F470524

General Info

Members Datasets Scaffolds Average Seq Length
627 274 626 234

Family's Representative Sequence

Representative Sequence 3300001989|JGI24739J22299_10016731|JGI24739J22299_100167312
Length 277
Sequence MADKPGWRRCPVWLLHLIPDPAKNLNQAPTSEALPVADAPRNRNPMTNILLTGSSRGIGAAIAQVLSASDGIRLIGHGTASGIAADFADPAGPRQLWDKALAELGSIDVVINNAGVFEDNPIDLGDDDWVAGWERTMRINLTASAELCRFAVRHWQERQSGGRIVNVASRAAYRGDSPQHWHYAASKAGMVAMTKSIARGYAAQGILAFAVCPGFTMTGMAEEYLSSRGGDKLLADIPLGRVADPEEIANAVAYLATSAPPSMTGAVIDVNGASYVR

Samples

Sample ID Description Type Environment
1 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
87 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
95 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
176 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
177 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
178 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
179 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
180 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
181 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
182 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
195 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
201 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
202 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
203 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
204 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
205 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
206 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
207 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
208 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
209 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
210 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
211 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
212 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
213 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
214 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
215 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
216 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
221 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
222 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
223 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
226 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
227 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
228 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
229 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
230 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
250 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
251 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
252 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
253 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
258 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
265 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
266 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
267 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
268 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
269 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
270 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
271 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
272 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
273 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
274 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 0.96
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.9
Nodule 0
Rhizoplane 4.63
Rhizosphere 85.81
Stem 0
Stem Tuber 0
Unclassified 3.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1008888 3300001904 Bacteria 1666
2 JGI24741J21665_1007812 3300001915 Bacteria 2053
3 JGI24739J22299_10016731 3300001989 Bacteria 2651
4 JGI24739J22299_10030728 3300001989 Bacteria 1860
5 JGI24739J22299_10038800 3300001989 Bacteria 1599
6 JGI24737J22298_10000693 3300001990 Bacteria 11841
7 JGI24737J22298_10002430 3300001990 Bacteria 6640
8 JGI24737J22298_10006127 3300001990 Bacteria 4119
9 JGI25153J46596_10000034 3300003215 Bacteria 192215
10 rootL2_10103814 3300003322 Bacteria 2616
11 Ga0055525_1000118 3300003759 Bacteria 120652
12 Ga0055542_1000012 3300003762 Bacteria 391808
13 Ga0055529_1000004 3300003763 Bacteria 433331
14 Ga0055524_1000409 3300003775 Bacteria 36411
15 Ga0055528_1032533 3300003790 Bacteria 1328
16 Ga0055530_10000638 3300003791 Bacteria 30190
17 Ga0055531_10000640 3300003794 Bacteria 30187
18 Ga0055531_10035174 3300003794 Bacteria 1573
19 Ga0070658_10000754 3300005327 Bacteria 27776
20 Ga0070658_10010209 3300005327 Bacteria 7530
21 Ga0070658_10028140 3300005327 Bacteria 4511
22 Ga0070658_10036358 3300005327 Bacteria 3969
23 Ga0070658_10037099 3300005327 Bacteria 3927
24 Ga0070658_10067263 3300005327 Bacteria 2927
25 Ga0070658_10068348 3300005327 Bacteria 2904
26 Ga0070658_10090281 3300005327 Bacteria 2524
27 Ga0070658_10179251 3300005327 Bacteria 1782
28 Ga0070658_10529124 3300005327 Bacteria 1019
29 Ga0070676_10003403 3300005328 Bacteria 8279
30 Ga0070676_10028033 3300005328 Bacteria 3197
31 Ga0070670_100001616 3300005331 Bacteria 18214
32 Ga0070670_100160705 3300005331 Bacteria 1947
33 Ga0070670_100258809 3300005331 Bacteria 1517
34 Ga0070670_100439856 3300005331 Bacteria 1155
35 Ga0070670_100484795 3300005331 Bacteria 1098
36 Ga0070677_10146964 3300005333 Bacteria 1093
37 Ga0070666_10214656 3300005335 Bacteria 1356
38 Ga0070680_100009968 3300005336 Bacteria 7319
39 Ga0070680_100019844 3300005336 Bacteria 5329
40 Ga0068868_100093610 3300005338 Bacteria 2423
41 Ga0070660_100035536 3300005339 Bacteria 3772
42 Ga0070660_100042929 3300005339 Bacteria 3453
43 Ga0070660_100055731 3300005339 Bacteria 3056
44 Ga0070660_100066893 3300005339 Bacteria 2799
45 Ga0070660_100076595 3300005339 Bacteria 2620
46 Ga0070660_100187314 3300005339 Bacteria 1676
47 Ga0070660_100270638 3300005339 Bacteria 1388
48 Ga0070660_100568269 3300005339 Bacteria 947
49 Ga0070661_100024122 3300005344 Bacteria 4363
50 Ga0070661_100056748 3300005344 Bacteria 2869
51 Ga0070661_100128181 3300005344 Bacteria 1904
52 Ga0070661_100316753 3300005344 Bacteria 1217
53 Ga0070668_100004873 3300005347 Bacteria 9944
54 Ga0070668_100220882 3300005347 Bacteria 1563
55 Ga0070668_100463273 3300005347 Bacteria 1092
56 Ga0070669_100010130 3300005353 Bacteria 6704
57 Ga0070669_100154451 3300005353 Bacteria 1779
58 Ga0070671_100001670 3300005355 Bacteria 16795
59 Ga0070671_100002301 3300005355 Bacteria 14752
60 Ga0070671_100011559 3300005355 Bacteria 7101
61 Ga0070671_100017420 3300005355 Bacteria 5819
62 Ga0070671_100023096 3300005355 Bacteria 5084
63 Ga0070671_100042665 3300005355 Bacteria 3770
64 Ga0070671_100195462 3300005355 Bacteria 1715
65 Ga0070674_100020454 3300005356 Bacteria 4230
66 Ga0070674_100030096 3300005356 Bacteria 3584
67 Ga0070674_100091528 3300005356 Bacteria 2197
68 Ga0070673_100038330 3300005364 Bacteria 3659
69 Ga0070673_100066413 3300005364 Bacteria 2881
70 Ga0070673_100114615 3300005364 Bacteria 2240
71 Ga0070673_100176872 3300005364 Bacteria 1825
72 Ga0070659_100008434 3300005366 Bacteria 7528
73 Ga0070659_100019549 3300005366 Bacteria 5135
74 Ga0070659_100043977 3300005366 Bacteria 3495
75 Ga0070659_100075882 3300005366 Bacteria 2680
76 Ga0070667_100002998 3300005367 Bacteria 14505
77 Ga0070667_100038852 3300005367 Bacteria 3990
78 Ga0070667_100052267 3300005367 Bacteria 3447
79 Ga0070667_100052950 3300005367 Bacteria 3425
80 Ga0070714_100204247 3300005435 Bacteria 1809
81 Ga0070714_100293540 3300005435 Bacteria 1514
82 Ga0070663_100494519 3300005455 Bacteria 1015
83 Ga0070663_100765256 3300005455 Bacteria 826
84 Ga0070678_100001009 3300005456 Bacteria 14629
85 Ga0070678_100001266 3300005456 Bacteria 13416
86 Ga0070678_100022762 3300005456 Bacteria 4160
87 Ga0070678_100050397 3300005456 Bacteria 3011
88 Ga0070662_100006947 3300005457 Bacteria 7325
89 Ga0070662_100021124 3300005457 Bacteria 4442
90 Ga0070662_100126142 3300005457 Bacteria 1968
91 Ga0070662_100146151 3300005457 Bacteria 1837
92 Ga0070662_100254961 3300005457 Bacteria 1412
93 Ga0070681_10112452 3300005458 Bacteria 2663
94 Ga0070681_10436387 3300005458 Bacteria 1222
95 Ga0068867_100090577 3300005459 Bacteria 2320
96 Ga0068867_100098368 3300005459 Bacteria 2231
97 Ga0070706_100262434 3300005467 Bacteria 1612
98 Ga0070679_100319653 3300005530 Bacteria 1501
99 Ga0070684_100657695 3300005535 Bacteria 976
100 Ga0068853_100040493 3300005539 Bacteria 3975
101 Ga0068853_100048087 3300005539 Bacteria 3662
102 Ga0070672_100032060 3300005543 Bacteria 3963
103 Ga0070672_100324004 3300005543 Bacteria 1310
104 Ga0070672_100364319 3300005543 Bacteria 1234
105 Ga0070672_100443326 3300005543 Bacteria 1118
106 Ga0070695_100013031 3300005545 Bacteria 4994
107 Ga0070665_100000084 3300005548 Bacteria 180481
108 Ga0070704_100373167 3300005549 Bacteria 1210
109 Ga0068855_100211839 3300005563 Bacteria 2177
110 Ga0068855_100352940 3300005563 Bacteria 1620
111 Ga0068855_100590333 3300005563 Bacteria 1199
112 Ga0070664_100000675 3300005564 Bacteria 26078
113 Ga0070664_100042795 3300005564 Bacteria 3822
114 Ga0070664_100050108 3300005564 Bacteria 3533
115 Ga0070664_100137964 3300005564 Bacteria 2146
116 Ga0068857_100016405 3300005577 Bacteria 6491
117 Ga0068857_100085484 3300005577 Bacteria 2819
118 Ga0068854_100035398 3300005578 Bacteria 3494
119 Ga0068854_100053546 3300005578 Bacteria 2898
120 Ga0068854_100117337 3300005578 Bacteria 2015
121 Ga0068854_100126818 3300005578 Bacteria 1945
122 Ga0068854_100177711 3300005578 Bacteria 1661
123 Ga0068856_100103385 3300005614 Bacteria 2842
124 Ga0068856_100118569 3300005614 Bacteria 2647
125 Ga0068856_100894110 3300005614 Bacteria 907
126 Ga0068856_101211868 3300005614 Bacteria 771
127 Ga0068852_100008231 3300005616 Bacteria 7665
128 Ga0068852_100011477 3300005616 Bacteria 6671
129 Ga0068859_100003695 3300005617 Bacteria 15598
130 Ga0068859_100044184 3300005617 Bacteria 4477
131 Ga0068859_100258709 3300005617 Bacteria 1831
132 Ga0068864_100034399 3300005618 Bacteria 4310
133 Ga0068864_100074102 3300005618 Bacteria 2970
134 Ga0068863_100002582 3300005841 Bacteria 17960
135 Ga0068863_100059852 3300005841 Bacteria 3603
136 Ga0068858_100059188 3300005842 Bacteria 3541
137 Ga0068858_100078820 3300005842 Bacteria 3061
138 Ga0068858_100092411 3300005842 Bacteria 2816
139 Ga0068860_100006703 3300005843 Bacteria 11558
140 Ga0068860_100014445 3300005843 Bacteria 7735
141 Ga0068860_100086477 3300005843 Bacteria 2984
142 Ga0068862_100050427 3300005844 Bacteria 3557
143 Ga0068862_100132068 3300005844 Bacteria 2209
144 Ga0068862_100522627 3300005844 Bacteria 1129
145 Ga0081539_10197483 3300005985 Bacteria 932
146 Ga0097621_100027147 3300006237 Bacteria 4499
147 Ga0068871_100044832 3300006358 Bacteria 3558
148 Ga0068871_100210400 3300006358 Bacteria 1682
149 Ga0075429_100352699 3300006880 Bacteria 1288
150 Ga0068865_100207258 3300006881 Bacteria 1525
151 Ga0097620_100003694 3300006931 Bacteria 15598
152 Ga0097620_100044180 3300006931 Bacteria 4477
153 Ga0097620_100258706 3300006931 Bacteria 1831
154 Ga0105250_10007339 3300009092 Bacteria 4739
155 Ga0105240_10042240 3300009093 Bacteria 5811
156 Ga0105240_10472610 3300009093 Bacteria 1399
157 Ga0111539_10020298 3300009094 Bacteria 8185
158 Ga0105245_10101888 3300009098 Bacteria 2658
159 Ga0114129_10387600 3300009147 Bacteria 1844
160 Ga0114129_10440981 3300009147 Bacteria 1709
161 Ga0105243_10000483 3300009148 Bacteria 40744
162 Ga0105248_10000621 3300009177 Bacteria 40351
163 Ga0105248_10211631 3300009177 Bacteria 2184
164 Ga0105248_10956561 3300009177 Bacteria 967
165 Ga0105237_10282592 3300009545 Bacteria 1662
166 Ga0105237_10466594 3300009545 Bacteria 1269
167 Ga0105238_10014999 3300009551 Bacteria 7845
168 Ga0105249_10040895 3300009553 Bacteria 4212
169 Ga0105246_10310785 3300011119 Bacteria 1277
170 Ga0105246_10811393 3300011119 Bacteria 831
171 Ga0157373_10295535 3300013100 Bacteria 1149
172 Ga0157373_10354164 3300013100 Bacteria 1047
173 Ga0157373_10413159 3300013100 Bacteria 968
174 Ga0157371_10000197 3300013102 Bacteria 88423
175 Ga0157371_10216383 3300013102 Bacteria 1375
176 Ga0157371_10388944 3300013102 Bacteria 1019
177 Ga0157371_10432192 3300013102 Bacteria 966
178 Ga0157370_10024985 3300013104 Bacteria 5912
179 Ga0157370_10045418 3300013104 Bacteria 4215
180 Ga0157369_10002175 3300013105 Bacteria 23611
181 Ga0157369_10010869 3300013105 Bacteria 10370
182 Ga0157369_10064124 3300013105 Bacteria 3957
183 Ga0157369_10119551 3300013105 Bacteria 2796
184 Ga0157369_10630986 3300013105 Bacteria 1105
185 Ga0163162_10447777 3300013306 Bacteria 1423
186 Ga0163162_10497746 3300013306 Bacteria 1349
187 Ga0157372_10228222 3300013307 Bacteria 2158
188 Ga0157375_10052488 3300013308 Bacteria 4008
189 Ga0163163_10000282 3300014325 Bacteria 50623
190 Ga0163163_10202012 3300014325 Bacteria 2036
191 Ga0157379_10002202 3300014968 Bacteria 16219
192 Ga0157379_10024258 3300014968 Bacteria 5384
193 Ga0197907_10778048 3300020069 Bacteria 1234
194 Ga0206354_10185466 3300020081 Bacteria 1125
195 Ga0206354_10229693 3300020081 Bacteria 9840
196 Ga0206354_11061492 3300020081 Bacteria 2492
197 Ga0206353_11730299 3300020082 Bacteria 1455
198 Ga0206353_11805231 3300020082 Bacteria 7432
199 Ga0213873_10000017 3300021358 Bacteria 123962
200 Ga0213874_10088014 3300021377 Bacteria 1016
201 Ga0213876_10000071 3300021384 Bacteria 123962
202 Ga0213876_10004712 3300021384 Bacteria 7589
203 Ga0213875_10002567 3300021388 Bacteria 10819
204 Ga0209674_108297 3300025226 Bacteria 1241
205 Ga0209563_100070 3300025230 Bacteria 249779
206 Ga0207425_1013908 3300025245 Bacteria 1842
207 Ga0209148_1000008 3300025254 Bacteria 1504371
208 Ga0209233_1025638 3300025261 Bacteria 1455
209 Ga0209565_1000007 3300025263 Bacteria 784361
210 Ga0209455_1000002 3300025272 Bacteria 1505459
211 Ga0209673_1003346 3300025273 Bacteria 9581
212 Ga0209675_1005065 3300025291 Bacteria 5636
213 Ga0209758_1000007 3300025297 Bacteria 1270410
214 Ga0209758_1013158 3300025297 Bacteria 4544
215 Ga0209050_1000010 3300025298 Bacteria 980454
216 Ga0209050_1028318 3300025298 Bacteria 1821
217 Ga0209256_1000008 3300025299 Bacteria 975723
218 Ga0209257_1000027 3300025304 Bacteria 703541
219 Ga0209257_1000820 3300025304 Bacteria 45043
220 Ga0209257_1019962 3300025304 Bacteria 2498
221 Ga0207697_10140921 3300025315 Bacteria 1046
222 Ga0207656_10017502 3300025321 Bacteria 2809
223 Ga0207682_10062223 3300025893 Bacteria 1564
224 Ga0207682_10071084 3300025893 Bacteria 1475
225 Ga0207642_10156573 3300025899 Bacteria 1219
226 Ga0207688_10015571 3300025901 Bacteria 4123
227 Ga0207688_10134322 3300025901 Bacteria 1452
228 Ga0207680_10082463 3300025903 Bacteria 2024
229 Ga0207647_10008080 3300025904 Bacteria 7562
230 Ga0207647_10034298 3300025904 Bacteria 3241
231 Ga0207645_10012375 3300025907 Bacteria 5788
232 Ga0207645_10020296 3300025907 Bacteria 4351
233 Ga0207643_10208782 3300025908 Bacteria 1191
234 Ga0207643_10330978 3300025908 Bacteria 953
235 Ga0207705_10002878 3300025909 Bacteria 13168
236 Ga0207705_10006763 3300025909 Bacteria 8476
237 Ga0207705_10011161 3300025909 Bacteria 6513
238 Ga0207705_10079988 3300025909 Bacteria 2381
239 Ga0207705_10155627 3300025909 Bacteria 1715
240 Ga0207705_10267229 3300025909 Bacteria 1307
241 Ga0207705_10292442 3300025909 Bacteria 1248
242 Ga0207654_10000926 3300025911 Bacteria 16210
243 Ga0207707_10346080 3300025912 Bacteria 1281
244 Ga0207695_10014755 3300025913 Bacteria 9236
245 Ga0207695_10016672 3300025913 Bacteria 8585
246 Ga0207671_10051379 3300025914 Bacteria 3055
247 Ga0207660_10005359 3300025917 Bacteria 8328
248 Ga0207660_10341581 3300025917 Bacteria 1198
249 Ga0207657_10009851 3300025919 Bacteria 9569
250 Ga0207657_10082386 3300025919 Bacteria 2701
251 Ga0207657_10157896 3300025919 Bacteria 1843
252 Ga0207657_10288688 3300025919 Bacteria 1301
253 Ga0207649_10004939 3300025920 Bacteria 7211
254 Ga0207649_10014509 3300025920 Bacteria 4413
255 Ga0207649_10198862 3300025920 Bacteria 1414
256 Ga0207652_10222850 3300025921 Bacteria 1699
257 Ga0207694_10006461 3300025924 Bacteria 8931
258 Ga0207694_10036745 3300025924 Bacteria 3759
259 Ga0207650_10066669 3300025925 Bacteria 2700
260 Ga0207650_10345440 3300025925 Bacteria 1223
261 Ga0207650_10491014 3300025925 Bacteria 1025
262 Ga0207650_10497446 3300025925 Bacteria 1018
263 Ga0207664_10121453 3300025929 Bacteria 2187
264 Ga0207664_10259529 3300025929 Bacteria 1519
265 Ga0207644_10000090 3300025931 Bacteria 65122
266 Ga0207644_10004166 3300025931 Bacteria 9377
267 Ga0207644_10035622 3300025931 Bacteria 3488
268 Ga0207644_10481574 3300025931 Bacteria 1022
269 Ga0207690_10002426 3300025932 Bacteria 11279
270 Ga0207690_10017183 3300025932 Bacteria 4414
271 Ga0207690_10258945 3300025932 Bacteria 1347
272 Ga0207690_10339400 3300025932 Bacteria 1185
273 Ga0207706_10019644 3300025933 Bacteria 6078
274 Ga0207706_10033286 3300025933 Bacteria 4589
275 Ga0207706_10047381 3300025933 Bacteria 3803
276 Ga0207706_10051278 3300025933 Bacteria 3644
277 Ga0207706_10064965 3300025933 Bacteria 3213
278 Ga0207706_10389731 3300025933 Bacteria 1208
279 Ga0207709_10000005 3300025935 Bacteria 806813
280 Ga0207669_10000114 3300025937 Bacteria 40433
281 Ga0207669_10008496 3300025937 Bacteria 4824
282 Ga0207691_10122014 3300025940 Bacteria 2308
283 Ga0207691_10236307 3300025940 Bacteria 1581
284 Ga0207691_10311357 3300025940 Bacteria 1351
285 Ga0207711_10000440 3300025941 Bacteria 43290
286 Ga0207711_10004825 3300025941 Bacteria 11457
287 Ga0207711_10014217 3300025941 Bacteria 6610
288 Ga0207711_10188335 3300025941 Bacteria 1879
289 Ga0207689_10108220 3300025942 Bacteria 2284
290 Ga0207661_10049671 3300025944 Bacteria 3339
291 Ga0207679_10001267 3300025945 Bacteria 16008
292 Ga0207679_10019457 3300025945 Bacteria 4561
293 Ga0207667_10000001 3300025949 Bacteria 1178522
294 Ga0207667_10132048 3300025949 Bacteria 2572
295 Ga0207667_10135294 3300025949 Bacteria 2538
296 Ga0207667_10323464 3300025949 Bacteria 1575
297 Ga0207667_10365508 3300025949 Bacteria 1471
298 Ga0207651_10154552 3300025960 Bacteria 1790
299 Ga0207651_10364638 3300025960 Bacteria 1220
300 Ga0207651_10367197 3300025960 Bacteria 1216
301 Ga0207668_10000107 3300025972 Bacteria 59177
302 Ga0207668_10151800 3300025972 Bacteria 1794
303 Ga0207668_10166385 3300025972 Bacteria 1724
304 Ga0207640_10000856 3300025981 Bacteria 17266
305 Ga0207640_10040908 3300025981 Bacteria 2945
306 Ga0207640_10043861 3300025981 Bacteria 2861
307 Ga0207640_10729360 3300025981 Bacteria 852
308 Ga0207658_10001264 3300025986 Bacteria 19972
309 Ga0207658_10004102 3300025986 Bacteria 10162
310 Ga0207658_10048630 3300025986 Bacteria 3110
311 Ga0207658_10274505 3300025986 Bacteria 1442
312 Ga0207658_10577629 3300025986 Bacteria 1008
313 Ga0207677_10127003 3300026023 Bacteria 1929
314 Ga0207677_10925834 3300026023 Bacteria 787
315 Ga0207703_10017075 3300026035 Bacteria 5659
316 Ga0207703_10064504 3300026035 Bacteria 3007
317 Ga0207639_10006031 3300026041 Bacteria 8220
318 Ga0207639_10050361 3300026041 Bacteria 3163
319 Ga0207639_10078654 3300026041 Bacteria 2604
320 Ga0207639_10379347 3300026041 Bacteria 1269
321 Ga0207639_10743171 3300026041 Bacteria 912
322 Ga0207678_10007366 3300026067 Bacteria 9739
323 Ga0207678_10083869 3300026067 Bacteria 2726
324 Ga0207702_10013760 3300026078 Bacteria 6720
325 Ga0207702_10159952 3300026078 Bacteria 2056
326 Ga0207702_10186107 3300026078 Bacteria 1915
327 Ga0207702_10292509 3300026078 Bacteria 1543
328 Ga0207641_10000330 3300026088 Bacteria 58123
329 Ga0207641_10086217 3300026088 Bacteria 2737
330 Ga0207641_10167761 3300026088 Bacteria 2001
331 Ga0207648_10059162 3300026089 Bacteria 3342
332 Ga0207648_10091127 3300026089 Bacteria 2665
333 Ga0207648_10203753 3300026089 Bacteria 1755
334 Ga0207676_10001166 3300026095 Bacteria 19777
335 Ga0207676_10015903 3300026095 Bacteria 5442
336 Ga0207676_10019259 3300026095 Bacteria 4975
337 Ga0207676_10704599 3300026095 Bacteria 978
338 Ga0207674_10000583 3300026116 Bacteria 48003
339 Ga0207674_10034199 3300026116 Bacteria 5316
340 Ga0207674_10251162 3300026116 Bacteria 1716
341 Ga0207683_10001252 3300026121 Bacteria 23031
342 Ga0207683_10047465 3300026121 Bacteria 3761
343 Ga0207683_10138015 3300026121 Bacteria 2195
344 Ga0207683_10151840 3300026121 Bacteria 2090
345 Ga0207698_10001191 3300026142 Bacteria 15162
346 Ga0207698_10003162 3300026142 Bacteria 9874
347 Ga0207698_10016505 3300026142 Bacteria 4979
348 Ga0207698_10430731 3300026142 Bacteria 1268
349 Ga0207698_10451263 3300026142 Bacteria 1241
350 Ga0207698_10542344 3300026142 Bacteria 1139
351 Ga0268266_10000002 3300028379 Bacteria 3059047
352 Ga0268266_10006543 3300028379 Bacteria 10664
353 Ga0268266_10318620 3300028379 Bacteria 1455
354 Ga0268266_10768106 3300028379 Bacteria 930
355 Ga0268265_10010441 3300028380 Bacteria 6271
356 Ga0268265_10021504 3300028380 Bacteria 4521
357 Ga0268265_10270459 3300028380 Bacteria 1515
358 Ga0268264_10107785 3300028381 Bacteria 2434
359 Ga0268264_10332375 3300028381 Bacteria 1440
360 Ga0307517_10016777 3300028786 Bacteria 9598
361 Ga0307513_10022404 3300031456 Bacteria 7427
362 Ga0307408_100044723 3300031548 Bacteria 3157
363 Ga0307408_100658162 3300031548 Bacteria 937
364 Ga0307405_10085845 3300031731 Bacteria 2070
365 Ga0307413_10007419 3300031824 Bacteria 5093
366 Ga0307413_10038941 3300031824 Bacteria 2759
367 Ga0307413_10355759 3300031824 Bacteria 1132
368 Ga0307410_10012832 3300031852 Bacteria 4863
369 Ga0307410_10016345 3300031852 Bacteria 4424
370 Ga0307410_10017877 3300031852 Bacteria 4270
371 Ga0307410_10253470 3300031852 Bacteria 1369
372 Ga0307406_10088798 3300031901 Bacteria 2075
373 Ga0307406_10380550 3300031901 Bacteria 1113
374 Ga0307407_10004081 3300031903 Bacteria 6136
375 Ga0307407_10089451 3300031903 Bacteria 1883
376 Ga0307407_10221723 3300031903 Bacteria 1279
377 Ga0307412_10042047 3300031911 Bacteria 2966
378 Ga0307412_10042825 3300031911 Bacteria 2945
379 Ga0307412_10051773 3300031911 Bacteria 2715
380 Ga0307416_100001948 3300032002 Bacteria 11561
381 Ga0307416_100023625 3300032002 Bacteria 4466
382 Ga0307416_100090508 3300032002 Bacteria 2624
383 Ga0307416_100103747 3300032002 Bacteria 2484
384 Ga0307416_100679389 3300032002 Bacteria 1117
385 Ga0307416_100730115 3300032002 Bacteria 1082
386 Ga0307414_10012727 3300032004 Bacteria 4988
387 Ga0307414_10063034 3300032004 Bacteria 2633
388 Ga0307411_10135347 3300032005 Bacteria 1808
389 Ga0307411_10306153 3300032005 Bacteria 1277
390 Ga0307415_100116755 3300032126 Bacteria 1991
391 Ga0373925_0459704 3300037068 Bacteria 1043
392 Ga0395899_0000981 3300037312 Bacteria 26323
393 Ga0395899_0012115 3300037312 Bacteria 6603
394 Ga0395899_0056894 3300037312 Bacteria 2889
395 Ga0395899_0121269 3300037312 Bacteria 1873
396 Ga0395899_0126052 3300037312 Bacteria 1831
397 Ga0395899_0135213 3300037312 Bacteria 1757
398 Ga0395899_0141110 3300037312 Bacteria 1714
399 Ga0395899_0163975 3300037312 Bacteria 1568
400 Ga0395899_0297843 3300037312 Bacteria 1092
401 Ga0395899_0321283 3300037312 Bacteria 1042
402 Ga0395899_0330953 3300037312 Bacteria 1023
403 Ga0395900_0000912 3300037418 Bacteria 38872
404 Ga0395900_0020065 3300037418 Bacteria 6816
405 Ga0395900_0027048 3300037418 Bacteria 5872
406 Ga0395900_0032140 3300037418 Bacteria 5395
407 Ga0395900_0036348 3300037418 Bacteria 5077
408 Ga0395900_0047865 3300037418 Bacteria 4404
409 Ga0395900_0081258 3300037418 Bacteria 3329
410 Ga0395900_0107923 3300037418 Bacteria 2860
411 Ga0395900_0112561 3300037418 Bacteria 2794
412 Ga0395900_0164139 3300037418 Bacteria 2264
413 Ga0395900_0187970 3300037418 Bacteria 2096
414 Ga0395900_0416815 3300037418 Bacteria 1304
415 Ga0395900_0442655 3300037418 Bacteria 1257
416 Ga0395900_0537241 3300037418 Bacteria 1115
417 Ga0395900_0610467 3300037418 Bacteria 1030
418 Ga0395898_0013658 3300037466 Bacteria 8355
419 Ga0395898_0099509 3300037466 Bacteria 2792
420 Ga0395898_0141917 3300037466 Bacteria 2299
421 Ga0395898_0158387 3300037466 Bacteria 2165
422 Ga0395905_0002176 3300037471 Bacteria 22155
423 Ga0395905_0006103 3300037471 Bacteria 12175
424 Ga0395905_0007538 3300037471 Bacteria 10820
425 Ga0395905_0011267 3300037471 Bacteria 8646
426 Ga0395905_0014142 3300037471 Bacteria 7626
427 Ga0395905_0026223 3300037471 Bacteria 5495
428 Ga0395905_0026524 3300037471 Bacteria 5462
429 Ga0395905_0030086 3300037471 Bacteria 5117
430 Ga0395905_0051975 3300037471 Bacteria 3838
431 Ga0395905_0071421 3300037471 Bacteria 3254
432 Ga0395905_0158062 3300037471 Bacteria 2131
433 Ga0395905_0249480 3300037471 Bacteria 1658
434 Ga0395905_0313387 3300037471 Bacteria 1457
435 Ga0395905_0377802 3300037471 Bacteria 1310
436 Ga0395905_0440892 3300037471 Bacteria 1199
437 Ga0395905_0514530 3300037471 Bacteria 1097
438 Ga0395905_0743477 3300037471 Bacteria 883
439 Ga0436364_1537163 3300037853 Bacteria 27026
440 Ga0395901_0011647 3300038443 Bacteria 8907
441 Ga0395901_0018305 3300038443 Bacteria 7152
442 Ga0395901_0026298 3300038443 Bacteria 5976
443 Ga0395901_0028858 3300038443 Bacteria 5707
444 Ga0395901_0054703 3300038443 Bacteria 4149
445 Ga0395901_0096533 3300038443 Bacteria 3097
446 Ga0395901_0135974 3300038443 Bacteria 2583
447 Ga0395901_0148844 3300038443 Bacteria 2460
448 Ga0395901_0148942 3300038443 Bacteria 2459
449 Ga0395901_0169230 3300038443 Bacteria 2293
450 Ga0395901_0184511 3300038443 Bacteria 2188
451 Ga0395901_0202309 3300038443 Bacteria 2081
452 Ga0395901_0257400 3300038443 Bacteria 1817
453 Ga0395901_0341817 3300038443 Bacteria 1546
454 Ga0436365_0646826 3300039437 Bacteria 110896
455 Ga0436365_1094616 3300039437 Bacteria 7416
456 Ga0436363_0623342 3300039450 Bacteria 1526
457 Ga0436362_0285880 3300039453 Bacteria 61821
458 Ga0451793_1227036 3300041452 Bacteria 1246
459 Ga0451807_0286986 3300041486 Bacteria 955
460 Ga0439445_0004822 3300042004 Bacteria 3061
461 Ga0439432_021453 3300042006 Bacteria 2141
462 Ga0450917_001777 3300042120 Bacteria 1527
463 Ga0450905_006843 3300042142 Bacteria 1546
464 Ga0450889_000007 3300042144 Bacteria 18930
465 Ga0466969_0003940 3300044656 Bacteria 7884
466 Ga0466969_0010066 3300044656 Bacteria 5015
467 Ga0466969_0104173 3300044656 Bacteria 1333
468 Ga0466965_0166433 3300044683 Bacteria 1158
469 Ga0466966_0001131 3300044684 Bacteria 17137
470 Ga0466966_0022363 3300044684 Bacteria 4150
471 Ga0466966_0032948 3300044684 Bacteria 3354
472 Ga0466966_0062609 3300044684 Bacteria 2345
473 Ga0466966_0064417 3300044684 Bacteria 2307
474 Ga0466961_0009596 3300044693 Bacteria 6160
475 Ga0466961_0108161 3300044693 Bacteria 1750
476 Ga0466963_0002122 3300044694 Bacteria 10968
477 Ga0466971_0003496 3300044719 Bacteria 6710
478 Ga0466971_0008191 3300044719 Bacteria 4557
479 Ga0466970_0012351 3300044765 Bacteria 4365
480 Ga0466970_0025859 3300044765 Bacteria 3075
481 Ga0466970_0160804 3300044765 Bacteria 1242
482 Ga0466957_0001498 3300044842 Bacteria 12248
483 Ga0466957_0046226 3300044842 Bacteria 2642
484 Ga0466957_0047041 3300044842 Bacteria 2620
485 Ga0466957_0237211 3300044842 Bacteria 1209
486 Ga0466957_0592395 3300044842 Bacteria 776
487 Ga0466959_0001847 3300045049 Bacteria 13294
488 Ga0466959_0054064 3300045049 Bacteria 2934
489 Ga0466959_0413957 3300045049 Bacteria 915
490 Ga0466958_0133086 3300045836 Bacteria 1562
491 Ga0466958_0409094 3300045836 Bacteria 876
492 Ga0466967_0109225 3300045976 Bacteria 2539
493 Ga0466967_0144660 3300045976 Bacteria 2217
494 Ga0495617_088585 3300046452 Bacteria 1011
495 Ga0495627_016713 3300046453 Bacteria 2507
496 Ga0495638_0000548 3300046460 Bacteria 42967
497 Ga0495650_0004011 3300046471 Bacteria 10336
498 Ga0495584_0026211 3300046491 Bacteria 2953
499 Ga0495585_0002479 3300046492 Bacteria 13171
500 Ga0495585_0052876 3300046492 Bacteria 2248
501 Ga0495585_0176447 3300046492 Bacteria 1100
502 Ga0495596_0008712 3300046500 Bacteria 4494
503 Ga0495596_0125314 3300046500 Bacteria 997
504 Ga0495607_0062511 3300046501 Bacteria 2110
505 Ga0495583_0007235 3300046506 Bacteria 7027
506 Ga0495583_0008885 3300046506 Bacteria 6076
507 Ga0495583_0012795 3300046506 Bacteria 4724
508 Ga0495583_0027811 3300046506 Bacteria 2787
509 Ga0495583_0036310 3300046506 Bacteria 2346
510 Ga0495606_0002454 3300046507 Bacteria 21514
511 Ga0495606_0210645 3300046507 Bacteria 1101
512 Ga0495616_0067776 3300046513 Bacteria 1734
513 Ga0495631_0003600 3300046518 Bacteria 8452
514 Ga0495631_0231223 3300046518 Bacteria 789
515 Ga0495637_0053327 3300046520 Bacteria 1684
516 Ga0495643_0001592 3300046522 Bacteria 20138
517 Ga0495643_0013217 3300046522 Bacteria 4950
518 Ga0495643_0133447 3300046522 Bacteria 1244
519 Ga0495643_0175191 3300046522 Bacteria 1046
520 Ga0495648_0000123 3300046524 Bacteria 92159
521 Ga0495663_0001632 3300046525 Bacteria 7012
522 Ga0495663_0017669 3300046525 Bacteria 2026
523 Ga0495642_0060173 3300046528 Bacteria 1575
524 Ga0495642_0067631 3300046528 Bacteria 1490
525 Ga0495598_0017390 3300046537 Bacteria 1852
526 Ga0495609_0108701 3300046538 Bacteria 1198
527 Ga0495621_0016869 3300046539 Bacteria 2351
528 Ga0495597_0023110 3300046542 Bacteria 2878
529 Ga0495622_0032968 3300046557 Bacteria 2418
530 Ga0495633_0001543 3300046558 Bacteria 17680
531 Ga0495633_0023118 3300046558 Bacteria 3081
532 Ga0495633_0035831 3300046558 Bacteria 2381
533 Ga0495668_0000149 3300046616 Bacteria 105826
534 Ga0495668_0124387 3300046616 Bacteria 1411
535 Ga0495668_0135690 3300046616 Bacteria 1347
536 Ga0495668_0165207 3300046616 Bacteria 1212
537 Ga0495611_0023834 3300046648 Bacteria 2659
538 Ga0495611_0053851 3300046648 Bacteria 1817
539 Ga0495625_0000287 3300046660 Bacteria 78023
540 Ga0495625_0000866 3300046660 Bacteria 41162
541 Ga0495625_0030662 3300046660 Bacteria 4009
542 Ga0495625_0083735 3300046660 Bacteria 2216
543 Ga0495625_0166555 3300046660 Bacteria 1473
544 Ga0495625_0343994 3300046660 Bacteria 944
545 Ga0495661_0080684 3300046665 Bacteria 1877
546 Ga0495669_0000043 3300046684 Bacteria 86386
547 Ga0495669_0023548 3300046684 Bacteria 2681
548 Ga0495669_0068870 3300046684 Bacteria 1610
549 Ga0495669_0074696 3300046684 Bacteria 1550
550 Ga0495669_0077457 3300046684 Bacteria 1522
551 Ga0495669_0155189 3300046684 Bacteria 1085
552 Ga0495669_0200976 3300046684 Bacteria 952
553 Ga0495670_0006982 3300046691 Bacteria 5564
554 Ga0495670_0013710 3300046691 Bacteria 3985
555 Ga0495649_0023596 3300046694 Bacteria 3436
556 Ga0495600_0082007 3300046809 Bacteria 2104
557 Ga0495660_0030707 3300046810 Bacteria 3026
558 Ga0495636_0168785 3300047318 Bacteria 989
559 Ga0495683_0008149 3300047323 Bacteria 5622
560 Ga0495683_0102700 3300047323 Bacteria 1373
561 Ga0495687_000597 3300047443 Bacteria 42130
562 Ga0495687_000662 3300047443 Bacteria 39551
563 Ga0495677_0007513 3300047445 Bacteria 4070
564 Ga0495677_0011550 3300047445 Bacteria 3229
565 Ga0495677_0135386 3300047445 Bacteria 944
566 Ga0495681_0005807 3300047470 Bacteria 8200
567 Ga0495686_0025393 3300047472 Bacteria 3884
568 Ga0496101_0234871 3300048904 Bacteria 1426
569 Ga0496101_0638471 3300048904 Bacteria 841
570 Ga0496102_0000671 3300048905 Bacteria 34255
571 Ga0496102_0011386 3300048905 Bacteria 7664
572 Ga0496103_0001496 3300048906 Bacteria 15636
573 Ga0496103_0155002 3300048906 Bacteria 1468
574 Ga0496104_0008531 3300048907 Bacteria 9109
575 Ga0496104_0075755 3300048907 Bacteria 3204
576 Ga0496105_0001988 3300048908 Bacteria 14734
577 Ga0496106_0036147 3300048909 Bacteria 3695
578 Ga0496106_0067486 3300048909 Bacteria 2727
579 Ga0496107_0011979 3300048910 Bacteria 6051
580 Ga0496107_0042833 3300048910 Bacteria 3252
581 Ga0496107_0516548 3300048910 Bacteria 886
582 Ga0496108_0009406 3300048911 Bacteria 7914
583 Ga0496109_0010251 3300048912 Bacteria 8002
584 Ga0496109_0016692 3300048912 Bacteria 6423
585 Ga0496110_0009283 3300048913 Bacteria 7955
586 Ga0496110_0018126 3300048913 Bacteria 5897
587 Ga0496110_0387147 3300048913 Bacteria 1274
588 Ga0496111_0002535 3300048914 Bacteria 11025
589 Ga0496111_0004353 3300048914 Bacteria 8935
590 Ga0496112_0115595 3300048915 Bacteria 2653
591 Ga0496113_0097723 3300048916 Bacteria 2272
592 Ga0496113_0149219 3300048916 Bacteria 1843
593 Ga0496114_0006150 3300048917 Bacteria 9448
594 Ga0496115_0002116 3300048918 Bacteria 14197
595 Ga0496116_0004138 3300048919 Bacteria 13977
596 Ga0496117_0001647 3300048920 Bacteria 31391
597 Ga0496118_0000039 3300048921 Bacteria 305458
598 Ga0496119_0044262 3300048922 Bacteria 2805
599 Ga0496121_0006371 3300048924 Bacteria 14695
600 Ga0496121_0006793 3300048924 Bacteria 14018
601 Ga0496122_0018532 3300048925 Bacteria 6423
602 Ga0496123_0012968 3300048926 Bacteria 7043
603 Ga0496124_0000232 3300048927 Bacteria 108986
604 Ga0496125_0005898 3300048928 Bacteria 13428
605 Ga0496126_0001592 3300048929 Bacteria 34561
606 Ga0501242_007975 3300049674 Bacteria 1231
607 Ga0501263_004726 3300049760 Bacteria 1514
608 Ga0501035_0044606 3300049822 Bacteria 3992
609 Ga0501044_0099738 3300049823 Bacteria 2922
610 nmdc:mga05p37_321727_c1 3300050507 Bacteria 1830
611 nmdc:mga05p37_658265_c1 3300050507 Bacteria 1171
612 nmdc:mga08y16_97889_c1 3300050511 Bacteria 3055
613 nmdc:mga0rr50_460663_c1 3300050513 Bacteria 1078
614 Ga0500610_0000270 3300053079 Bacteria 15792
615 Ga0500643_016290 3300053087 Bacteria 2521
616 Ga0500566_0014559 3300053094 Bacteria 4622
617 Ga0500595_004552 3300053119 Bacteria 6193
618 Ga0500642_0000853 3300053130 Bacteria 8884
619 Ga0500658_0000497 3300053134 Bacteria 16778
620 Ga0500658_0030705 3300053134 Bacteria 2097
621 Ga0500568_0007329 3300053139 Bacteria 5423
622 Ga0500636_0001359 3300053177 Bacteria 13286
623 Ga0500645_000267 3300053730 Bacteria 37622
624 Ga0500596_000275 3300053735 Bacteria 9135
625 Ga0466962_0024055 3300061719 Bacteria 2926
626 Ga0466962_0268173 3300061719 Bacteria 841

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025925 Ga0207650_10491014 Ga0207650_104910142 212
2 3300046684 Ga0495669_0200976 Ga0495669_0200976_289_939 216
3 3300005327 Ga0070658_10037099 Ga0070658_100370995 219
4 3300005539 Ga0068853_100040493 Ga0068853_1000404933 219
5 3300005578 Ga0068854_100177711 Ga0068854_1001777112 219
6 3300005614 Ga0068856_101211868 Ga0068856_1012118681 219
7 3300005616 Ga0068852_100011477 Ga0068852_1000114772 219
8 3300009551 Ga0105238_10014999 Ga0105238_100149995 219
9 3300013104 Ga0157370_10045418 Ga0157370_100454181 219
10 3300013105 Ga0157369_10002175 Ga0157369_1000217518 219
11 3300025909 Ga0207705_10079988 Ga0207705_100799882 219
12 3300025924 Ga0207694_10006461 Ga0207694_100064615 219
13 3300025949 Ga0207667_10135294 Ga0207667_101352942 219
14 3300026041 Ga0207639_10078654 Ga0207639_100786542 219
15 3300026142 Ga0207698_10003162 Ga0207698_100031627 219
16 3300025909 Ga0207705_10267229 Ga0207705_102672292 224
17 3300026041 Ga0207639_10743171 Ga0207639_107431711 224
18 3300044842 Ga0466957_0592395 Ga0466957_0592395_61_765 224
19 3300046660 Ga0495625_0343994 Ga0495625_0343994_176_880 224
20 3300046684 Ga0495669_0068870 Ga0495669_0068870_140_844 224
21 3300005367 Ga0070667_100052267 Ga0070667_1000522674 225
22 3300005844 Ga0068862_100132068 Ga0068862_1001320683 225
23 3300025986 Ga0207658_10004102 Ga0207658_100041029 225
24 3300028380 Ga0268265_10270459 Ga0268265_102704592 225
25 3300046506 Ga0495583_0036310 Ga0495583_0036310_39_758 225
26 3300041452 Ga0451793_1227036 Ga0451793_1227036_376_1185 226
27 3300005327 Ga0070658_10067263 Ga0070658_100672632 227
28 3300005338 Ga0068868_100093610 Ga0068868_1000936103 227
29 3300005347 Ga0070668_100463273 Ga0070668_1004632731 227
30 3300005353 Ga0070669_100154451 Ga0070669_1001544512 227
31 3300005364 Ga0070673_100114615 Ga0070673_1001146152 227
32 3300005367 Ga0070667_100002998 Ga0070667_1000029982 227
33 3300005455 Ga0070663_100765256 Ga0070663_1007652561 227
34 3300005543 Ga0070672_100324004 Ga0070672_1003240042 227
35 3300005617 Ga0068859_100003695 Ga0068859_10000369516 227
36 3300005841 Ga0068863_100002582 Ga0068863_10000258219 227
37 3300005842 Ga0068858_100059188 Ga0068858_1000591882 227
38 3300005843 Ga0068860_100006703 Ga0068860_10000670312 227
39 3300006931 Ga0097620_100003694 Ga0097620_10000369416 227
40 3300009092 Ga0105250_10007339 Ga0105250_100073393 227
41 3300009177 Ga0105248_10000621 Ga0105248_1000062114 227
42 3300009553 Ga0105249_10040895 Ga0105249_100408954 227
43 3300013306 Ga0163162_10497746 Ga0163162_104977462 227
44 3300014325 Ga0163163_10000282 Ga0163163_1000028246 227
45 3300014968 Ga0157379_10002202 Ga0157379_1000220215 227
46 3300025909 Ga0207705_10292442 Ga0207705_102924421 227
47 3300025940 Ga0207691_10236307 Ga0207691_102363072 227
48 3300025941 Ga0207711_10000440 Ga0207711_100004404 227
49 3300025960 Ga0207651_10154552 Ga0207651_101545522 227
50 3300025972 Ga0207668_10166385 Ga0207668_101663852 227
51 3300025986 Ga0207658_10001264 Ga0207658_1000126417 227
52 3300026035 Ga0207703_10017075 Ga0207703_100170752 227
53 3300026088 Ga0207641_10000330 Ga0207641_1000033050 227
54 3300026095 Ga0207676_10001166 Ga0207676_1000116615 227
55 3300028380 Ga0268265_10021504 Ga0268265_100215042 227
56 3300048924 Ga0496121_0006371 Ga0496121_0006371_9966_10667 227
57 3300046684 Ga0495669_0077457 Ga0495669_0077457_261_965 228
58 3300049822 Ga0501035_0044606 Ga0501035_0044606_2720_3412 228
59 3300049823 Ga0501044_0099738 Ga0501044_0099738_1401_2093 228
60 iso_pu_bacteria 2643221622 2644125518 228
61 3300046522 Ga0495643_0175191 Ga0495643_0175191_101_808 229
62 3300001915 JGI24741J21665_1007812 JGI24741J21665_10078122 230
63 3300001989 JGI24739J22299_10016731 JGI24739J22299_100167312 230
64 3300001990 JGI24737J22298_10000693 JGI24737J22298_100006935 230
65 3300003215 JGI25153J46596_10000034 JGI25153J46596_10000034105 230
66 3300003322 rootL2_10103814 rootL2_101038142 230
67 3300003759 Ga0055525_1000118 Ga0055525_10001182 230
68 3300003762 Ga0055542_1000012 Ga0055542_100001232 230
69 3300003763 Ga0055529_1000004 Ga0055529_1000004175 230
70 3300005327 Ga0070658_10000754 Ga0070658_1000075414 230
71 3300005328 Ga0070676_10028033 Ga0070676_100280332 230
72 3300005331 Ga0070670_100160705 Ga0070670_1001607053 230
73 3300005339 Ga0070660_100035536 Ga0070660_1000355364 230
74 3300005355 Ga0070671_100195462 Ga0070671_1001954621 230
75 3300005356 Ga0070674_100020454 Ga0070674_1000204545 230
76 3300005356 Ga0070674_100030096 Ga0070674_1000300964 230
77 3300005366 Ga0070659_100008434 Ga0070659_1000084348 230
78 3300005456 Ga0070678_100001266 Ga0070678_1000012662 230
79 3300005457 Ga0070662_100126142 Ga0070662_1001261422 230
80 3300005548 Ga0070665_100000084 Ga0070665_100000084158 230
81 3300005564 Ga0070664_100137964 Ga0070664_1001379642 230
82 3300005577 Ga0068857_100085484 Ga0068857_1000854844 230
83 3300005578 Ga0068854_100035398 Ga0068854_1000353982 230
84 3300009148 Ga0105243_10000483 Ga0105243_100004832 230
85 3300009545 Ga0105237_10466594 Ga0105237_104665942 230
86 3300013100 Ga0157373_10295535 Ga0157373_102955351 230
87 3300013102 Ga0157371_10000197 Ga0157371_100001977 230
88 3300025226 Ga0209674_108297 Ga0209674_1082972 230
89 3300025230 Ga0209563_100070 Ga0209563_100070121 230
90 3300025254 Ga0209148_1000008 Ga0209148_1000008665 230
91 3300025261 Ga0209233_1025638 Ga0209233_10256381 230
92 3300025272 Ga0209455_1000002 Ga0209455_1000002759 230
93 3300025297 Ga0209758_1000007 Ga0209758_1000007576 230
94 3300025321 Ga0207656_10017502 Ga0207656_100175022 230
95 3300025901 Ga0207688_10015571 Ga0207688_100155712 230
96 3300025904 Ga0207647_10034298 Ga0207647_100342981 230
97 3300025907 Ga0207645_10020296 Ga0207645_100202964 230
98 3300025908 Ga0207643_10330978 Ga0207643_103309782 230
99 3300025909 Ga0207705_10002878 Ga0207705_1000287814 230
100 3300025911 Ga0207654_10000926 Ga0207654_100009265 230
101 3300025913 Ga0207695_10014755 Ga0207695_100147556 230
102 3300025914 Ga0207671_10051379 Ga0207671_100513794 230
103 3300025919 Ga0207657_10009851 Ga0207657_100098514 230
104 3300025920 Ga0207649_10004939 Ga0207649_100049392 230
105 3300025924 Ga0207694_10036745 Ga0207694_100367454 230
106 3300025932 Ga0207690_10002426 Ga0207690_100024269 230
107 3300025933 Ga0207706_10051278 Ga0207706_100512785 230
108 3300025935 Ga0207709_10000005 Ga0207709_10000005432 230
109 3300025937 Ga0207669_10000114 Ga0207669_1000011419 230
110 3300025937 Ga0207669_10008496 Ga0207669_100084965 230
111 3300025949 Ga0207667_10000001 Ga0207667_10000001877 230
112 3300025981 Ga0207640_10000856 Ga0207640_100008568 230
113 3300026041 Ga0207639_10006031 Ga0207639_1000603110 230
114 3300026078 Ga0207702_10186107 Ga0207702_101861072 230
115 3300026121 Ga0207683_10138015 Ga0207683_101380152 230
116 3300026142 Ga0207698_10430731 Ga0207698_104307312 230
117 3300028379 Ga0268266_10000002 Ga0268266_10000002884 230
118 3300028786 Ga0307517_10016777 Ga0307517_100167776 230
119 3300031456 Ga0307513_10022404 Ga0307513_100224042 230
120 3300037312 Ga0395899_0121269 Ga0395899_0121269_512_1210 230
121 3300046452 Ga0495617_088585 Ga0495617_088585_209_907 230
122 3300046460 Ga0495638_0000548 Ga0495638_0000548_32668_33378 230
123 3300046471 Ga0495650_0004011 Ga0495650_0004011_5997_6695 230
124 3300046491 Ga0495584_0026211 Ga0495584_0026211_1048_1746 230
125 3300046492 Ga0495585_0002479 Ga0495585_0002479_7312_8010 230
126 3300046492 Ga0495585_0052876 Ga0495585_0052876_1084_1782 230
127 3300046492 Ga0495585_0176447 Ga0495585_0176447_147_845 230
128 3300046500 Ga0495596_0008712 Ga0495596_0008712_3016_3714 230
129 3300046500 Ga0495596_0125314 Ga0495596_0125314_21_719 230
130 3300046501 Ga0495607_0062511 Ga0495607_0062511_592_1290 230
131 3300046506 Ga0495583_0007235 Ga0495583_0007235_352_1050 230
132 3300046506 Ga0495583_0008885 Ga0495583_0008885_1990_2688 230
133 3300046506 Ga0495583_0012795 Ga0495583_0012795_3827_4525 230
134 3300046506 Ga0495583_0027811 Ga0495583_0027811_275_973 230
135 3300046507 Ga0495606_0002454 Ga0495606_0002454_1011_1709 230
136 3300046507 Ga0495606_0210645 Ga0495606_0210645_379_1077 230
137 3300046513 Ga0495616_0067776 Ga0495616_0067776_940_1638 230
138 3300046518 Ga0495631_0003600 Ga0495631_0003600_7667_8365 230
139 3300046518 Ga0495631_0231223 Ga0495631_0231223_37_735 230
140 3300046520 Ga0495637_0053327 Ga0495637_0053327_43_741 230
141 3300046522 Ga0495643_0001592 Ga0495643_0001592_9272_9970 230
142 3300046522 Ga0495643_0013217 Ga0495643_0013217_114_812 230
143 3300046522 Ga0495643_0133447 Ga0495643_0133447_511_1209 230
144 3300046524 Ga0495648_0000123 Ga0495648_0000123_8428_9126 230
145 3300046525 Ga0495663_0001632 Ga0495663_0001632_3753_4451 230
146 3300046525 Ga0495663_0017669 Ga0495663_0017669_1279_1989 230
147 3300046528 Ga0495642_0067631 Ga0495642_0067631_326_1024 230
148 3300046538 Ga0495609_0108701 Ga0495609_0108701_406_1104 230
149 3300046542 Ga0495597_0023110 Ga0495597_0023110_2110_2808 230
150 3300046557 Ga0495622_0032968 Ga0495622_0032968_1229_1927 230
151 3300046558 Ga0495633_0001543 Ga0495633_0001543_2953_3651 230
152 3300046558 Ga0495633_0023118 Ga0495633_0023118_2063_2761 230
153 3300046616 Ga0495668_0000149 Ga0495668_0000149_79318_80016 230
154 3300046616 Ga0495668_0165207 Ga0495668_0165207_431_1129 230
155 3300046648 Ga0495611_0023834 Ga0495611_0023834_1069_1767 230
156 3300046648 Ga0495611_0053851 Ga0495611_0053851_617_1315 230
157 3300046660 Ga0495625_0000287 Ga0495625_0000287_43502_44212 230
158 3300046660 Ga0495625_0000866 Ga0495625_0000866_19356_20054 230
159 3300046660 Ga0495625_0030662 Ga0495625_0030662_2966_3664 230
160 3300046660 Ga0495625_0083735 Ga0495625_0083735_1118_1816 230
161 3300046660 Ga0495625_0166555 Ga0495625_0166555_527_1225 230
162 3300046665 Ga0495661_0080684 Ga0495661_0080684_683_1381 230
163 3300046684 Ga0495669_0000043 Ga0495669_0000043_59635_60333 230
164 3300046691 Ga0495670_0013710 Ga0495670_0013710_386_1084 230
165 3300046694 Ga0495649_0023596 Ga0495649_0023596_2648_3346 230
166 3300046809 Ga0495600_0082007 Ga0495600_0082007_1309_2007 230
167 3300046810 Ga0495660_0030707 Ga0495660_0030707_1448_2146 230
168 3300047318 Ga0495636_0168785 Ga0495636_0168785_28_726 230
169 3300047323 Ga0495683_0008149 Ga0495683_0008149_1127_1825 230
170 3300047443 Ga0495687_000597 Ga0495687_000597_26038_26736 230
171 3300047443 Ga0495687_000662 Ga0495687_000662_12922_13620 230
172 3300047445 Ga0495677_0007513 Ga0495677_0007513_3073_3771 230
173 3300047470 Ga0495681_0005807 Ga0495681_0005807_552_1250 230
174 3300048904 Ga0496101_0638471 Ga0496101_0638471_57_755 230
175 3300048905 Ga0496102_0000671 Ga0496102_0000671_25733_26431 230
176 3300048906 Ga0496103_0001496 Ga0496103_0001496_7060_7758 230
177 3300048907 Ga0496104_0008531 Ga0496104_0008531_5500_6198 230
178 3300048908 Ga0496105_0001988 Ga0496105_0001988_10942_11640 230
179 3300048913 Ga0496110_0009283 Ga0496110_0009283_1828_2526 230
180 3300048914 Ga0496111_0002535 Ga0496111_0002535_4748_5446 230
181 3300048916 Ga0496113_0097723 Ga0496113_0097723_365_1063 230
182 3300048917 Ga0496114_0006150 Ga0496114_0006150_7082_7780 230
183 3300048918 Ga0496115_0002116 Ga0496115_0002116_5571_6269 230
184 3300048919 Ga0496116_0004138 Ga0496116_0004138_5434_6132 230
185 3300048920 Ga0496117_0001647 Ga0496117_0001647_7124_7822 230
186 3300048921 Ga0496118_0000039 Ga0496118_0000039_63663_64361 230
187 3300048922 Ga0496119_0044262 Ga0496119_0044262_1959_2657 230
188 3300048924 Ga0496121_0006793 Ga0496121_0006793_5456_6154 230
189 3300048925 Ga0496122_0018532 Ga0496122_0018532_3899_4597 230
190 3300048926 Ga0496123_0012968 Ga0496123_0012968_2860_3558 230
191 3300048927 Ga0496124_0000232 Ga0496124_0000232_82464_83162 230
192 3300048928 Ga0496125_0005898 Ga0496125_0005898_7476_8174 230
193 3300048929 Ga0496126_0001592 Ga0496126_0001592_7893_8591 230
194 3300049674 Ga0501242_007975 Ga0501242_007975_496_1188 230
195 3300053079 Ga0500610_0000270 Ga0500610_0000270_12226_12924 230
196 3300053119 Ga0500595_004552 Ga0500595_004552_5383_6081 230
197 3300053130 Ga0500642_0000853 Ga0500642_0000853_327_1025 230
198 3300053134 Ga0500658_0000497 Ga0500658_0000497_4625_5335 230
199 3300053177 Ga0500636_0001359 Ga0500636_0001359_10667_11365 230
200 3300053730 Ga0500645_000267 Ga0500645_000267_10823_11521 230
201 3300053735 Ga0500596_000275 Ga0500596_000275_80_778 230
202 3300003775 Ga0055524_1000409 Ga0055524_100040929 231
203 3300003790 Ga0055528_1032533 Ga0055528_10325332 231
204 3300003791 Ga0055530_10000638 Ga0055530_1000063827 231
205 3300003794 Ga0055531_10000640 Ga0055531_100006406 231
206 3300003794 Ga0055531_10035174 Ga0055531_100351742 231
207 3300013100 Ga0157373_10413159 Ga0157373_104131591 231
208 3300020081 Ga0206354_10229693 Ga0206354_1022969310 231
209 3300020082 Ga0206353_11805231 Ga0206353_118052315 231
210 3300025245 Ga0207425_1013908 Ga0207425_10139082 231
211 3300025263 Ga0209565_1000007 Ga0209565_1000007377 231
212 3300025273 Ga0209673_1003346 Ga0209673_10033464 231
213 3300025291 Ga0209675_1005065 Ga0209675_10050653 231
214 3300025297 Ga0209758_1013158 Ga0209758_10131584 231
215 3300025298 Ga0209050_1000010 Ga0209050_1000010795 231
216 3300025298 Ga0209050_1028318 Ga0209050_10283182 231
217 3300025299 Ga0209256_1000008 Ga0209256_1000008219 231
218 3300025304 Ga0209257_1000027 Ga0209257_1000027437 231
219 3300025304 Ga0209257_1000820 Ga0209257_100082039 231
220 3300025304 Ga0209257_1019962 Ga0209257_10199622 231
221 3300026142 Ga0207698_10542344 Ga0207698_105423442 231
222 3300046453 Ga0495627_016713 Ga0495627_016713_937_1635 231
223 3300047472 Ga0495686_0025393 Ga0495686_0025393_50_754 231
224 3300053087 Ga0500643_016290 Ga0500643_016290_822_1520 231
225 3300053094 Ga0500566_0014559 Ga0500566_0014559_3615_4313 231
226 3300053134 Ga0500658_0030705 Ga0500658_0030705_1048_1746 231
227 3300053139 Ga0500568_0007329 Ga0500568_0007329_659_1357 231
228 3300005331 Ga0070670_100439856 Ga0070670_1004398562 232
229 3300005543 Ga0070672_100364319 Ga0070672_1003643191 232
230 3300021358 Ga0213873_10000017 Ga0213873_1000001755 232
231 3300021384 Ga0213876_10000071 Ga0213876_1000007182 232
232 3300021388 Ga0213875_10002567 Ga0213875_100025678 232
233 3300025925 Ga0207650_10345440 Ga0207650_103454402 232
234 3300031548 Ga0307408_100044723 Ga0307408_1000447232 232
235 3300031903 Ga0307407_10089451 Ga0307407_100894511 232
236 3300031911 Ga0307412_10051773 Ga0307412_100517733 232
237 3300032004 Ga0307414_10012727 Ga0307414_100127274 232
238 3300032005 Ga0307411_10135347 Ga0307411_101353473 232
239 3300037471 Ga0395905_0743477 Ga0395905_0743477_161_862 232
240 3300037853 Ga0436364_1537163 Ga0436364_1537163_19382_20083 232
241 3300039437 Ga0436365_0646826 Ga0436365_0646826_79240_79956 232
242 3300039453 Ga0436362_0285880 Ga0436362_0285880_18745_19461 232
243 3300044842 Ga0466957_0046226 Ga0466957_0046226_1628_2329 232
244 3300046616 Ga0495668_0124387 Ga0495668_0124387_169_873 232
245 3300061719 Ga0466962_0268173 Ga0466962_0268173_32_733 232
246 3300005327 Ga0070658_10529124 Ga0070658_105291242 233
247 3300005331 Ga0070670_100484795 Ga0070670_1004847951 233
248 3300005355 Ga0070671_100017420 Ga0070671_1000174205 233
249 3300005355 Ga0070671_100042665 Ga0070671_1000426653 233
250 3300005364 Ga0070673_100176872 Ga0070673_1001768721 233
251 3300005367 Ga0070667_100038852 Ga0070667_1000388523 233
252 3300005539 Ga0068853_100048087 Ga0068853_1000480872 233
253 3300005563 Ga0068855_100352940 Ga0068855_1003529402 233
254 3300005564 Ga0070664_100050108 Ga0070664_1000501082 233
255 3300005577 Ga0068857_100016405 Ga0068857_1000164052 233
256 3300005614 Ga0068856_100103385 Ga0068856_1001033852 233
257 3300005617 Ga0068859_100044184 Ga0068859_1000441844 233
258 3300005618 Ga0068864_100074102 Ga0068864_1000741022 233
259 3300005841 Ga0068863_100059852 Ga0068863_1000598522 233
260 3300005842 Ga0068858_100092411 Ga0068858_1000924113 233
261 3300005843 Ga0068860_100086477 Ga0068860_1000864772 233
262 3300005985 Ga0081539_10197483 Ga0081539_101974831 233
263 3300006358 Ga0068871_100044832 Ga0068871_1000448324 233
264 3300006931 Ga0097620_100044180 Ga0097620_1000441803 233
265 3300009545 Ga0105237_10282592 Ga0105237_102825922 233
266 3300011119 Ga0105246_10310785 Ga0105246_103107852 233
267 3300013102 Ga0157371_10216383 Ga0157371_102163832 233
268 3300014325 Ga0163163_10202012 Ga0163163_102020122 233
269 3300014968 Ga0157379_10024258 Ga0157379_100242585 233
270 3300025925 Ga0207650_10497446 Ga0207650_104974461 233
271 3300025931 Ga0207644_10035622 Ga0207644_100356223 233
272 3300025931 Ga0207644_10481574 Ga0207644_104815742 233
273 3300025932 Ga0207690_10339400 Ga0207690_103394002 233
274 3300025933 Ga0207706_10019644 Ga0207706_100196444 233
275 3300025945 Ga0207679_10019457 Ga0207679_100194574 233
276 3300025972 Ga0207668_10151800 Ga0207668_101518002 233
277 3300026041 Ga0207639_10050361 Ga0207639_100503611 233
278 3300026078 Ga0207702_10013760 Ga0207702_100137604 233
279 3300026088 Ga0207641_10086217 Ga0207641_100862174 233
280 3300026095 Ga0207676_10019259 Ga0207676_100192592 233
281 3300026095 Ga0207676_10704599 Ga0207676_107045992 233
282 3300026116 Ga0207674_10000583 Ga0207674_1000058318 233
283 3300028379 Ga0268266_10318620 Ga0268266_103186202 233
284 3300028381 Ga0268264_10332375 Ga0268264_103323752 233
285 3300031731 Ga0307405_10085845 Ga0307405_100858452 233
286 3300031824 Ga0307413_10007419 Ga0307413_100074194 233
287 3300031824 Ga0307413_10038941 Ga0307413_100389413 233
288 3300031852 Ga0307410_10012832 Ga0307410_100128323 233
289 3300031852 Ga0307410_10016345 Ga0307410_100163455 233
290 3300031852 Ga0307410_10253470 Ga0307410_102534702 233
291 3300031901 Ga0307406_10088798 Ga0307406_100887982 233
292 3300031901 Ga0307406_10380550 Ga0307406_103805502 233
293 3300031903 Ga0307407_10004081 Ga0307407_100040814 233
294 3300031911 Ga0307412_10042047 Ga0307412_100420472 233
295 3300032002 Ga0307416_100023625 Ga0307416_1000236252 233
296 3300032002 Ga0307416_100090508 Ga0307416_1000905083 233
297 3300032002 Ga0307416_100103747 Ga0307416_1001037471 233
298 3300032004 Ga0307414_10063034 Ga0307414_100630342 233
299 3300037312 Ga0395899_0012115 Ga0395899_0012115_26_730 233
300 3300037312 Ga0395899_0135213 Ga0395899_0135213_972_1676 233
301 3300037312 Ga0395899_0330953 Ga0395899_0330953_177_881 233
302 3300037418 Ga0395900_0000912 Ga0395900_0000912_30119_30823 233
303 3300037418 Ga0395900_0036348 Ga0395900_0036348_4217_4921 233
304 3300037418 Ga0395900_0081258 Ga0395900_0081258_904_1608 233
305 3300037418 Ga0395900_0610467 Ga0395900_0610467_150_854 233
306 3300037466 Ga0395898_0099509 Ga0395898_0099509_1399_2103 233
307 3300037466 Ga0395898_0141917 Ga0395898_0141917_425_1129 233
308 3300037471 Ga0395905_0002176 Ga0395905_0002176_13373_14077 233
309 3300037471 Ga0395905_0011267 Ga0395905_0011267_2852_3556 233
310 3300037471 Ga0395905_0026223 Ga0395905_0026223_2997_3701 233
311 3300037471 Ga0395905_0313387 Ga0395905_0313387_82_786 233
312 3300037471 Ga0395905_0377802 Ga0395905_0377802_150_854 233
313 3300037471 Ga0395905_0440892 Ga0395905_0440892_124_828 233
314 3300038443 Ga0395901_0054703 Ga0395901_0054703_1611_2315 233
315 3300038443 Ga0395901_0096533 Ga0395901_0096533_672_1376 233
316 3300038443 Ga0395901_0135974 Ga0395901_0135974_1017_1721 233
317 3300038443 Ga0395901_0148942 Ga0395901_0148942_864_1568 233
318 3300038443 Ga0395901_0169230 Ga0395901_0169230_558_1262 233
319 3300041486 Ga0451807_0286986 Ga0451807_0286986_214_915 233
320 3300042004 Ga0439445_0004822 Ga0439445_0004822_323_1024 233
321 3300042006 Ga0439432_021453 Ga0439432_021453_1057_1758 233
322 3300044656 Ga0466969_0003940 Ga0466969_0003940_3234_3938 233
323 3300044684 Ga0466966_0001131 Ga0466966_0001131_8553_9257 233
324 3300044684 Ga0466966_0032948 Ga0466966_0032948_1798_2502 233
325 3300044694 Ga0466963_0002122 Ga0466963_0002122_9538_10242 233
326 3300044719 Ga0466971_0008191 Ga0466971_0008191_1336_2040 233
327 3300044765 Ga0466970_0012351 Ga0466970_0012351_3355_4059 233
328 3300044842 Ga0466957_0001498 Ga0466957_0001498_493_1197 233
329 3300045049 Ga0466959_0001847 Ga0466959_0001847_5937_6641 233
330 3300048905 Ga0496102_0011386 Ga0496102_0011386_3231_3935 233
331 3300048907 Ga0496104_0075755 Ga0496104_0075755_819_1523 233
332 3300048909 Ga0496106_0036147 Ga0496106_0036147_235_939 233
333 3300048910 Ga0496107_0011979 Ga0496107_0011979_4692_5396 233
334 3300048911 Ga0496108_0009406 Ga0496108_0009406_1264_1968 233
335 3300048912 Ga0496109_0010251 Ga0496109_0010251_6077_6781 233
336 3300048913 Ga0496110_0018126 Ga0496110_0018126_1258_1962 233
337 3300048914 Ga0496111_0004353 Ga0496111_0004353_3272_3976 233
338 3300048915 Ga0496112_0115595 Ga0496112_0115595_1280_1984 233
339 3300048916 Ga0496113_0149219 Ga0496113_0149219_943_1647 233
340 3300050513 nmdc:mga0rr50_460663_c1 nmdc:mga0rr50_460663_c1_340_1041 233
341 3300061719 Ga0466962_0024055 Ga0466962_0024055_1829_2533 233
342 3300001904 JGI24736J21556_1008888 JGI24736J21556_10088882 234
343 3300001989 JGI24739J22299_10030728 JGI24739J22299_100307282 234
344 3300001989 JGI24739J22299_10038800 JGI24739J22299_100388001 234
345 3300001990 JGI24737J22298_10002430 JGI24737J22298_100024307 234
346 3300001990 JGI24737J22298_10006127 JGI24737J22298_100061271 234
347 3300005327 Ga0070658_10010209 Ga0070658_100102095 234
348 3300005327 Ga0070658_10028140 Ga0070658_100281403 234
349 3300005327 Ga0070658_10036358 Ga0070658_100363581 234
350 3300005327 Ga0070658_10068348 Ga0070658_100683483 234
351 3300005327 Ga0070658_10090281 Ga0070658_100902813 234
352 3300005327 Ga0070658_10179251 Ga0070658_101792512 234
353 3300005328 Ga0070676_10003403 Ga0070676_100034036 234
354 3300005331 Ga0070670_100001616 Ga0070670_1000016169 234
355 3300005331 Ga0070670_100258809 Ga0070670_1002588091 234
356 3300005333 Ga0070677_10146964 Ga0070677_101469641 234
357 3300005335 Ga0070666_10214656 Ga0070666_102146561 234
358 3300005336 Ga0070680_100009968 Ga0070680_1000099687 234
359 3300005336 Ga0070680_100019844 Ga0070680_1000198444 234
360 3300005339 Ga0070660_100042929 Ga0070660_1000429293 234
361 3300005339 Ga0070660_100055731 Ga0070660_1000557312 234
362 3300005339 Ga0070660_100066893 Ga0070660_1000668933 234
363 3300005339 Ga0070660_100076595 Ga0070660_1000765951 234
364 3300005339 Ga0070660_100187314 Ga0070660_1001873142 234
365 3300005339 Ga0070660_100270638 Ga0070660_1002706381 234
366 3300005339 Ga0070660_100568269 Ga0070660_1005682691 234
367 3300005344 Ga0070661_100024122 Ga0070661_1000241223 234
368 3300005344 Ga0070661_100056748 Ga0070661_1000567482 234
369 3300005344 Ga0070661_100128181 Ga0070661_1001281813 234
370 3300005344 Ga0070661_100316753 Ga0070661_1003167531 234
371 3300005347 Ga0070668_100004873 Ga0070668_1000048739 234
372 3300005347 Ga0070668_100220882 Ga0070668_1002208822 234
373 3300005353 Ga0070669_100010130 Ga0070669_1000101306 234
374 3300005355 Ga0070671_100001670 Ga0070671_1000016708 234
375 3300005355 Ga0070671_100002301 Ga0070671_1000023018 234
376 3300005355 Ga0070671_100011559 Ga0070671_1000115593 234
377 3300005355 Ga0070671_100023096 Ga0070671_1000230965 234
378 3300005356 Ga0070674_100091528 Ga0070674_1000915283 234
379 3300005364 Ga0070673_100038330 Ga0070673_1000383304 234
380 3300005364 Ga0070673_100066413 Ga0070673_1000664132 234
381 3300005366 Ga0070659_100019549 Ga0070659_1000195496 234
382 3300005366 Ga0070659_100043977 Ga0070659_1000439772 234
383 3300005366 Ga0070659_100075882 Ga0070659_1000758822 234
384 3300005367 Ga0070667_100052950 Ga0070667_1000529505 234
385 3300005435 Ga0070714_100204247 Ga0070714_1002042472 234
386 3300005435 Ga0070714_100293540 Ga0070714_1002935402 234
387 3300005455 Ga0070663_100494519 Ga0070663_1004945191 234
388 3300005456 Ga0070678_100001009 Ga0070678_10000100915 234
389 3300005456 Ga0070678_100022762 Ga0070678_1000227623 234
390 3300005456 Ga0070678_100050397 Ga0070678_1000503974 234
391 3300005457 Ga0070662_100006947 Ga0070662_1000069473 234
392 3300005457 Ga0070662_100021124 Ga0070662_1000211244 234
393 3300005457 Ga0070662_100146151 Ga0070662_1001461512 234
394 3300005457 Ga0070662_100254961 Ga0070662_1002549611 234
395 3300005458 Ga0070681_10112452 Ga0070681_101124523 234
396 3300005458 Ga0070681_10436387 Ga0070681_104363871 234
397 3300005459 Ga0068867_100090577 Ga0068867_1000905771 234
398 3300005459 Ga0068867_100098368 Ga0068867_1000983683 234
399 3300005467 Ga0070706_100262434 Ga0070706_1002624341 234
400 3300005530 Ga0070679_100319653 Ga0070679_1003196532 234
401 3300005535 Ga0070684_100657695 Ga0070684_1006576951 234
402 3300005543 Ga0070672_100032060 Ga0070672_1000320602 234
403 3300005543 Ga0070672_100443326 Ga0070672_1004433262 234
404 3300005545 Ga0070695_100013031 Ga0070695_1000130315 234
405 3300005549 Ga0070704_100373167 Ga0070704_1003731671 234
406 3300005563 Ga0068855_100211839 Ga0068855_1002118392 234
407 3300005563 Ga0068855_100590333 Ga0068855_1005903331 234
408 3300005564 Ga0070664_100000675 Ga0070664_1000006757 234
409 3300005564 Ga0070664_100042795 Ga0070664_1000427955 234
410 3300005578 Ga0068854_100053546 Ga0068854_1000535462 234
411 3300005578 Ga0068854_100117337 Ga0068854_1001173372 234
412 3300005578 Ga0068854_100126818 Ga0068854_1001268182 234
413 3300005614 Ga0068856_100118569 Ga0068856_1001185693 234
414 3300005614 Ga0068856_100894110 Ga0068856_1008941102 234
415 3300005616 Ga0068852_100008231 Ga0068852_10000823111 234
416 3300005617 Ga0068859_100258709 Ga0068859_1002587092 234
417 3300005618 Ga0068864_100034399 Ga0068864_1000343995 234
418 3300005842 Ga0068858_100078820 Ga0068858_1000788202 234
419 3300005843 Ga0068860_100014445 Ga0068860_1000144455 234
420 3300005844 Ga0068862_100050427 Ga0068862_1000504275 234
421 3300005844 Ga0068862_100522627 Ga0068862_1005226272 234
422 3300006237 Ga0097621_100027147 Ga0097621_1000271473 234
423 3300006358 Ga0068871_100210400 Ga0068871_1002104002 234
424 3300006880 Ga0075429_100352699 Ga0075429_1003526992 234
425 3300006881 Ga0068865_100207258 Ga0068865_1002072582 234
426 3300006931 Ga0097620_100258706 Ga0097620_1002587062 234
427 3300009093 Ga0105240_10042240 Ga0105240_100422402 234
428 3300009093 Ga0105240_10472610 Ga0105240_104726102 234
429 3300009094 Ga0111539_10020298 Ga0111539_100202982 234
430 3300009098 Ga0105245_10101888 Ga0105245_101018882 234
431 3300009147 Ga0114129_10387600 Ga0114129_103876002 234
432 3300009147 Ga0114129_10440981 Ga0114129_104409812 234
433 3300009177 Ga0105248_10211631 Ga0105248_102116312 234
434 3300009177 Ga0105248_10956561 Ga0105248_109565612 234
435 3300011119 Ga0105246_10811393 Ga0105246_108113931 234
436 3300013100 Ga0157373_10354164 Ga0157373_103541642 234
437 3300013102 Ga0157371_10388944 Ga0157371_103889442 234
438 3300013102 Ga0157371_10432192 Ga0157371_104321922 234
439 3300013104 Ga0157370_10024985 Ga0157370_100249855 234
440 3300013105 Ga0157369_10010869 Ga0157369_100108694 234
441 3300013105 Ga0157369_10064124 Ga0157369_100641242 234
442 3300013105 Ga0157369_10119551 Ga0157369_101195513 234
443 3300013105 Ga0157369_10630986 Ga0157369_106309862 234
444 3300013306 Ga0163162_10447777 Ga0163162_104477772 234
445 3300013307 Ga0157372_10228222 Ga0157372_102282223 234
446 3300013308 Ga0157375_10052488 Ga0157375_100524883 234
447 3300020069 Ga0197907_10778048 Ga0197907_107780482 234
448 3300020081 Ga0206354_10185466 Ga0206354_101854661 234
449 3300020081 Ga0206354_11061492 Ga0206354_110614922 234
450 3300020082 Ga0206353_11730299 Ga0206353_117302992 234
451 3300021377 Ga0213874_10088014 Ga0213874_100880142 234
452 3300021384 Ga0213876_10004712 Ga0213876_100047122 234
453 3300025315 Ga0207697_10140921 Ga0207697_101409211 234
454 3300025893 Ga0207682_10062223 Ga0207682_100622232 234
455 3300025893 Ga0207682_10071084 Ga0207682_100710842 234
456 3300025899 Ga0207642_10156573 Ga0207642_101565732 234
457 3300025901 Ga0207688_10134322 Ga0207688_101343222 234
458 3300025903 Ga0207680_10082463 Ga0207680_100824632 234
459 3300025904 Ga0207647_10008080 Ga0207647_1000808010 234
460 3300025907 Ga0207645_10012375 Ga0207645_100123752 234
461 3300025908 Ga0207643_10208782 Ga0207643_102087822 234
462 3300025909 Ga0207705_10006763 Ga0207705_100067635 234
463 3300025909 Ga0207705_10011161 Ga0207705_100111614 234
464 3300025909 Ga0207705_10155627 Ga0207705_101556272 234
465 3300025912 Ga0207707_10346080 Ga0207707_103460801 234
466 3300025913 Ga0207695_10016672 Ga0207695_100166728 234
467 3300025917 Ga0207660_10005359 Ga0207660_100053597 234
468 3300025917 Ga0207660_10341581 Ga0207660_103415812 234
469 3300025919 Ga0207657_10082386 Ga0207657_100823862 234
470 3300025919 Ga0207657_10157896 Ga0207657_101578962 234
471 3300025919 Ga0207657_10288688 Ga0207657_102886882 234
472 3300025920 Ga0207649_10014509 Ga0207649_100145094 234
473 3300025920 Ga0207649_10198862 Ga0207649_101988622 234
