9691 | 1 | 145 |
|
| AF-A0A7Y1T5F4-F1-model_v4 | deleted | 0.9668 | 1 | 234 |
|
| AF-A0A7Y1T5F4-F1-model_v4 | deleted | 0.9627 | 1 | 234 |
|
| AF-A0A2W4YCQ0-F1-model_v4 | deleted | 0.9509 | 1 | 234 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar