F470499
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 626 | 403 | 1252 | 257 |
Family's Representative Sequence
| Representative Sequence | 3300048908|Ga0496105_0599463|Ga0496105_0599463_60_818 |
| Length | 252 |
| Sequence | VNDGDGTLAAEAQGRRFGPLGTALVIIPTYNEAENIKKIVGRVRSAVPEAHVLVADDNSPDGTGKLADELAADDENVQVLHRKGKEGLGAAYLAGFRWGLEHGYGVLIEMDADGSHQPEELPRLLTALKGADLVLGSRWVPGGRVVNWPKSREFISRGGSLYSRVLLAFRRETLEGLGLGEVASQGYCFQVDLARRAVKAGYHVVEVPITFVERELGDSKMSRDILVEALWRVTTWGVGERVGRLTARRKQS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 37 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 38 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 40 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 41 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 42 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 44 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 45 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 46 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 49 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 67 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 73 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 74 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 76 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 106 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 108 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 109 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 110 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 111 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 112 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 113 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 114 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 115 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 116 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 117 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 118 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 119 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 120 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 121 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 122 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 123 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 124 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 125 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 126 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 127 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 128 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 129 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 130 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 131 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 132 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 133 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 134 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 135 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 136 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 137 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 138 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 139 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 140 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 141 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 142 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 143 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 144 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 146 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 147 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 148 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 149 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 150 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 151 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 152 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 153 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 154 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 155 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 156 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 157 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 158 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 159 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 160 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 161 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 162 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 163 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 164 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 165 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 166 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 167 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 168 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 169 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 170 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 171 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 172 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 173 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 174 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 175 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 176 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 177 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 178 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 179 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 180 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 181 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 182 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 183 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 184 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 185 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 186 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 187 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 188 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 189 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 190 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 259 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 260 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 261 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 265 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 266 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 267 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 268 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 269 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 296 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 297 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 298 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 308 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 309 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 310 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 311 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 313 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 314 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 315 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 316 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 317 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 318 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 319 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 320 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 321 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 322 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 323 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 324 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 325 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 326 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 327 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 328 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 331 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 332 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 333 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 334 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 335 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 336 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 337 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 338 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 339 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 340 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 341 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 342 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 343 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 344 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 345 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 346 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 347 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 348 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 349 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 350 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 351 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 352 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 353 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 354 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 355 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 356 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 357 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 358 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 359 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 360 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 361 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 362 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 363 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 364 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 365 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 366 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 367 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 368 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 369 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 370 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 371 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 372 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 373 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 374 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 375 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 376 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 377 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 378 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 379 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 380 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 381 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 382 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 383 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 384 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 385 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 386 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 387 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 388 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 389 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 390 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 391 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 392 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 393 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 394 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 395 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 396 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 397 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 398 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 399 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 400 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 401 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 402 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 403 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.26 |
| Metatranscriptomes | 1.92 |
| Isolates | 11.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.59 |
| Nodule | 0.96 |
| Rhizoplane | 4.15 |
| Rhizosphere | 79.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496105_0599463 | 3300048908 | Bacteria | 855 |
| 2 | JGI24735J21928_10061776 | 3300002067 | Bacteria | 1076 |
| 3 | rootH1_10008653 | 3300003316 | Bacteria | 2382 |
| 4 | rootL2_10020556 | 3300003322 | Bacteria | 5416 |
| 5 | JGI25160J50197_1016844 | 3300003354 | Bacteria | 2339 |
| 6 | Ga0006562J51391_1102868 | 3300003578 | Bacteria | 2040 |
| 7 | Ga0070658_10000677 | 3300005327 | Bacteria | 29445 |
| 8 | Ga0070660_100160255 | 3300005339 | Bacteria | 1813 |
| 9 | Ga0070667_100690369 | 3300005367 | Bacteria | 944 |
| 10 | Ga0070709_10006485 | 3300005434 | Bacteria | 6378 |
| 11 | Ga0070714_100000002 | 3300005435 | Bacteria | 386673 |
| 12 | Ga0070714_100001182 | 3300005435 | Bacteria | 18802 |
| 13 | Ga0070713_100035240 | 3300005436 | Bacteria | 4027 |
| 14 | Ga0070713_100076323 | 3300005436 | Bacteria | 2845 |
| 15 | Ga0070713_100094701 | 3300005436 | Bacteria | 2575 |
| 16 | Ga0070713_100313334 | 3300005436 | Bacteria | 1447 |
| 17 | Ga0070710_10019284 | 3300005437 | Bacteria | 3522 |
| 18 | Ga0070700_100000072 | 3300005441 | Bacteria | 71205 |
| 19 | Ga0070708_100032555 | 3300005445 | Bacteria | 4524 |
| 20 | Ga0070708_100033754 | 3300005445 | Bacteria | 4446 |
| 21 | Ga0070706_100002091 | 3300005467 | Bacteria | 20346 |
| 22 | Ga0070706_100002349 | 3300005467 | Bacteria | 19092 |
| 23 | Ga0070706_100005716 | 3300005467 | Bacteria | 11827 |
| 24 | Ga0070706_100462369 | 3300005467 | Bacteria | 1180 |
| 25 | Ga0070707_100001004 | 3300005468 | Bacteria | 27958 |
| 26 | Ga0070707_100003928 | 3300005468 | Bacteria | 13990 |
| 27 | Ga0070707_100012739 | 3300005468 | Bacteria | 7852 |
| 28 | Ga0070698_100000637 | 3300005471 | Bacteria | 37691 |
| 29 | Ga0070698_100001515 | 3300005471 | Bacteria | 25747 |
| 30 | Ga0070698_100001711 | 3300005471 | Bacteria | 24475 |
| 31 | Ga0070698_100061633 | 3300005471 | Bacteria | 3785 |
| 32 | Ga0070679_100047535 | 3300005530 | Bacteria | 4276 |
| 33 | Ga0070684_100079493 | 3300005535 | Bacteria | 2899 |
| 34 | Ga0070697_100015965 | 3300005536 | Bacteria | 5903 |
| 35 | Ga0070697_100023402 | 3300005536 | Bacteria | 4911 |
| 36 | Ga0068853_100006392 | 3300005539 | Bacteria | 9360 |
| 37 | Ga0070672_100215790 | 3300005543 | Bacteria | 1608 |
| 38 | Ga0070696_100013349 | 3300005546 | Bacteria | 5512 |
| 39 | Ga0070696_100017170 | 3300005546 | Bacteria | 4884 |
| 40 | Ga0070704_100021974 | 3300005549 | Bacteria | 4146 |
| 41 | Ga0068855_100050257 | 3300005563 | Bacteria | 4914 |
| 42 | Ga0068855_100248898 | 3300005563 | Bacteria | 1983 |
| 43 | Ga0068855_100608856 | 3300005563 | Bacteria | 1177 |
| 44 | Ga0070664_100181796 | 3300005564 | Bacteria | 1869 |
| 45 | Ga0068857_100486208 | 3300005577 | Bacteria | 1157 |
| 46 | Ga0068854_100585294 | 3300005578 | Bacteria | 951 |
| 47 | Ga0068856_100153437 | 3300005614 | Bacteria | 2313 |
| 48 | Ga0068852_100008381 | 3300005616 | Bacteria | 7618 |
| 49 | Ga0068852_100118577 | 3300005616 | Bacteria | 2419 |
| 50 | Ga0068859_100005559 | 3300005617 | Bacteria | 12838 |
| 51 | Ga0068864_100001246 | 3300005618 | Bacteria | 21141 |
| 52 | Ga0068863_100033398 | 3300005841 | Bacteria | 4901 |
| 53 | Ga0068858_100386258 | 3300005842 | Bacteria | 1344 |
| 54 | Ga0081538_10000016 | 3300005981 | Bacteria | 147022 |
| 55 | Ga0081540_1001512 | 3300005983 | Bacteria | 19996 |
| 56 | Ga0070717_10011636 | 3300006028 | Bacteria | 6692 |
| 57 | Ga0070717_10028408 | 3300006028 | Bacteria | 4477 |
| 58 | Ga0070717_10039201 | 3300006028 | Bacteria | 3854 |
| 59 | Ga0070717_10057152 | 3300006028 | Bacteria | 3225 |
| 60 | Ga0075365_10128166 | 3300006038 | Bacteria | 1755 |
| 61 | Ga0075363_100026941 | 3300006048 | Bacteria | 2944 |
| 62 | Ga0075432_10026398 | 3300006058 | Bacteria | 1995 |
| 63 | Ga0070712_100033504 | 3300006175 | Bacteria | 3477 |
| 64 | Ga0070712_100146736 | 3300006175 | Bacteria | 1806 |
| 65 | Ga0075367_10001282 | 3300006178 | Bacteria | 10633 |
| 66 | Ga0075428_100197641 | 3300006844 | Bacteria | 2175 |
| 67 | Ga0075429_100632464 | 3300006880 | Bacteria | 938 |
| 68 | Ga0075436_100072030 | 3300006914 | Bacteria | 2390 |
| 69 | Ga0097620_100005559 | 3300006931 | Bacteria | 12838 |
| 70 | Ga0099826_10061147 | 3300006948 | Bacteria | 2449 |
| 71 | Ga0075435_100389050 | 3300007076 | Bacteria | 1198 |
| 72 | Ga0105240_10012952 | 3300009093 | Bacteria | 11487 |
| 73 | Ga0111539_10139586 | 3300009094 | Bacteria | 2838 |
| 74 | Ga0105245_10041510 | 3300009098 | Bacteria | 4101 |
| 75 | Ga0105245_10109397 | 3300009098 | Bacteria | 2568 |
| 76 | Ga0105245_10783582 | 3300009098 | Bacteria | 991 |
| 77 | Ga0114129_10142368 | 3300009147 | Bacteria | 3286 |
| 78 | Ga0105241_10029549 | 3300009174 | Bacteria | 4091 |
| 79 | Ga0105241_10060165 | 3300009174 | Bacteria | 2921 |
| 80 | Ga0105241_10249598 | 3300009174 | Bacteria | 1504 |
| 81 | Ga0105248_10422949 | 3300009177 | Bacteria | 1500 |
| 82 | Ga0105248_10515278 | 3300009177 | Bacteria | 1348 |
| 83 | Ga0105237_10006081 | 3300009545 | Bacteria | 13504 |
| 84 | Ga0105237_10713174 | 3300009545 | Bacteria | 1010 |
| 85 | Ga0105238_10028580 | 3300009551 | Bacteria | 5680 |
| 86 | Ga0105246_10054690 | 3300011119 | Bacteria | 2752 |
| 87 | Ga0157370_10000875 | 3300013104 | Bacteria | 38190 |
| 88 | Ga0157369_10060040 | 3300013105 | Bacteria | 4101 |
| 89 | Ga0157369_10060175 | 3300013105 | Bacteria | 4096 |
| 90 | Ga0157374_10206269 | 3300013296 | Bacteria | 1926 |
| 91 | Ga0157374_10715648 | 3300013296 | Bacteria | 1015 |
| 92 | Ga0157372_10227571 | 3300013307 | Bacteria | 2162 |
| 93 | Ga0157372_10551176 | 3300013307 | Bacteria | 1344 |
| 94 | Ga0157375_10566930 | 3300013308 | Bacteria | 1296 |
| 95 | Ga0157375_10717214 | 3300013308 | Bacteria | 1153 |
| 96 | Ga0163163_10028049 | 3300014325 | Bacteria | 5401 |
| 97 | Ga0163163_10064075 | 3300014325 | Bacteria | 3647 |
| 98 | Ga0163163_10336218 | 3300014325 | Bacteria | 1565 |
| 99 | Ga0182007_10000166 | 3300015262 | Bacteria | 45125 |
| 100 | Ga0183367_1017 | 3300015688 | Bacteria | 126691 |
| 101 | Ga0197907_11057858 | 3300020069 | Bacteria | 2027 |
| 102 | Ga0197907_11476537 | 3300020069 | Bacteria | 1819 |
| 103 | Ga0206349_1459813 | 3300020075 | Bacteria | 2016 |
| 104 | Ga0206350_10732310 | 3300020080 | Bacteria | 2007 |
| 105 | Ga0206354_10304190 | 3300020081 | Bacteria | 2050 |
| 106 | Ga0206353_10352472 | 3300020082 | Bacteria | 3155 |
| 107 | Ga0206353_10636788 | 3300020082 | Bacteria | 2006 |
| 108 | Ga0206353_10986400 | 3300020082 | Bacteria | 2749 |
| 109 | Ga0213876_10052438 | 3300021384 | Bacteria | 2156 |
| 110 | Ga0213875_10058102 | 3300021388 | Bacteria | 1811 |
| 111 | Ga0224712_10019050 | 3300022467 | Bacteria | 2307 |
| 112 | Ga0224712_10047061 | 3300022467 | Bacteria | 1658 |
| 113 | Ga0224712_10061124 | 3300022467 | Bacteria | 1501 |
| 114 | Ga0224572_1000548 | 3300024225 | Bacteria | 4587 |
| 115 | Ga0209758_1003531 | 3300025297 | Bacteria | 14099 |
| 116 | Ga0207426_1000643 | 3300025302 | Bacteria | 43590 |
| 117 | Ga0207426_1003231 | 3300025302 | Bacteria | 9142 |
| 118 | Ga0207426_1013430 | 3300025302 | Bacteria | 3035 |
| 119 | Ga0207426_1021292 | 3300025302 | Bacteria | 2242 |
| 120 | Ga0207692_10014932 | 3300025898 | Bacteria | 3405 |
| 121 | Ga0207710_10004454 | 3300025900 | Bacteria | 6111 |
| 122 | Ga0207699_10035919 | 3300025906 | Bacteria | 2822 |
| 123 | Ga0207705_10004269 | 3300025909 | Bacteria | 10824 |
| 124 | Ga0207684_10002360 | 3300025910 | Bacteria | 19118 |
| 125 | Ga0207684_10006588 | 3300025910 | Bacteria | 10563 |
| 126 | Ga0207684_10377484 | 3300025910 | Bacteria | 1219 |
| 127 | Ga0207654_10038553 | 3300025911 | Bacteria | 2682 |
| 128 | Ga0207695_10287711 | 3300025913 | Bacteria | 1536 |
| 129 | Ga0207671_10008914 | 3300025914 | Bacteria | 8448 |
| 130 | Ga0207693_10294402 | 3300025915 | Bacteria | 1272 |
| 131 | Ga0207663_10039815 | 3300025916 | Bacteria | 2851 |
| 132 | Ga0207652_10536072 | 3300025921 | Bacteria | 1053 |
| 133 | Ga0207646_10000544 | 3300025922 | Bacteria | 49768 |
| 134 | Ga0207646_10008213 | 3300025922 | Bacteria | 10490 |
| 135 | Ga0207646_10072169 | 3300025922 | Bacteria | 3083 |
| 136 | Ga0207687_10024077 | 3300025927 | Bacteria | 4063 |
| 137 | Ga0207700_10015521 | 3300025928 | Bacteria | 5027 |
| 138 | Ga0207700_10159095 | 3300025928 | Bacteria | 1874 |
| 139 | Ga0207700_10604903 | 3300025928 | Bacteria | 976 |
| 140 | Ga0207664_10000038 | 3300025929 | Bacteria | 166264 |
| 141 | Ga0207664_10009968 | 3300025929 | Bacteria | 6694 |
| 142 | Ga0207664_10472206 | 3300025929 | Bacteria | 1121 |
| 143 | Ga0207665_10406979 | 3300025939 | Bacteria | 1037 |
| 144 | Ga0207711_10217994 | 3300025941 | Bacteria | 1744 |
| 145 | Ga0207661_10340743 | 3300025944 | Bacteria | 1351 |
| 146 | Ga0207667_10097483 | 3300025949 | Bacteria | 3035 |
| 147 | Ga0207667_10342436 | 3300025949 | Bacteria | 1526 |
| 148 | Ga0207667_10409487 | 3300025949 | Bacteria | 1380 |
| 149 | Ga0207667_10543195 | 3300025949 | Bacteria | 1176 |
| 150 | Ga0207703_10354333 | 3300026035 | Bacteria | 1352 |
| 151 | Ga0207639_10015349 | 3300026041 | Bacteria | 5403 |
| 152 | Ga0207708_10000023 | 3300026075 | Bacteria | 176615 |
| 153 | Ga0207708_10131913 | 3300026075 | Bacteria | 1954 |
| 154 | Ga0207702_10083627 | 3300026078 | Bacteria | 2777 |
| 155 | Ga0207702_10149223 | 3300026078 | Bacteria | 2125 |
| 156 | Ga0207676_10019388 | 3300026095 | Bacteria | 4962 |
| 157 | Ga0207674_10554656 | 3300026116 | Bacteria | 1110 |
| 158 | Ga0207698_10066734 | 3300026142 | Bacteria | 2833 |
| 159 | Ga0209371_1034207 | 3300027312 | Bacteria | 1079 |
| 160 | Ga0209282_1048740 | 3300027666 | Bacteria | 2449 |
| 161 | Ga0209813_10067141 | 3300027866 | Bacteria | 1158 |
| 162 | Ga0307515_10009395 | 3300028794 | Bacteria | 18921 |
| 163 | Ga0307515_10140063 | 3300028794 | Bacteria | 2601 |
| 164 | Ga0307515_10233747 | 3300028794 | Bacteria | 1624 |
| 165 | Ga0307511_10000410 | 3300030521 | Bacteria | 45774 |
| 166 | Ga0307511_10015650 | 3300030521 | Bacteria | 7340 |
| 167 | Ga0307511_10046036 | 3300030521 | Bacteria | 3595 |
| 168 | Ga0307512_10002135 | 3300030522 | Bacteria | 25918 |
| 169 | Ga0307512_10021907 | 3300030522 | Bacteria | 5753 |
| 170 | Ga0307513_10052390 | 3300031456 | Bacteria | 4395 |
| 171 | Ga0307509_10166344 | 3300031507 | Bacteria | 2093 |
| 172 | Ga0307508_10024914 | 3300031616 | Bacteria | 5427 |
| 173 | Ga0307508_10225231 | 3300031616 | Bacteria | 1474 |
| 174 | Ga0307514_10004854 | 3300031649 | Bacteria | 12229 |
| 175 | Ga0307514_10015345 | 3300031649 | Bacteria | 6324 |
| 176 | Ga0316576_10000270 | 3300031727 | Bacteria | 22702 |
| 177 | Ga0316576_10018290 | 3300031727 | Bacteria | 4781 |
| 178 | Ga0307516_10011429 | 3300031730 | Bacteria | 9644 |
| 179 | Ga0307516_10280546 | 3300031730 | Bacteria | 1348 |
| 180 | Ga0307405_10003123 | 3300031731 | Bacteria | 7528 |
| 181 | Ga0307413_10259827 | 3300031824 | Bacteria | 1294 |
| 182 | Ga0307410_10065150 | 3300031852 | Bacteria | 2506 |
| 183 | Ga0307410_10111003 | 3300031852 | Bacteria | 1984 |
| 184 | Ga0307409_100003337 | 3300031995 | Bacteria | 8689 |
| 185 | Ga0307416_100001296 | 3300032002 | Bacteria | 13482 |
| 186 | Ga0307416_100226077 | 3300032002 | Bacteria | 1800 |
| 187 | Ga0307416_100380457 | 3300032002 | Bacteria | 1441 |
| 188 | Ga0307415_100000260 | 3300032126 | Bacteria | 22804 |
| 189 | Ga0307415_100095637 | 3300032126 | Bacteria | 2163 |
| 190 | Ga0307415_100131151 | 3300032126 | Bacteria | 1898 |
| 191 | Ga0307507_10120829 | 3300033179 | Bacteria | 2096 |
| 192 | Ga0307507_10231552 | 3300033179 | Bacteria | 1224 |
| 193 | Ga0307510_10056448 | 3300033180 | Bacteria | 4089 |
| 194 | Ga0373948_0010364 | 3300034817 | Bacteria | 1626 |
| 195 | Ga0373950_0007304 | 3300034818 | Bacteria | 1712 |
| 196 | Ga0373959_0008854 | 3300034820 | Bacteria | 1723 |
| 197 | Ga0373938_0036541 | 3300034957 | Bacteria | 1075 |
| 198 | Ga0373928_0004634 | 3300035084 | Bacteria | 2620 |
| 199 | Ga0373929_0019788 | 3300035085 | Bacteria | 1351 |
| 200 | Ga0373934_0001411 | 3300035086 | Bacteria | 8784 |
| 201 | Ga0373940_0014329 | 3300035088 | Bacteria | 1932 |
| 202 | Ga0373923_0029446 | 3300035111 | Bacteria | 2202 |
| 203 | Ga0373939_0010717 | 3300035114 | Bacteria | 2299 |
| 204 | Ga0373941_0016515 | 3300035115 | Bacteria | 2008 |
| 205 | Ga0373953_0000268 | 3300035117 | Bacteria | 14200 |
| 206 | Ga0373954_0001771 | 3300035118 | Bacteria | 8872 |
| 207 | Ga0373956_0002251 | 3300035119 | Bacteria | 7946 |
| 208 | Ga0373946_0193481 | 3300035171 | Bacteria | 971 |
| 209 | Ga0373955_0000016 | 3300035172 | Bacteria | 71862 |
| 210 | Ga0373962_0014421 | 3300035242 | Bacteria | 2014 |
| 211 | Ga0373924_0000752 | 3300035410 | Bacteria | 10094 |
| 212 | Ga0373927_0017018 | 3300035695 | Bacteria | 4790 |
| 213 | Ga0373933_0000001 | 3300035724 | Bacteria | 228234 |
| 214 | Ga0373937_0003722 | 3300036401 | Bacteria | 12886 |
| 215 | Ga0316584_0007960 | 3300036712 | Bacteria | 7272 |
| 216 | Ga0395900_0177367 | 3300037418 | Bacteria | 2167 |
| 217 | Ga0395900_0547115 | 3300037418 | Bacteria | 1103 |
| 218 | Ga0395900_0573274 | 3300037418 | Bacteria | 1071 |
| 219 | Ga0395898_0018140 | 3300037466 | Bacteria | 7182 |
| 220 | Ga0436364_0819810 | 3300037853 | Bacteria | 1454 |
| 221 | Ga0436364_0911612 | 3300037853 | Bacteria | 5012 |
| 222 | Ga0395901_0381100 | 3300038443 | Bacteria | 1451 |
| 223 | Ga0436365_1298945 | 3300039437 | Bacteria | 5479 |
| 224 | Ga0436363_0412211 | 3300039450 | Bacteria | 1042 |
| 225 | Ga0439436_0016730 | 3300041404 | Bacteria | 2198 |
| 226 | Ga0439439_0013511 | 3300041406 | Bacteria | 1979 |
| 227 | Ga0451793_0478337 | 3300041452 | Bacteria | 1706 |
| 228 | Ga0451795_1417318 | 3300041456 | Bacteria | 1016 |
| 229 | Ga0451853_1859136 | 3300041512 | Bacteria | 2903 |
| 230 | Ga0439433_0005340 | 3300041999 | Bacteria | 2758 |
| 231 | Ga0439448_0009516 | 3300042005 | Bacteria | 2867 |
| 232 | Ga0439448_0020807 | 3300042005 | Bacteria | 2033 |
| 233 | Ga0439449_0001268 | 3300042007 | Bacteria | 9896 |
| 234 | Ga0439450_019828 | 3300042008 | Bacteria | 1429 |
| 235 | Ga0439454_004515 | 3300042011 | Bacteria | 1610 |
| 236 | Ga0439455_0041912 | 3300042012 | Bacteria | 1175 |
| 237 | Ga0439457_000025 | 3300042014 | Bacteria | 30691 |
| 238 | Ga0439457_003276 | 3300042014 | Bacteria | 4433 |
| 239 | Ga0439463_032717 | 3300042016 | Bacteria | 1314 |
| 240 | Ga0450890_009948 | 3300042127 | Bacteria | 1222 |
| 241 | Ga0450894_000356 | 3300042131 | Bacteria | 8039 |
| 242 | Ga0450896_000092 | 3300042133 | Bacteria | 6296 |
| 243 | Ga0450898_000154 | 3300042134 | Bacteria | 6958 |
| 244 | Ga0450899_000359 | 3300042135 | Bacteria | 5064 |
| 245 | Ga0450900_018926 | 3300042136 | Bacteria | 947 |
| 246 | Ga0450903_000014 | 3300042138 | Bacteria | 34118 |
| 247 | Ga0450906_000431 | 3300042145 | Bacteria | 8701 |
| 248 | Ga0450907_013450 | 3300042146 | Bacteria | 1363 |
| 249 | Ga0439458_0003690 | 3300042157 | Bacteria | 3553 |
| 250 | Ga0439458_0005624 | 3300042157 | Bacteria | 2813 |
| 251 | Ga0466969_0033688 | 3300044656 | Bacteria | 2599 |
| 252 | Ga0466972_0002210 | 3300044658 | Bacteria | 9550 |
| 253 | Ga0466972_0006993 | 3300044658 | Bacteria | 5659 |
| 254 | Ga0466972_0041761 | 3300044658 | Bacteria | 2232 |
| 255 | Ga0466972_0159789 | 3300044658 | Bacteria | 1059 |
| 256 | Ga0466965_0066143 | 3300044683 | Bacteria | 1812 |
| 257 | Ga0466965_0179896 | 3300044683 | Bacteria | 1115 |
| 258 | Ga0466965_0257605 | 3300044683 | Bacteria | 937 |
| 259 | Ga0466966_0005225 | 3300044684 | Bacteria | 8534 |
| 260 | Ga0466966_0068619 | 3300044684 | Bacteria | 2226 |
| 261 | Ga0466966_0074846 | 3300044684 | Bacteria | 2116 |
| 262 | Ga0466966_0159099 | 3300044684 | Bacteria | 1375 |
| 263 | Ga0466961_0009410 | 3300044693 | Bacteria | 6221 |
| 264 | Ga0466961_0056479 | 3300044693 | Bacteria | 2501 |
| 265 | Ga0466961_0080533 | 3300044693 | Bacteria | 2061 |
| 266 | Ga0466961_0293735 | 3300044693 | Bacteria | 993 |
| 267 | Ga0466963_0009635 | 3300044694 | Bacteria | 5823 |
| 268 | Ga0466963_0019873 | 3300044694 | Bacteria | 4219 |
| 269 | Ga0466963_0026566 | 3300044694 | Bacteria | 3703 |
| 270 | Ga0466963_0061057 | 3300044694 | Bacteria | 2519 |
| 271 | Ga0466963_0203924 | 3300044694 | Bacteria | 1383 |
| 272 | Ga0466963_0352602 | 3300044694 | Bacteria | 1036 |
| 273 | Ga0466963_0464246 | 3300044694 | Bacteria | 893 |
| 274 | Ga0466964_0000816 | 3300044706 | Bacteria | 10197 |
| 275 | Ga0466964_0016897 | 3300044706 | Bacteria | 2790 |
| 276 | Ga0466964_0026131 | 3300044706 | Bacteria | 2284 |
| 277 | Ga0466971_0013457 | 3300044719 | Bacteria | 3595 |
| 278 | Ga0466971_0031222 | 3300044719 | Bacteria | 2385 |
| 279 | Ga0466971_0056576 | 3300044719 | Bacteria | 1769 |
| 280 | Ga0466968_0031788 | 3300044735 | Bacteria | 2192 |
| 281 | Ga0466970_0044372 | 3300044765 | Bacteria | 2367 |
| 282 | Ga0466970_0069313 | 3300044765 | Bacteria | 1895 |
| 283 | Ga0466957_0027238 | 3300044842 | Bacteria | 3395 |
| 284 | Ga0466957_0042779 | 3300044842 | Bacteria | 2741 |
| 285 | Ga0466957_0045603 | 3300044842 | Bacteria | 2659 |
| 286 | Ga0466960_0015448 | 3300044901 | Bacteria | 3291 |
| 287 | Ga0466960_0207327 | 3300044901 | Bacteria | 1073 |
| 288 | Ga0466959_0137822 | 3300045049 | Bacteria | 1726 |
| 289 | Ga0466958_0019128 | 3300045836 | Bacteria | 3984 |
| 290 | Ga0466958_0032372 | 3300045836 | Bacteria | 3110 |
| 291 | Ga0466958_0057283 | 3300045836 | Bacteria | 2368 |
| 292 | Ga0466958_0123455 | 3300045836 | Bacteria | 1622 |
| 293 | Ga0466958_0125739 | 3300045836 | Bacteria | 1607 |
| 294 | Ga0466958_0177408 | 3300045836 | Bacteria | 1351 |
| 295 | Ga0466967_0000184 | 3300045976 | Bacteria | 25866 |
| 296 | Ga0466967_0004866 | 3300045976 | Bacteria | 9170 |
| 297 | Ga0466967_0021072 | 3300045976 | Bacteria | 5282 |
| 298 | Ga0466967_0033405 | 3300045976 | Bacteria | 4355 |
| 299 | Ga0466967_0036728 | 3300045976 | Bacteria | 4185 |
| 300 | Ga0466967_0071032 | 3300045976 | Bacteria | 3116 |
| 301 | Ga0466967_0247056 | 3300045976 | Bacteria | 1703 |
| 302 | Ga0466967_0319504 | 3300045976 | Bacteria | 1497 |
| 303 | Ga0466967_0425619 | 3300045976 | Bacteria | 1295 |
| 304 | Ga0495617_012782 | 3300046452 | Bacteria | 2862 |
| 305 | Ga0495627_043789 | 3300046453 | Bacteria | 1368 |
| 306 | Ga0495592_0000025 | 3300046454 | Bacteria | 136324 |
| 307 | Ga0495592_0019855 | 3300046454 | Bacteria | 5109 |
| 308 | Ga0495603_0000942 | 3300046455 | Bacteria | 16736 |
| 309 | Ga0495603_0003385 | 3300046455 | Bacteria | 9496 |
| 310 | Ga0495603_0006063 | 3300046455 | Bacteria | 7229 |
| 311 | Ga0495603_0006479 | 3300046455 | Bacteria | 7011 |
| 312 | Ga0495603_0042449 | 3300046455 | Bacteria | 2718 |
| 313 | Ga0495590_0010403 | 3300046457 | Bacteria | 3500 |
| 314 | Ga0495629_0000666 | 3300046459 | Bacteria | 27787 |
| 315 | Ga0495629_0008880 | 3300046459 | Bacteria | 7390 |
| 316 | Ga0495629_0012169 | 3300046459 | Bacteria | 6234 |
| 317 | Ga0495629_0081444 | 3300046459 | Bacteria | 2259 |
| 318 | Ga0495629_0148539 | 3300046459 | Bacteria | 1629 |
| 319 | Ga0495629_0275487 | 3300046459 | Bacteria | 1155 |
| 320 | Ga0495638_0063743 | 3300046460 | Bacteria | 2271 |
| 321 | Ga0495638_0226928 | 3300046460 | Bacteria | 1041 |
| 322 | Ga0495651_0000014 | 3300046462 | Bacteria | 136312 |
| 323 | Ga0495651_0067958 | 3300046462 | Bacteria | 2717 |
| 324 | Ga0495653_0004684 | 3300046463 | Bacteria | 11067 |
| 325 | Ga0495605_0004741 | 3300046474 | Bacteria | 7952 |
| 326 | Ga0495639_0010582 | 3300046475 | Bacteria | 3972 |
| 327 | Ga0495639_0204204 | 3300046475 | Bacteria | 968 |
| 328 | Ga0495662_0038157 | 3300046476 | Bacteria | 2321 |
| 329 | Ga0495662_0056238 | 3300046476 | Bacteria | 1900 |
| 330 | Ga0495585_0043139 | 3300046492 | Bacteria | 2524 |
| 331 | Ga0495594_0013603 | 3300046499 | Bacteria | 4250 |
| 332 | Ga0495594_0076416 | 3300046499 | Bacteria | 1867 |
| 333 | Ga0495594_0083620 | 3300046499 | Bacteria | 1784 |
| 334 | Ga0495596_0044346 | 3300046500 | Bacteria | 1750 |
| 335 | Ga0495607_0041262 | 3300046501 | Bacteria | 2742 |
| 336 | Ga0495606_0006736 | 3300046507 | Bacteria | 10515 |
| 337 | Ga0495608_0000055 | 3300046511 | Bacteria | 93015 |
| 338 | Ga0495608_0113768 | 3300046511 | Bacteria | 1738 |
| 339 | Ga0495616_0003647 | 3300046513 | Bacteria | 9834 |
| 340 | Ga0495628_0000102 | 3300046516 | Bacteria | 68520 |
| 341 | Ga0495630_0340303 | 3300046517 | Bacteria | 1148 |
| 342 | Ga0495631_0004943 | 3300046518 | Bacteria | 7024 |
| 343 | Ga0495632_0155774 | 3300046519 | Bacteria | 1054 |
| 344 | Ga0495632_0176816 | 3300046519 | Bacteria | 979 |
| 345 | Ga0495637_0107972 | 3300046520 | Bacteria | 1081 |
| 346 | Ga0495643_0001437 | 3300046522 | Bacteria | 21986 |
| 347 | Ga0495643_0002988 | 3300046522 | Bacteria | 12777 |
| 348 | Ga0495648_0098666 | 3300046524 | Bacteria | 1617 |
| 349 | Ga0495652_0004463 | 3300046529 | Bacteria | 13363 |
| 350 | Ga0495587_0000029 | 3300046536 | Bacteria | 136321 |
| 351 | Ga0495609_0028621 | 3300046538 | Bacteria | 2542 |
| 352 | Ga0495597_0088188 | 3300046542 | Bacteria | 1319 |
| 353 | Ga0495622_0002415 | 3300046557 | Bacteria | 9079 |
| 354 | Ga0495622_0028338 | 3300046557 | Bacteria | 2615 |
| 355 | Ga0495633_0009359 | 3300046558 | Bacteria | 5418 |
| 356 | Ga0495667_0000036 | 3300046559 | Bacteria | 136146 |
| 357 | Ga0495667_0072804 | 3300046559 | Bacteria | 2239 |
| 358 | Ga0495668_0018178 | 3300046616 | Bacteria | 4065 |
| 359 | Ga0495634_0055061 | 3300046642 | Bacteria | 2661 |
| 360 | Ga0495611_0014917 | 3300046648 | Bacteria | 3319 |
| 361 | Ga0495611_0087777 | 3300046648 | Bacteria | 1435 |
| 362 | Ga0495611_0209154 | 3300046648 | Bacteria | 909 |
| 363 | Ga0495625_0043187 | 3300046660 | Bacteria | 3271 |
| 364 | Ga0495635_0080795 | 3300046663 | Bacteria | 2225 |
| 365 | Ga0495661_0019156 | 3300046665 | Bacteria | 4490 |
| 366 | Ga0495588_0005319 | 3300046674 | Bacteria | 5725 |
| 367 | Ga0495588_0075376 | 3300046674 | Bacteria | 1757 |
| 368 | Ga0495657_0000319 | 3300046675 | Bacteria | 44250 |
| 369 | Ga0495657_0003160 | 3300046675 | Bacteria | 13581 |
| 370 | Ga0495599_0000006 | 3300046678 | Bacteria | 283487 |
| 371 | Ga0495599_0149101 | 3300046678 | Bacteria | 1449 |
| 372 | Ga0495623_0000852 | 3300046679 | Bacteria | 20658 |
| 373 | Ga0495613_0115601 | 3300046689 | Bacteria | 1930 |
| 374 | Ga0495613_0157177 | 3300046689 | Bacteria | 1619 |
| 375 | Ga0495613_0203854 | 3300046689 | Bacteria | 1393 |
| 376 | Ga0495613_0280226 | 3300046689 | Bacteria | 1158 |
| 377 | Ga0495624_0130991 | 3300046690 | Bacteria | 1537 |
| 378 | Ga0495670_0120367 | 3300046691 | Bacteria | 1363 |
| 379 | Ga0495670_0211684 | 3300046691 | Bacteria | 1028 |
| 380 | Ga0495671_0022010 | 3300046692 | Bacteria | 3343 |
| 381 | Ga0495649_0015923 | 3300046694 | Bacteria | 4270 |
| 382 | Ga0495649_0132849 | 3300046694 | Bacteria | 1313 |
| 383 | Ga0495589_0020073 | 3300046794 | Bacteria | 3418 |
| 384 | Ga0495589_0043687 | 3300046794 | Bacteria | 2229 |
| 385 | Ga0495600_0075163 | 3300046809 | Bacteria | 2206 |
| 386 | Ga0495600_0358084 | 3300046809 | Bacteria | 913 |
| 387 | Ga0495581_0166233 | 3300047315 | Bacteria | 1290 |
| 388 | Ga0495604_0001010 | 3300047317 | Bacteria | 23432 |
| 389 | Ga0495604_0070818 | 3300047317 | Bacteria | 2639 |
| 390 | Ga0495636_0005508 | 3300047318 | Bacteria | 4969 |
| 391 | Ga0495636_0006017 | 3300047318 | Bacteria | 4760 |
| 392 | Ga0495636_0006557 | 3300047318 | Bacteria | 4574 |
| 393 | Ga0495636_0166035 | 3300047318 | Bacteria | 996 |
| 394 | Ga0495674_0263922 | 3300047319 | Bacteria | 1414 |
| 395 | Ga0495672_0071260 | 3300047320 | Bacteria | 1967 |
| 396 | Ga0495676_0004421 | 3300047321 | Bacteria | 12853 |
| 397 | Ga0495676_0007217 | 3300047321 | Bacteria | 10194 |
| 398 | Ga0495676_0034935 | 3300047321 | Bacteria | 4211 |
| 399 | Ga0495680_0000117 | 3300047322 | Bacteria | 76289 |
| 400 | Ga0495680_0027717 | 3300047322 | Bacteria | 4649 |
| 401 | Ga0495687_008131 | 3300047443 | Bacteria | 6052 |
| 402 | Ga0495687_009032 | 3300047443 | Bacteria | 5621 |
| 403 | Ga0495687_062714 | 3300047443 | Bacteria | 1524 |
| 404 | Ga0495675_0005582 | 3300047444 | Bacteria | 7677 |
| 405 | Ga0495675_0034028 | 3300047444 | Bacteria | 3252 |
| 406 | Ga0495677_0101604 | 3300047445 | Bacteria | 1089 |
| 407 | Ga0495677_0142813 | 3300047445 | Bacteria | 919 |
| 408 | Ga0495685_000398 | 3300047447 | Bacteria | 13796 |
| 409 | Ga0495685_030716 | 3300047447 | Bacteria | 1847 |
| 410 | Ga0495673_0071475 | 3300047469 | Bacteria | 1459 |
| 411 | Ga0495681_0002268 | 3300047470 | Bacteria | 13832 |
| 412 | Ga0495681_0007946 | 3300047470 | Bacteria | 6699 |
| 413 | Ga0495681_0064993 | 3300047470 | Bacteria | 1669 |
| 414 | Ga0495686_0131468 | 3300047472 | Bacteria | 1483 |
| 415 | Ga0495602_0008141 | 3300048088 | Bacteria | 10945 |
| 416 | Ga0495614_0001460 | 3300048089 | Bacteria | 10221 |
| 417 | Ga0495614_0048231 | 3300048089 | Bacteria | 1826 |
| 418 | Ga0495614_0049344 | 3300048089 | Bacteria | 1804 |
| 419 | Ga0495614_0065879 | 3300048089 | Bacteria | 1558 |
| 420 | Ga0495614_0114676 | 3300048089 | Bacteria | 1184 |
| 421 | Ga0495626_0014277 | 3300048091 | Bacteria | 4102 |
| 422 | Ga0496100_0232895 | 3300048903 | Bacteria | 1356 |
| 423 | Ga0496102_0012617 | 3300048905 | Bacteria | 7319 |
| 424 | Ga0496104_0007571 | 3300048907 | Bacteria | 9608 |
| 425 | Ga0496104_0019746 | 3300048907 | Bacteria | 6169 |
| 426 | Ga0496104_0117917 | 3300048907 | Bacteria | 2547 |
| 427 | Ga0496105_0016494 | 3300048908 | Bacteria | 5899 |
| 428 | Ga0496105_0024100 | 3300048908 | Bacteria | 4942 |
| 429 | Ga0496105_0084531 | 3300048908 | Bacteria | 2621 |
| 430 | Ga0496107_0132239 | 3300048910 | Bacteria | 1842 |
| 431 | Ga0496107_0150240 | 3300048910 | Bacteria | 1723 |
| 432 | Ga0496108_0007825 | 3300048911 | Bacteria | 8661 |
| 433 | Ga0496108_0146559 | 3300048911 | Bacteria | 2035 |
| 434 | Ga0496108_0385386 | 3300048911 | Bacteria | 1224 |
| 435 | Ga0496109_0021077 | 3300048912 | Bacteria | 5763 |
| 436 | Ga0496109_0040765 | 3300048912 | Bacteria | 4206 |
| 437 | Ga0496109_0295242 | 3300048912 | Bacteria | 1528 |
| 438 | Ga0496110_0032602 | 3300048913 | Bacteria | 4501 |
| 439 | Ga0496110_0098021 | 3300048913 | Bacteria | 2626 |
| 440 | Ga0496112_0122871 | 3300048915 | Bacteria | 2566 |
| 441 | Ga0496112_0368410 | 3300048915 | Bacteria | 1378 |
| 442 | Ga0496113_0002281 | 3300048916 | Bacteria | 11069 |
| 443 | Ga0496113_0614099 | 3300048916 | Bacteria | 870 |
| 444 | Ga0496115_0101298 | 3300048918 | Bacteria | 2361 |
| 445 | Ga0496119_0001193 | 3300048922 | Bacteria | 32523 |
| 446 | Ga0496120_0019811 | 3300048923 | Bacteria | 4291 |
| 447 | Ga0495678_024644 | 3300049459 | Bacteria | 2595 |
| 448 | Ga0501031_0003628 | 3300049568 | Bacteria | 9933 |
| 449 | Ga0501032_0002891 | 3300049569 | Bacteria | 13354 |
| 450 | Ga0501032_0093750 | 3300049569 | Bacteria | 1991 |
| 451 | Ga0501033_0007128 | 3300049570 | Bacteria | 8724 |
| 452 | Ga0501033_0039007 | 3300049570 | Bacteria | 3548 |
| 453 | Ga0501033_0084822 | 3300049570 | Bacteria | 2321 |
| 454 | Ga0501033_0099496 | 3300049570 | Bacteria | 2123 |
| 455 | Ga0501033_0108476 | 3300049570 | Bacteria | 2022 |
| 456 | Ga0501034_0003111 | 3300049571 | Bacteria | 19126 |
| 457 | Ga0501034_0011530 | 3300049571 | Bacteria | 9158 |
| 458 | Ga0501034_0038283 | 3300049571 | Bacteria | 4857 |
| 459 | Ga0501034_0045311 | 3300049571 | Bacteria | 4445 |
| 460 | Ga0501034_0083394 | 3300049571 | Bacteria | 3198 |
| 461 | Ga0501036_0001833 | 3300049572 | Bacteria | 16501 |
| 462 | Ga0501036_0002710 | 3300049572 | Bacteria | 13988 |
| 463 | Ga0501036_0005689 | 3300049572 | Bacteria | 10114 |
| 464 | Ga0501036_0017323 | 3300049572 | Bacteria | 6021 |
| 465 | Ga0501036_0191115 | 3300049572 | Bacteria | 1722 |
| 466 | Ga0501037_0003656 | 3300049573 | Bacteria | 11158 |
| 467 | Ga0501037_0022883 | 3300049573 | Bacteria | 4621 |
| 468 | Ga0501038_0005910 | 3300049574 | Bacteria | 11311 |
| 469 | Ga0501038_0009008 | 3300049574 | Bacteria | 9159 |
| 470 | Ga0501038_0016504 | 3300049574 | Bacteria | 6693 |
| 471 | Ga0501038_0084612 | 3300049574 | Bacteria | 2668 |
| 472 | Ga0501039_0046359 | 3300049575 | Bacteria | 3358 |
| 473 | Ga0501039_0343275 | 3300049575 | Bacteria | 1173 |
| 474 | Ga0501039_0585412 | 3300049575 | Bacteria | 875 |
| 475 | Ga0501040_0004768 | 3300049576 | Bacteria | 8795 |
| 476 | Ga0501042_0000316 | 3300049578 | Bacteria | 24201 |
| 477 | Ga0501042_0032483 | 3300049578 | Bacteria | 3696 |
| 478 | Ga0501042_0166868 | 3300049578 | Bacteria | 1588 |
| 479 | Ga0501043_0000948 | 3300049579 | Bacteria | 25739 |
| 480 | Ga0501043_0006631 | 3300049579 | Bacteria | 9261 |
| 481 | Ga0501043_0043640 | 3300049579 | Bacteria | 3524 |
| 482 | Ga0501043_0055481 | 3300049579 | Bacteria | 3113 |
| 483 | Ga0501043_0392454 | 3300049579 | Bacteria | 1049 |
| 484 | Ga0501047_0011570 | 3300049581 | Bacteria | 8349 |
| 485 | Ga0501048_0007895 | 3300049582 | Bacteria | 8059 |
| 486 | Ga0501048_0027267 | 3300049582 | Bacteria | 4154 |
| 487 | Ga0501048_0183903 | 3300049582 | Bacteria | 1481 |
| 488 | Ga0501067_0055362 | 3300049583 | Bacteria | 2198 |
| 489 | Ga0501070_0022271 | 3300049586 | Bacteria | 5309 |
| 490 | Ga0501070_0143517 | 3300049586 | Bacteria | 1971 |
| 491 | Ga0501070_0176299 | 3300049586 | Bacteria | 1760 |
| 492 | Ga0501072_0005844 | 3300049588 | Bacteria | 9375 |
| 493 | Ga0501073_0525187 | 3300049589 | Bacteria | 818 |
| 494 | Ga0501074_0005511 | 3300049590 | Bacteria | 9107 |
| 495 | Ga0501074_0139161 | 3300049590 | Bacteria | 1736 |
| 496 | Ga0501076_0000957 | 3300049592 | Bacteria | 18872 |
| 497 | Ga0501079_0114668 | 3300049741 | Bacteria | 2094 |
| 498 | Ga0501079_0394942 | 3300049741 | Bacteria | 1085 |
| 499 | Ga0501080_0263596 | 3300049742 | Bacteria | 1569 |
| 500 | Ga0501081_0021363 | 3300049743 | Bacteria | 4319 |
| 501 | Ga0501081_0189671 | 3300049743 | Bacteria | 1488 |
| 502 | Ga0501035_0005137 | 3300049822 | Bacteria | 12386 |
| 503 | Ga0501035_0033368 | 3300049822 | Bacteria | 4682 |
| 504 | Ga0501035_0040949 | 3300049822 | Bacteria | 4184 |
| 505 | Ga0501035_0062954 | 3300049822 | Bacteria | 3300 |
| 506 | Ga0501035_0117999 | 3300049822 | Bacteria | 2322 |