474 3300025921 Ga0207652_10222850 Ga0207652_102228501 234
475 3300025925 Ga0207650_10066669 Ga0207650_100666692 234
476 3300025929 Ga0207664_10121453 Ga0207664_101214533 234
477 3300025929 Ga0207664_10259529 Ga0207664_102595292 234
478 3300025931 Ga0207644_10000090 Ga0207644_1000009057 234
479 3300025931 Ga0207644_10004166 Ga0207644_100041665 234
480 3300025932 Ga0207690_10017183 Ga0207690_100171835 234
481 3300025932 Ga0207690_10258945 Ga0207690_102589452 234
482 3300025933 Ga0207706_10033286 Ga0207706_100332862 234
483 3300025933 Ga0207706_10047381 Ga0207706_100473813 234
484 3300025933 Ga0207706_10064965 Ga0207706_100649652 234
485 3300025933 Ga0207706_10389731 Ga0207706_103897311 234
486 3300025940 Ga0207691_10122014 Ga0207691_101220142 234
487 3300025940 Ga0207691_10311357 Ga0207691_103113572 234
488 3300025941 Ga0207711_10004825 Ga0207711_100048257 234
489 3300025941 Ga0207711_10014217 Ga0207711_100142172 234
490 3300025941 Ga0207711_10188335 Ga0207711_101883352 234
491 3300025942 Ga0207689_10108220 Ga0207689_101082202 234
492 3300025944 Ga0207661_10049671 Ga0207661_100496712 234
493 3300025945 Ga0207679_10001267 Ga0207679_1000126713 234
494 3300025949 Ga0207667_10132048 Ga0207667_101320483 234
495 3300025949 Ga0207667_10323464 Ga0207667_103234642 234
496 3300025949 Ga0207667_10365508 Ga0207667_103655082 234
497 3300025960 Ga0207651_10364638 Ga0207651_103646382 234
498 3300025960 Ga0207651_10367197 Ga0207651_103671971 234
499 3300025972 Ga0207668_10000107 Ga0207668_1000010746 234
500 3300025981 Ga0207640_10040908 Ga0207640_100409084 234
501 3300025981 Ga0207640_10043861 Ga0207640_100438613 234
502 3300025981 Ga0207640_10729360 Ga0207640_107293601 234
503 3300025986 Ga0207658_10048630 Ga0207658_100486303 234
504 3300025986 Ga0207658_10274505 Ga0207658_102745052 234
505 3300025986 Ga0207658_10577629 Ga0207658_105776292 234
506 3300026023 Ga0207677_10127003 Ga0207677_101270033 234
507 3300026023 Ga0207677_10925834 Ga0207677_109258341 234
508 3300026035 Ga0207703_10064504 Ga0207703_100645043 234
509 3300026041 Ga0207639_10379347 Ga0207639_103793471 234
510 3300026067 Ga0207678_10007366 Ga0207678_100073666 234
511 3300026067 Ga0207678_10083869 Ga0207678_100838691 234
512 3300026078 Ga0207702_10159952 Ga0207702_101599522 234
513 3300026078 Ga0207702_10292509 Ga0207702_102925092 234
514 3300026088 Ga0207641_10167761 Ga0207641_101677612 234
515 3300026089 Ga0207648_10059162 Ga0207648_100591622 234
516 3300026089 Ga0207648_10091127 Ga0207648_100911272 234
517 3300026089 Ga0207648_10203753 Ga0207648_102037532 234
518 3300026095 Ga0207676_10015903 Ga0207676_100159033 234
519 3300026116 Ga0207674_10034199 Ga0207674_100341995 234
520 3300026116 Ga0207674_10251162 Ga0207674_102511622 234
521 3300026121 Ga0207683_10001252 Ga0207683_100012523 234
522 3300026121 Ga0207683_10047465 Ga0207683_100474654 234
523 3300026121 Ga0207683_10151840 Ga0207683_101518403 234
524 3300026142 Ga0207698_10001191 Ga0207698_100011913 234
525 3300026142 Ga0207698_10016505 Ga0207698_100165054 234
526 3300026142 Ga0207698_10451263 Ga0207698_104512632 234
527 3300028379 Ga0268266_10006543 Ga0268266_1000654311 234
528 3300028379 Ga0268266_10768106 Ga0268266_107681061 234
529 3300028380 Ga0268265_10010441 Ga0268265_100104415 234
530 3300028381 Ga0268264_10107785 Ga0268264_101077852 234
531 3300031548 Ga0307408_100658162 Ga0307408_1006581621 234
532 3300031824 Ga0307413_10355759 Ga0307413_103557592 234
533 3300031852 Ga0307410_10017877 Ga0307410_100178772 234
534 3300031903 Ga0307407_10221723 Ga0307407_102217232 234
535 3300031911 Ga0307412_10042825 Ga0307412_100428252 234
536 3300032002 Ga0307416_100001948 Ga0307416_1000019484 234
537 3300032002 Ga0307416_100679389 Ga0307416_1006793891 234
538 3300032002 Ga0307416_100730115 Ga0307416_1007301152 234
539 3300032005 Ga0307411_10306153 Ga0307411_103061532 234
540 3300032126 Ga0307415_100116755 Ga0307415_1001167552 234
541 3300037068 Ga0373925_0459704 Ga0373925_0459704_130_837 234
542 3300037312 Ga0395899_0000981 Ga0395899_0000981_15395_16099 234
543 3300037312 Ga0395899_0056894 Ga0395899_0056894_1251_1955 234
544 3300037312 Ga0395899_0126052 Ga0395899_0126052_866_1570 234
545 3300037312 Ga0395899_0141110 Ga0395899_0141110_438_1142 234
546 3300037312 Ga0395899_0163975 Ga0395899_0163975_604_1308 234
547 3300037312 Ga0395899_0297843 Ga0395899_0297843_54_758 234
548 3300037312 Ga0395899_0321283 Ga0395899_0321283_285_989 234
549 3300037418 Ga0395900_0020065 Ga0395900_0020065_2631_3335 234
550 3300037418 Ga0395900_0027048 Ga0395900_0027048_4472_5176 234
551 3300037418 Ga0395900_0032140 Ga0395900_0032140_1817_2521 234
552 3300037418 Ga0395900_0047865 Ga0395900_0047865_2054_2758 234
553 3300037418 Ga0395900_0107923 Ga0395900_0107923_1808_2512 234
554 3300037418 Ga0395900_0112561 Ga0395900_0112561_1487_2191 234
555 3300037418 Ga0395900_0164139 Ga0395900_0164139_1034_1738 234
556 3300037418 Ga0395900_0187970 Ga0395900_0187970_982_1686 234
557 3300037418 Ga0395900_0416815 Ga0395900_0416815_362_1066 234
558 3300037418 Ga0395900_0442655 Ga0395900_0442655_41_745 234
559 3300037418 Ga0395900_0537241 Ga0395900_0537241_21_725 234
560 3300037466 Ga0395898_0013658 Ga0395898_0013658_2281_2985 234
561 3300037466 Ga0395898_0158387 Ga0395898_0158387_358_1062 234
562 3300037471 Ga0395905_0006103 Ga0395905_0006103_7173_7877 234
563 3300037471 Ga0395905_0007538 Ga0395905_0007538_4732_5436 234
564 3300037471 Ga0395905_0014142 Ga0395905_0014142_3000_3704 234
565 3300037471 Ga0395905_0026524 Ga0395905_0026524_3392_4096 234
566 3300037471 Ga0395905_0030086 Ga0395905_0030086_1247_1951 234
567 3300037471 Ga0395905_0051975 Ga0395905_0051975_1130_1834 234
568 3300037471 Ga0395905_0071421 Ga0395905_0071421_77_781 234
569 3300037471 Ga0395905_0158062 Ga0395905_0158062_1081_1785 234
570 3300037471 Ga0395905_0249480 Ga0395905_0249480_446_1150 234
571 3300037471 Ga0395905_0514530 Ga0395905_0514530_110_814 234
572 3300038443 Ga0395901_0011647 Ga0395901_0011647_3371_4075 234
573 3300038443 Ga0395901_0018305 Ga0395901_0018305_1906_2610 234
574 3300038443 Ga0395901_0026298 Ga0395901_0026298_1006_1710 234
575 3300038443 Ga0395901_0028858 Ga0395901_0028858_170_874 234
576 3300038443 Ga0395901_0148844 Ga0395901_0148844_205_909 234
577 3300038443 Ga0395901_0184511 Ga0395901_0184511_56_760 234
578 3300038443 Ga0395901_0202309 Ga0395901_0202309_1232_1936 234
579 3300038443 Ga0395901_0257400 Ga0395901_0257400_176_880 234
580 3300038443 Ga0395901_0341817 Ga0395901_0341817_514_1218 234
581 3300039437 Ga0436365_1094616 Ga0436365_1094616_773_1477 234
582 3300039450 Ga0436363_0623342 Ga0436363_0623342_671_1375 234
583 3300042120 Ga0450917_001777 Ga0450917_001777_783_1487 234
584 3300042142 Ga0450905_006843 Ga0450905_006843_244_948 234
585 3300042144 Ga0450889_000007 Ga0450889_000007_14069_14773 234
586 3300044656 Ga0466969_0010066 Ga0466969_0010066_2844_3548 234
587 3300044656 Ga0466969_0104173 Ga0466969_0104173_195_899 234
588 3300044683 Ga0466965_0166433 Ga0466965_0166433_381_1085 234
589 3300044684 Ga0466966_0022363 Ga0466966_0022363_818_1522 234
590 3300044684 Ga0466966_0062609 Ga0466966_0062609_535_1239 234
591 3300044684 Ga0466966_0064417 Ga0466966_0064417_482_1186 234
592 3300044693 Ga0466961_0009596 Ga0466961_0009596_2170_2874 234
593 3300044693 Ga0466961_0108161 Ga0466961_0108161_363_1067 234
594 3300044719 Ga0466971_0003496 Ga0466971_0003496_3742_4446 234
595 3300044765 Ga0466970_0025859 Ga0466970_0025859_1648_2352 234
596 3300044765 Ga0466970_0160804 Ga0466970_0160804_111_815 234
597 3300044842 Ga0466957_0047041 Ga0466957_0047041_944_1648 234
598 3300044842 Ga0466957_0237211 Ga0466957_0237211_255_962 234
599 3300045049 Ga0466959_0054064 Ga0466959_0054064_1313_2017 234
600 3300045049 Ga0466959_0413957 Ga0466959_0413957_160_864 234
601 3300045836 Ga0466958_0133086 Ga0466958_0133086_739_1443 234
602 3300045836 Ga0466958_0409094 Ga0466958_0409094_40_744 234
603 3300045976 Ga0466967_0109225 Ga0466967_0109225_991_1743 234
604 3300045976 Ga0466967_0144660 Ga0466967_0144660_85_789 234
605 3300046528 Ga0495642_0060173 Ga0495642_0060173_270_974 234
606 3300046537 Ga0495598_0017390 Ga0495598_0017390_1052_1756 234
607 3300046539 Ga0495621_0016869 Ga0495621_0016869_1122_1826 234
608 3300046558 Ga0495633_0035831 Ga0495633_0035831_1594_2298 234
609 3300046616 Ga0495668_0135690 Ga0495668_0135690_459_1163 234
610 3300046684 Ga0495669_0023548 Ga0495669_0023548_765_1469 234
611 3300046684 Ga0495669_0074696 Ga0495669_0074696_89_793 234
612 3300046684 Ga0495669_0155189 Ga0495669_0155189_306_1010 234
613 3300046691 Ga0495670_0006982 Ga0495670_0006982_3826_4530 234
614 3300047323 Ga0495683_0102700 Ga0495683_0102700_94_798 234
615 3300047445 Ga0495677_0011550 Ga0495677_0011550_1073_1777 234
616 3300047445 Ga0495677_0135386 Ga0495677_0135386_24_728 234
617 3300048904 Ga0496101_0234871 Ga0496101_0234871_207_911 234
618 3300048906 Ga0496103_0155002 Ga0496103_0155002_263_967 234
619 3300048909 Ga0496106_0067486 Ga0496106_0067486_347_1066 234
620 3300048910 Ga0496107_0042833 Ga0496107_0042833_1662_2381 234
621 3300048910 Ga0496107_0516548 Ga0496107_0516548_138_845 234
622 3300048912 Ga0496109_0016692 Ga0496109_0016692_1249_1953 234
623 3300048913 Ga0496110_0387147 Ga0496110_0387147_318_1022 234
624 3300049760 Ga0501263_004726 Ga0501263_004726_476_1180 234
625 3300050507 nmdc:mga05p37_321727_c1 nmdc:mga05p37_321727_c1_527_1231 234
626 3300050507 nmdc:mga05p37_658265_c1 nmdc:mga05p37_658265_c1_106_810 234
627 3300050511 nmdc:mga08y16_97889_c1 nmdc:mga08y16_97889_c1_1330_2034 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