| 507 | Ga0501035_0126155 | 3300049822 | Bacteria | 2234 |
| 508 | Ga0501044_0006572 | 3300049823 | Bacteria | 12839 |
| 509 | Ga0501044_0101311 | 3300049823 | Bacteria | 2897 |
| 510 | Ga0501044_0139417 | 3300049823 | Bacteria | 2414 |
| 511 | Ga0501044_0385753 | 3300049823 | Bacteria | 1315 |
| 512 | Ga0501044_0442331 | 3300049823 | Bacteria | 1207 |
| 513 | Ga0501045_0090840 | 3300049824 | Bacteria | 2257 |
| 514 | nmdc:mga0yw44_200915_c1 | 3300050492 | Bacteria | 1316 |
| 515 | nmdc:mga06z11_4065_c1 | 3300050494 | Bacteria | 5718 |
| 516 | nmdc:mga04h51_25220_c1 | 3300050495 | Bacteria | 1828 |
| 517 | nmdc:mga05p37_123536_c1 | 3300050507 | Bacteria | 3180 |
| 518 | nmdc:mga05p37_224670_c1 | 3300050507 | Bacteria | 2264 |
| 519 | nmdc:mga05p37_372922_c1 | 3300050507 | Bacteria | 1674 |
| 520 | nmdc:mga09592_205672_c1 | 3300050508 | Bacteria | 1705 |
| 521 | nmdc:mga06r32_3633_c1 | 3300050510 | Bacteria | 13772 |
| 522 | nmdc:mga08y16_175936_c1 | 3300050511 | Bacteria | 2222 |
| 523 | nmdc:mga0n895_142738_c1 | 3300050512 | Bacteria | 2424 |
| 524 | nmdc:mga0a205_260040_c1 | 3300050515 | Bacteria | 1614 |
| 525 | Ga0495612_0041308 | 3300053078 | Bacteria | 1881 |
| 526 | Ga0495655_0048196 | 3300053083 | Bacteria | 1117 |
| 527 | Ga0495595_0001781 | 3300053084 | Bacteria | 8401 |
| 528 | Ga0500578_0014450 | 3300053086 | Bacteria | 5075 |
| 529 | Ga0500583_0052093 | 3300053092 | Bacteria | 1904 |
| 530 | Ga0500566_0071602 | 3300053094 | Bacteria | 1945 |
| 531 | Ga0500641_0045666 | 3300053096 | Bacteria | 1785 |
| 532 | Ga0500654_018344 | 3300053099 | Bacteria | 4545 |
| 533 | Ga0500660_124265 | 3300053100 | Bacteria | 1066 |
| 534 | Ga0500553_152121 | 3300053101 | Bacteria | 888 |
| 535 | Ga0500580_072681 | 3300053113 | Bacteria | 1412 |
| 536 | Ga0500614_027383 | 3300053123 | Bacteria | 1369 |
| 537 | Ga0500652_095795 | 3300053131 | Bacteria | 1239 |
| 538 | Ga0500658_0007775 | 3300053134 | Bacteria | 3959 |
| 539 | Ga0500561_0001350 | 3300053137 | Bacteria | 3986 |
| 540 | Ga0500573_0015109 | 3300053140 | Bacteria | 4374 |
| 541 | Ga0500588_0008282 | 3300053146 | Bacteria | 2423 |
| 542 | Ga0500600_0068915 | 3300053149 | Bacteria | 1945 |
| 543 | Ga0500616_0062643 | 3300053153 | Bacteria | 1920 |
| 544 | Ga0500627_0170673 | 3300053158 | Bacteria | 980 |
| 545 | Ga0500633_0002033 | 3300053160 | Bacteria | 4044 |
| 546 | Ga0500633_0056884 | 3300053160 | Bacteria | 1366 |
| 547 | Ga0500634_0108311 | 3300053161 | Bacteria | 1376 |
| 548 | Ga0500656_004474 | 3300053732 | Bacteria | 1350 |
| 549 | Ga0500587_001783 | 3300053739 | Bacteria | 3059 |
| 550 | Ga0501084_0007270 | 3300054114 | Bacteria | 9126 |
| 551 | Ga0501082_0097829 | 3300060353 | Bacteria | 2537 |
| 552 | Ga0466962_0049165 | 3300061719 | Bacteria | 2016 |
| 553 | 2547406452 | 2547132111 | Bacteria | 8013147 |
| 554 | 2554258600 | 2554235005 | Bacteria | 6457341 |
| 555 | 2554259619 | 2554235005 | Bacteria | 6457341 |
| 556 | 2585300928 | 2582581312 | Bacteria | 7308206 |
| 557 | 2585303445 | 2582581313 | Bacteria | 10042643 |
| 558 | 2585316918 | 2582581314 | Bacteria | 11452267 |
| 559 | 2616695531 | 2616644814 | Bacteria | 11555299 |
| 560 | 2616906184 | 2616644941 | Bacteria | 8510691 |
| 561 | 2643760308 | 2643221548 | Bacteria | 8053412 |
| 562 | 2643849904 | 2643221567 | Bacteria | 4163945 |
| 563 | 2643904417 | 2643221578 | Bacteria | 9213798 |
| 564 | 2644135906 | 2643221624 | Bacteria | 4384879 |
| 565 | 2644179535 | 2643221631 | Bacteria | 8168043 |
| 566 | 2644267938 | 2643221647 | Bacteria | 10741251 |
| 567 | 2644406315 | 2643221673 | Bacteria | 9196637 |
| 568 | 2644443613 | 2643221678 | Bacteria | 9540101 |
| 569 | 2644459995 | 2643221682 | Bacteria | 6743283 |
| 570 | 2644632458 | 2643221714 | Bacteria | 9015452 |
| 571 | 2753073180 | 2751185734 | Bacteria | 8863695 |
| 572 | 2785345816 | 2784746763 | Bacteria | 9783172 |
| 573 | 2785367071 | 2784746768 | Bacteria | 10036182 |
| 574 | 2786668110 | 2786546132 | Bacteria | 10419719 |
| 575 | 2799186383 | 2799112218 | Bacteria | 4315149 |
| 576 | 2808847575 | 2808606359 | Bacteria | 9866990 |
| 577 | 2808918308 | 2808606375 | Bacteria | 9466072 |
| 578 | 2811846889 | 2808606982 | Bacteria | 7791042 |
| 579 | 2812360391 | 2811994879 | Bacteria | 9313447 |
| 580 | 2816426040 | 2816332119 | Bacteria | 8120218 |
| 581 | 2816510236 | 2816332139 | Bacteria | 9138787 |
| 582 | 2819699814 | 2818991463 | Bacteria | 7948711 |
| 583 | 2837273822 | 2837268691 | Bacteria | 7850704 |
| 584 | 2852637638 | 2852635781 | Bacteria | 8251373 |
| 585 | 2862289743 | 2862281513 | Bacteria | 9621493 |
| 586 | 2862383674 | 2862382967 | Bacteria | 10317375 |
| 587 | 2862510347 | 2862507626 | Bacteria | 9425308 |
| 588 | 2862583795 | 2862574272 | Bacteria | 10567477 |
| 589 | 2863407049 | 2863404153 | Bacteria | 9672205 |
| 590 | 2867434252 | 2867428634 | Bacteria | 9590268 |
| 591 | 2867479264 | 2867475112 | Bacteria | 6909112 |
| 592 | 2873157754 | 2873151551 | Bacteria | 8625867 |
| 593 | 2875392623 | 2875391855 | Bacteria | 7600475 |
| 594 | 2912722581 | 2912715099 | Bacteria | 9460473 |
| 595 | 2912726267 | 2912723979 | Bacteria | 8557534 |
| 596 | 2919472269 | 2919468124 | Bacteria | 9133025 |
| 597 | 2946052093 | 2946045630 | Bacteria | 8527308 |
| 598 | 2946065498 | 2946064051 | Bacteria | 8957905 |
| 599 | 2946073852 | 2946072368 | Bacteria | 8999607 |
| 600 | 2947231912 | 2947224130 | Bacteria | 9938529 |
| 601 | 2954011154 | 2954002825 | Bacteria | 9173742 |
| 602 | 2954388728 | 2954380949 | Bacteria | 10050426 |
| 603 | 2954674398 | 2954673503 | Bacteria | 9685905 |
| 604 | 2954689733 | 2954682443 | Bacteria | 9862841 |
| 605 | 2954699516 | 2954691527 | Bacteria | 10720516 |
| 606 | 2954702702 | 2954701450 | Bacteria | 10834262 |
| 607 | 2954718455 | 2954711539 | Bacteria | 10867210 |
| 608 | 2954728425 | 2954721474 | Bacteria | 10456478 |
| 609 | 2954733384 | 2954731030 | Bacteria | 10243860 |
| 610 | 2954747321 | 2954740390 | Bacteria | 10229294 |
| 611 | 2954752267 | 2954749733 | Bacteria | 10366972 |
| 612 | 2966604511 | 2966598605 | Bacteria | 7676064 |
| 613 | 2990059657 | 2990059506 | Bacteria | 9321252 |
| 614 | 2990091134 | 2990088156 | Bacteria | 6657676 |
| 615 | 3006487440 | 3006486233 | Bacteria | 8157040 |
| 616 | 8008486878 | 8008485437 | Bacteria | 7198341 |
| 617 | 8008561232 | 8008558824 | Bacteria | 10610750 |
| 618 | 8025414885 | 8025413630 | Bacteria | 7014048 |
| 619 | 8025526135 | 8025524527 | Bacteria | 7197316 |
| 620 | 8025535396 | 8025530807 | Bacteria | 8495698 |
| 621 | 8033685515 | 8033684223 | Bacteria | 6906479 |
| 622 | 8048408090 | 8048406513 | Bacteria | 8936924 |
| 623 | 8054162087 | 8054160619 | Bacteria | 7783213 |
| 624 | 8055162683 | 8055157932 | Bacteria | 6429399 |
| 625 | 8056669570 | 8056667051 | Bacteria | 6953971 |
| 626 | 8056835792 | 8056829672 | Bacteria | 9045328 |
| 627 | Ga0496105_0599463 | |||
| 628 | JGI24735J21928_10061776 | |||
| 629 | rootH1_10008653 | |||
| 630 | rootL2_10020556 | |||
| 631 | JGI25160J50197_1016844 | |||
| 632 | Ga0006562J51391_1102868 | |||
| 633 | Ga0070658_10000677 | |||
| 634 | Ga0070660_100160255 | |||
| 635 | Ga0070667_100690369 | |||
| 636 | Ga0070709_10006485 | |||
| 637 | Ga0070714_100000002 | |||
| 638 | Ga0070714_100001182 | |||
| 639 | Ga0070713_100035240 | |||
| 640 | Ga0070713_100076323 | |||
| 641 | Ga0070713_100094701 | |||
| 642 | Ga0070713_100313334 | |||
| 643 | Ga0070710_10019284 | |||
| 644 | Ga0070700_100000072 | |||
| 645 | Ga0070708_100032555 | |||
| 646 | Ga0070708_100033754 | |||
| 647 | Ga0070706_100002091 | |||
| 648 | Ga0070706_100002349 | |||
| 649 | Ga0070706_100005716 | |||
| 650 | Ga0070706_100462369 | |||
| 651 | Ga0070707_100001004 | |||
| 652 | Ga0070707_100003928 | |||
| 653 | Ga0070707_100012739 | |||
| 654 | Ga0070698_100000637 | |||
| 655 | Ga0070698_100001515 | |||
| 656 | Ga0070698_100001711 | |||
| 657 | Ga0070698_100061633 | |||
| 658 | Ga0070679_100047535 | |||
| 659 | Ga0070684_100079493 | |||
| 660 | Ga0070697_100015965 | |||
| 661 | Ga0070697_100023402 | |||
| 662 | Ga0068853_100006392 | |||
| 663 | Ga0070672_100215790 | |||
| 664 | Ga0070696_100013349 | |||
| 665 | Ga0070696_100017170 | |||
| 666 | Ga0070704_100021974 | |||
| 667 | Ga0068855_100050257 | |||
| 668 | Ga0068855_100248898 | |||
| 669 | Ga0068855_100608856 | |||
| 670 | Ga0070664_100181796 | |||
| 671 | Ga0068857_100486208 | |||
| 672 | Ga0068854_100585294 | |||
| 673 | Ga0068856_100153437 | |||
| 674 | Ga0068852_100008381 | |||
| 675 | Ga0068852_100118577 | |||
| 676 | Ga0068859_100005559 | |||
| 677 | Ga0068864_100001246 | |||
| 678 | Ga0068863_100033398 | |||
| 679 | Ga0068858_100386258 | |||
| 680 | Ga0081538_10000016 | |||
| 681 | Ga0081540_1001512 | |||
| 682 | Ga0070717_10011636 | |||
| 683 | Ga0070717_10028408 | |||
| 684 | Ga0070717_10039201 | |||
| 685 | Ga0070717_10057152 | |||
| 686 | Ga0075365_10128166 | |||
| 687 | Ga0075363_100026941 | |||
| 688 | Ga0075432_10026398 | |||
| 689 | Ga0070712_100033504 | |||
| 690 | Ga0070712_100146736 | |||
| 691 | Ga0075367_10001282 | |||
| 692 | Ga0075428_100197641 | |||
| 693 | Ga0075429_100632464 | |||
| 694 | Ga0075436_100072030 | |||
| 695 | Ga0097620_100005559 | |||
| 696 | Ga0099826_10061147 | |||
| 697 | Ga0075435_100389050 | |||
| 698 | Ga0105240_10012952 | |||
| 699 | Ga0111539_10139586 | |||
| 700 | Ga0105245_10041510 | |||
| 701 | Ga0105245_10109397 | |||
| 702 | Ga0105245_10783582 | |||
| 703 | Ga0114129_10142368 | |||
| 704 | Ga0105241_10029549 | |||
| 705 | Ga0105241_10060165 | |||
| 706 | Ga0105241_10249598 | |||
| 707 | Ga0105248_10422949 | |||
| 708 | Ga0105248_10515278 | |||
| 709 | Ga0105237_10006081 | |||
| 710 | Ga0105237_10713174 | |||
| 711 | Ga0105238_10028580 | |||
| 712 | Ga0105246_10054690 | |||
| 713 | Ga0157370_10000875 | |||
| 714 | Ga0157369_10060040 | |||
| 715 | Ga0157369_10060175 | |||
| 716 | Ga0157374_10206269 | |||
| 717 | Ga0157374_10715648 | |||
| 718 | Ga0157372_10227571 | |||
| 719 | Ga0157372_10551176 | |||
| 720 | Ga0157375_10566930 | |||
| 721 | Ga0157375_10717214 | |||
| 722 | Ga0163163_10028049 | |||
| 723 | Ga0163163_10064075 | |||
| 724 | Ga0163163_10336218 | |||
| 725 | Ga0182007_10000166 | |||
| 726 | Ga0183367_1017 | |||
| 727 | Ga0197907_11057858 | |||
| 728 | Ga0197907_11476537 | |||
| 729 | Ga0206349_1459813 | |||
| 730 | Ga0206350_10732310 | |||
| 731 | Ga0206354_10304190 | |||
| 732 | Ga0206353_10352472 | |||
| 733 | Ga0206353_10636788 | |||
| 734 | Ga0206353_10986400 | |||
| 735 | Ga0213876_10052438 | |||
| 736 | Ga0213875_10058102 | |||
| 737 | Ga0224712_10019050 | |||
| 738 | Ga0224712_10047061 | |||
| 739 | Ga0224712_10061124 | |||
| 740 | Ga0224572_1000548 | |||
| 741 | Ga0209758_1003531 | |||
| 742 | Ga0207426_1000643 | |||
| 743 | Ga0207426_1003231 | |||
| 744 | Ga0207426_1013430 | |||
| 745 | Ga0207426_1021292 | |||
| 746 | Ga0207692_10014932 | |||
| 747 | Ga0207710_10004454 | |||
| 748 | Ga0207699_10035919 | |||
| 749 | Ga0207705_10004269 | |||
| 750 | Ga0207684_10002360 | |||
| 751 | Ga0207684_10006588 | |||
| 752 | Ga0207684_10377484 | |||
| 753 | Ga0207654_10038553 | |||
| 754 | Ga0207695_10287711 | |||
| 755 | Ga0207671_10008914 | |||
| 756 | Ga0207693_10294402 | |||
| 757 | Ga0207663_10039815 | |||
| 758 | Ga0207652_10536072 | |||
| 759 | Ga0207646_10000544 | |||
| 760 | Ga0207646_10008213 | |||
| 761 | Ga0207646_10072169 | |||
| 762 | Ga0207687_10024077 | |||
| 763 | Ga0207700_10015521 | |||
| 764 | Ga0207700_10159095 | |||
| 765 | Ga0207700_10604903 | |||
| 766 | Ga0207664_10000038 | |||
| 767 | Ga0207664_10009968 | |||
| 768 | Ga0207664_10472206 | |||
| 769 | Ga0207665_10406979 | |||
| 770 | Ga0207711_10217994 | |||
| 771 | Ga0207661_10340743 | |||
| 772 | Ga0207667_10097483 | |||
| 773 | Ga0207667_10342436 | |||
| 774 | Ga0207667_10409487 | |||
| 775 | Ga0207667_10543195 | |||
| 776 | Ga0207703_10354333 | |||
| 777 | Ga0207639_10015349 | |||
| 778 | Ga0207708_10000023 | |||
| 779 | Ga0207708_10131913 | |||
| 780 | Ga0207702_10083627 | |||
| 781 | Ga0207702_10149223 | |||
| 782 | Ga0207676_10019388 | |||
| 783 | Ga0207674_10554656 | |||
| 784 | Ga0207698_10066734 | |||
| 785 | Ga0209371_1034207 | |||
| 786 | Ga0209282_1048740 | |||
| 787 | Ga0209813_10067141 | |||
| 788 | Ga0307515_10009395 | |||
| 789 | Ga0307515_10140063 | |||
| 790 | Ga0307515_10233747 | |||
| 791 | Ga0307511_10000410 | |||
| 792 | Ga0307511_10015650 | |||
| 793 | Ga0307511_10046036 | |||
| 794 | Ga0307512_10002135 | |||
| 795 | Ga0307512_10021907 | |||
| 796 | Ga0307513_10052390 | |||
| 797 | Ga0307509_10166344 | |||
| 798 | Ga0307508_10024914 | |||
| 799 | Ga0307508_10225231 | |||
| 800 | Ga0307514_10004854 | |||
| 801 | Ga0307514_10015345 | |||
| 802 | Ga0316576_10000270 | |||
| 803 | Ga0316576_10018290 | |||
| 804 | Ga0307516_10011429 | |||
| 805 | Ga0307516_10280546 | |||
| 806 | Ga0307405_10003123 | |||
| 807 | Ga0307413_10259827 | |||
| 808 | Ga0307410_10065150 | |||
| 809 | Ga0307410_10111003 | |||
| 810 | Ga0307409_100003337 | |||
| 811 | Ga0307416_100001296 | |||
| 812 | Ga0307416_100226077 | |||
| 813 | Ga0307416_100380457 | |||
| 814 | Ga0307415_100000260 | |||
| 815 | Ga0307415_100095637 | |||
| 816 | Ga0307415_100131151 | |||
| 817 | Ga0307507_10120829 | |||
| 818 | Ga0307507_10231552 | |||
| 819 | Ga0307510_10056448 | |||
| 820 | Ga0373948_0010364 | |||
| 821 | Ga0373950_0007304 | |||
| 822 | Ga0373959_0008854 | |||
| 823 | Ga0373938_0036541 | |||
| 824 | Ga0373928_0004634 | |||
| 825 | Ga0373929_0019788 | |||
| 826 | Ga0373934_0001411 | |||
| 827 | Ga0373940_0014329 | |||
| 828 | Ga0373923_0029446 | |||
| 829 | Ga0373939_0010717 | |||
| 830 | Ga0373941_0016515 | |||
| 831 | Ga0373953_0000268 | |||
| 832 | Ga0373954_0001771 | |||
| 833 | Ga0373956_0002251 | |||
| 834 | Ga0373946_0193481 | |||
| 835 | Ga0373955_0000016 | |||
| 836 | Ga0373962_0014421 | |||
| 837 | Ga0373924_0000752 | |||
| 838 | Ga0373927_0017018 | |||
| 839 | Ga0373933_0000001 | |||
| 840 | Ga0373937_0003722 | |||
| 841 | Ga0316584_0007960 | |||
| 842 | Ga0395900_0177367 | |||
| 843 | Ga0395900_0547115 | |||
| 844 | Ga0395900_0573274 | |||
| 845 | Ga0395898_0018140 | |||
| 846 | Ga0436364_0819810 | |||
| 847 | Ga0436364_0911612 | |||
| 848 | Ga0395901_0381100 | |||
| 849 | Ga0436365_1298945 | |||
| 850 | Ga0436363_0412211 | |||
| 851 | Ga0439436_0016730 | |||
| 852 | Ga0439439_0013511 | |||
| 853 | Ga0451793_0478337 | |||
| 854 | Ga0451795_1417318 | |||
| 855 | Ga0451853_1859136 | |||
| 856 | Ga0439433_0005340 | |||
| 857 | Ga0439448_0009516 | |||
| 858 | Ga0439448_0020807 | |||
| 859 | Ga0439449_0001268 | |||
| 860 | Ga0439450_019828 | |||
| 861 | Ga0439454_004515 | |||
| 862 | Ga0439455_0041912 | |||
| 863 | Ga0439457_000025 | |||
| 864 | Ga0439457_003276 | |||
| 865 | Ga0439463_032717 | |||
| 866 | Ga0450890_009948 | |||
| 867 | Ga0450894_000356 | |||
| 868 | Ga0450896_000092 | |||
| 869 | Ga0450898_000154 | |||
| 870 | Ga0450899_000359 | |||
| 871 | Ga0450900_018926 | |||
| 872 | Ga0450903_000014 | |||
| 873 | Ga0450906_000431 | |||
| 874 | Ga0450907_013450 | |||
| 875 | Ga0439458_0003690 | |||
| 876 | Ga0439458_0005624 | |||
| 877 | Ga0466969_0033688 | |||
| 878 | Ga0466972_0002210 | |||
| 879 | Ga0466972_0006993 | |||
| 880 | Ga0466972_0041761 | |||
| 881 | Ga0466972_0159789 | |||
| 882 | Ga0466965_0066143 | |||
| 883 | Ga0466965_0179896 | |||
| 884 | Ga0466965_0257605 | |||
| 885 | Ga0466966_0005225 | |||
| 886 | Ga0466966_0068619 | |||
| 887 | Ga0466966_0074846 | |||
| 888 | Ga0466966_0159099 | |||
| 889 | Ga0466961_0009410 | |||
| 890 | Ga0466961_0056479 | |||
| 891 | Ga0466961_0080533 | |||
| 892 | Ga0466961_0293735 | |||
| 893 | Ga0466963_0009635 | |||
| 894 | Ga0466963_0019873 | |||
| 895 | Ga0466963_0026566 | |||
| 896 | Ga0466963_0061057 | |||
| 897 | Ga0466963_0203924 | |||
| 898 | Ga0466963_0352602 | |||
| 899 | Ga0466963_0464246 | |||
| 900 | Ga0466964_0000816 | |||
| 901 | Ga0466964_0016897 | |||
| 902 | Ga0466964_0026131 | |||
| 903 | Ga0466971_0013457 | |||
| 904 | Ga0466971_0031222 | |||
| 905 | Ga0466971_0056576 | |||
| 906 | Ga0466968_0031788 | |||
| 907 | Ga0466970_0044372 | |||
| 908 | Ga0466970_0069313 | |||
| 909 | Ga0466957_0027238 | |||
| 910 | Ga0466957_0042779 | |||
| 911 | Ga0466957_0045603 | |||
| 912 | Ga0466960_0015448 | |||
| 913 | Ga0466960_0207327 | |||
| 914 | Ga0466959_0137822 | |||
| 915 | Ga0466958_0019128 | |||
| 916 | Ga0466958_0032372 | |||
| 917 | Ga0466958_0057283 | |||
| 918 | Ga0466958_0123455 | |||
| 919 | Ga0466958_0125739 | |||
| 920 | Ga0466958_0177408 | |||
| 921 | Ga0466967_0000184 | |||
| 922 | Ga0466967_0004866 | |||
| 923 | Ga0466967_0021072 | |||
| 924 | Ga0466967_0033405 | |||
| 925 | Ga0466967_0036728 | |||
| 926 | Ga0466967_0071032 | |||
| 927 | Ga0466967_0247056 | |||
| 928 | Ga0466967_0319504 | |||
| 929 | Ga0466967_0425619 | |||
| 930 | Ga0495617_012782 | |||
| 931 | Ga0495627_043789 | |||
| 932 | Ga0495592_0000025 | |||
| 933 | Ga0495592_0019855 | |||
| 934 | Ga0495603_0000942 | |||