73

229

0.91

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

71

273

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uzl-assembly1.cif.gz_B-2 maba from mycobacterium tuberculosis 0.9064 2 229
5ovl-assembly1.cif.gz_D crystal structure of maba bound to nadp+ from m. smegmatis 0.9024 2 229
1g6k-assembly1.cif.gz_A crystal structure of glucose dehydrogenase mutant e96a complexed with nad+ 0.9011 3 229
1gco-assembly1.cif.gz_A crystal structure of glucose dehydrogenase complexed with nad+ 0.8987 3 229
3aus-assembly1.cif.gz_A crystal structure of bacillus megaterium glucose dehydrogenase 4 in ligand-free form 0.8984 3 229
ID Description Score Start End Superfamily
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9069 3 167 3.40.50.720
2ztuB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9022 6 229 3.40.50.720
af_P76633_10_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.901 2 229 3.40.50.720
af_Q9URX0_1_248_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9003 3 229 3.40.50.720
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8971 2 229 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A258C4U9-F1-model_v4 deleted 0.9865 2 105
AF-A0A3D0WLM4-F1-model_v4 deleted 0.9691 1 145
AF-A0A7Y1T5F4-F1-model_v4 deleted 0.9668 1 234
AF-A0A7Y1T5F4-F1-model_v4 deleted 0.9627 1 234
AF-A0A2W4YCQ0-F1-model_v4 deleted 0.9509 1 234

Feature Viewer

pLDDT pTM Quality
91.09 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map