| 935 | Ga0495603_0003385 | |||
| 936 | Ga0495603_0006063 | |||
| 937 | Ga0495603_0006479 | |||
| 938 | Ga0495603_0042449 | |||
| 939 | Ga0495590_0010403 | |||
| 940 | Ga0495629_0000666 | |||
| 941 | Ga0495629_0008880 | |||
| 942 | Ga0495629_0012169 | |||
| 943 | Ga0495629_0081444 | |||
| 944 | Ga0495629_0148539 | |||
| 945 | Ga0495629_0275487 | |||
| 946 | Ga0495638_0063743 | |||
| 947 | Ga0495638_0226928 | |||
| 948 | Ga0495651_0000014 | |||
| 949 | Ga0495651_0067958 | |||
| 950 | Ga0495653_0004684 | |||
| 951 | Ga0495605_0004741 | |||
| 952 | Ga0495639_0010582 | |||
| 953 | Ga0495639_0204204 | |||
| 954 | Ga0495662_0038157 | |||
| 955 | Ga0495662_0056238 | |||
| 956 | Ga0495585_0043139 | |||
| 957 | Ga0495594_0013603 | |||
| 958 | Ga0495594_0076416 | |||
| 959 | Ga0495594_0083620 | |||
| 960 | Ga0495596_0044346 | |||
| 961 | Ga0495607_0041262 | |||
| 962 | Ga0495606_0006736 | |||
| 963 | Ga0495608_0000055 | |||
| 964 | Ga0495608_0113768 | |||
| 965 | Ga0495616_0003647 | |||
| 966 | Ga0495628_0000102 | |||
| 967 | Ga0495630_0340303 | |||
| 968 | Ga0495631_0004943 | |||
| 969 | Ga0495632_0155774 | |||
| 970 | Ga0495632_0176816 | |||
| 971 | Ga0495637_0107972 | |||
| 972 | Ga0495643_0001437 | |||
| 973 | Ga0495643_0002988 | |||
| 974 | Ga0495648_0098666 | |||
| 975 | Ga0495652_0004463 | |||
| 976 | Ga0495587_0000029 | |||
| 977 | Ga0495609_0028621 | |||
| 978 | Ga0495597_0088188 | |||
| 979 | Ga0495622_0002415 | |||
| 980 | Ga0495622_0028338 | |||
| 981 | Ga0495633_0009359 | |||
| 982 | Ga0495667_0000036 | |||
| 983 | Ga0495667_0072804 | |||
| 984 | Ga0495668_0018178 | |||
| 985 | Ga0495634_0055061 | |||
| 986 | Ga0495611_0014917 | |||
| 987 | Ga0495611_0087777 | |||
| 988 | Ga0495611_0209154 | |||
| 989 | Ga0495625_0043187 | |||
| 990 | Ga0495635_0080795 | |||
| 991 | Ga0495661_0019156 | |||
| 992 | Ga0495588_0005319 | |||
| 993 | Ga0495588_0075376 | |||
| 994 | Ga0495657_0000319 | |||
| 995 | Ga0495657_0003160 | |||
| 996 | Ga0495599_0000006 | |||
| 997 | Ga0495599_0149101 | |||
| 998 | Ga0495623_0000852 | |||
| 999 | Ga0495613_0115601 | |||
| 1000 | Ga0495613_0157177 | |||
| 1001 | Ga0495613_0203854 | |||
| 1002 | Ga0495613_0280226 | |||
| 1003 | Ga0495624_0130991 | |||
| 1004 | Ga0495670_0120367 | |||
| 1005 | Ga0495670_0211684 | |||
| 1006 | Ga0495671_0022010 | |||
| 1007 | Ga0495649_0015923 | |||
| 1008 | Ga0495649_0132849 | |||
| 1009 | Ga0495589_0020073 | |||
| 1010 | Ga0495589_0043687 | |||
| 1011 | Ga0495600_0075163 | |||
| 1012 | Ga0495600_0358084 | |||
| 1013 | Ga0495581_0166233 | |||
| 1014 | Ga0495604_0001010 | |||
| 1015 | Ga0495604_0070818 | |||
| 1016 | Ga0495636_0005508 | |||
| 1017 | Ga0495636_0006017 | |||
| 1018 | Ga0495636_0006557 | |||
| 1019 | Ga0495636_0166035 | |||
| 1020 | Ga0495674_0263922 | |||
| 1021 | Ga0495672_0071260 | |||
| 1022 | Ga0495676_0004421 | |||
| 1023 | Ga0495676_0007217 | |||
| 1024 | Ga0495676_0034935 | |||
| 1025 | Ga0495680_0000117 | |||
| 1026 | Ga0495680_0027717 | |||
| 1027 | Ga0495687_008131 | |||
| 1028 | Ga0495687_009032 | |||
| 1029 | Ga0495687_062714 | |||
| 1030 | Ga0495675_0005582 | |||
| 1031 | Ga0495675_0034028 | |||
| 1032 | Ga0495677_0101604 | |||
| 1033 | Ga0495677_0142813 | |||
| 1034 | Ga0495685_000398 | |||
| 1035 | Ga0495685_030716 | |||
| 1036 | Ga0495673_0071475 | |||
| 1037 | Ga0495681_0002268 | |||
| 1038 | Ga0495681_0007946 | |||
| 1039 | Ga0495681_0064993 | |||
| 1040 | Ga0495686_0131468 | |||
| 1041 | Ga0495602_0008141 | |||
| 1042 | Ga0495614_0001460 | |||
| 1043 | Ga0495614_0048231 | |||
| 1044 | Ga0495614_0049344 | |||
| 1045 | Ga0495614_0065879 | |||
| 1046 | Ga0495614_0114676 | |||
| 1047 | Ga0495626_0014277 | |||
| 1048 | Ga0496100_0232895 | |||
| 1049 | Ga0496102_0012617 | |||
| 1050 | Ga0496104_0007571 | |||
| 1051 | Ga0496104_0019746 | |||
| 1052 | Ga0496104_0117917 | |||
| 1053 | Ga0496105_0016494 | |||
| 1054 | Ga0496105_0024100 | |||
| 1055 | Ga0496105_0084531 | |||
| 1056 | Ga0496107_0132239 | |||
| 1057 | Ga0496107_0150240 | |||
| 1058 | Ga0496108_0007825 | |||
| 1059 | Ga0496108_0146559 | |||
| 1060 | Ga0496108_0385386 | |||
| 1061 | Ga0496109_0021077 | |||
| 1062 | Ga0496109_0040765 | |||
| 1063 | Ga0496109_0295242 | |||
| 1064 | Ga0496110_0032602 | |||
| 1065 | Ga0496110_0098021 | |||
| 1066 | Ga0496112_0122871 | |||
| 1067 | Ga0496112_0368410 | |||
| 1068 | Ga0496113_0002281 | |||
| 1069 | Ga0496113_0614099 | |||
| 1070 | Ga0496115_0101298 | |||
| 1071 | Ga0496119_0001193 | |||
| 1072 | Ga0496120_0019811 | |||
| 1073 | Ga0495678_024644 | |||
| 1074 | Ga0501031_0003628 | |||
| 1075 | Ga0501032_0002891 | |||
| 1076 | Ga0501032_0093750 | |||
| 1077 | Ga0501033_0007128 | |||
| 1078 | Ga0501033_0039007 | |||
| 1079 | Ga0501033_0084822 | |||
| 1080 | Ga0501033_0099496 | |||
| 1081 | Ga0501033_0108476 | |||
| 1082 | Ga0501034_0003111 | |||
| 1083 | Ga0501034_0011530 | |||
| 1084 | Ga0501034_0038283 | |||
| 1085 | Ga0501034_0045311 | |||
| 1086 | Ga0501034_0083394 | |||
| 1087 | Ga0501036_0001833 | |||
| 1088 | Ga0501036_0002710 | |||
| 1089 | Ga0501036_0005689 | |||
| 1090 | Ga0501036_0017323 | |||
| 1091 | Ga0501036_0191115 | |||
| 1092 | Ga0501037_0003656 | |||
| 1093 | Ga0501037_0022883 | |||
| 1094 | Ga0501038_0005910 | |||
| 1095 | Ga0501038_0009008 | |||
| 1096 | Ga0501038_0016504 | |||
| 1097 | Ga0501038_0084612 | |||
| 1098 | Ga0501039_0046359 | |||
| 1099 | Ga0501039_0343275 | |||
| 1100 | Ga0501039_0585412 | |||
| 1101 | Ga0501040_0004768 | |||
| 1102 | Ga0501042_0000316 | |||
| 1103 | Ga0501042_0032483 | |||
| 1104 | Ga0501042_0166868 | |||
| 1105 | Ga0501043_0000948 | |||
| 1106 | Ga0501043_0006631 | |||
| 1107 | Ga0501043_0043640 | |||
| 1108 | Ga0501043_0055481 | |||
| 1109 | Ga0501043_0392454 | |||
| 1110 | Ga0501047_0011570 | |||
| 1111 | Ga0501048_0007895 | |||
| 1112 | Ga0501048_0027267 | |||
| 1113 | Ga0501048_0183903 | |||
| 1114 | Ga0501067_0055362 | |||
| 1115 | Ga0501070_0022271 | |||
| 1116 | Ga0501070_0143517 | |||
| 1117 | Ga0501070_0176299 | |||
| 1118 | Ga0501072_0005844 | |||
| 1119 | Ga0501073_0525187 | |||
| 1120 | Ga0501074_0005511 | |||
| 1121 | Ga0501074_0139161 | |||
| 1122 | Ga0501076_0000957 | |||
| 1123 | Ga0501079_0114668 | |||
| 1124 | Ga0501079_0394942 | |||
| 1125 | Ga0501080_0263596 | |||
| 1126 | Ga0501081_0021363 | |||
| 1127 | Ga0501081_0189671 | |||
| 1128 | Ga0501035_0005137 | |||
| 1129 | Ga0501035_0033368 | |||
| 1130 | Ga0501035_0040949 | |||
| 1131 | Ga0501035_0062954 | |||
| 1132 | Ga0501035_0117999 | |||
| 1133 | Ga0501035_0126155 | |||
| 1134 | Ga0501044_0006572 | |||
| 1135 | Ga0501044_0101311 | |||
| 1136 | Ga0501044_0139417 | |||
| 1137 | Ga0501044_0385753 | |||
| 1138 | Ga0501044_0442331 | |||
| 1139 | Ga0501045_0090840 | |||
| 1140 | nmdc:mga0yw44_200915_c1 | |||
| 1141 | nmdc:mga06z11_4065_c1 | |||
| 1142 | nmdc:mga04h51_25220_c1 | |||
| 1143 | nmdc:mga05p37_123536_c1 | |||
| 1144 | nmdc:mga05p37_224670_c1 | |||
| 1145 | nmdc:mga05p37_372922_c1 | |||
| 1146 | nmdc:mga09592_205672_c1 | |||
| 1147 | nmdc:mga06r32_3633_c1 | |||
| 1148 | nmdc:mga08y16_175936_c1 | |||
| 1149 | nmdc:mga0n895_142738_c1 | |||
| 1150 | nmdc:mga0a205_260040_c1 | |||
| 1151 | Ga0495612_0041308 | |||
| 1152 | Ga0495655_0048196 | |||
| 1153 | Ga0495595_0001781 | |||
| 1154 | Ga0500578_0014450 | |||
| 1155 | Ga0500583_0052093 | |||
| 1156 | Ga0500566_0071602 | |||
| 1157 | Ga0500641_0045666 | |||
| 1158 | Ga0500654_018344 | |||
| 1159 | Ga0500660_124265 | |||
| 1160 | Ga0500553_152121 | |||
| 1161 | Ga0500580_072681 | |||
| 1162 | Ga0500614_027383 | |||
| 1163 | Ga0500652_095795 | |||
| 1164 | Ga0500658_0007775 | |||
| 1165 | Ga0500561_0001350 | |||
| 1166 | Ga0500573_0015109 | |||
| 1167 | Ga0500588_0008282 | |||
| 1168 | Ga0500600_0068915 | |||
| 1169 | Ga0500616_0062643 | |||
| 1170 | Ga0500627_0170673 | |||
| 1171 | Ga0500633_0002033 | |||
| 1172 | Ga0500633_0056884 | |||
| 1173 | Ga0500634_0108311 | |||
| 1174 | Ga0500656_004474 | |||
| 1175 | Ga0500587_001783 | |||
| 1176 | Ga0501084_0007270 | |||
| 1177 | Ga0501082_0097829 | |||
| 1178 | Ga0466962_0049165 | |||
| 1179 | 2547406452 | |||
| 1180 | 2554258600 | |||
| 1181 | 2554259619 | |||
| 1182 | 2585300928 | |||
| 1183 | 2585303445 | |||
| 1184 | 2585316918 | |||
| 1185 | 2616695531 | |||
| 1186 | 2616906184 | |||
| 1187 | 2643760308 | |||
| 1188 | 2643849904 | |||
| 1189 | 2643904417 | |||
| 1190 | 2644135906 | |||
| 1191 | 2644179535 | |||
| 1192 | 2644267938 | |||
| 1193 | 2644406315 | |||
| 1194 | 2644443613 | |||
| 1195 | 2644459995 | |||
| 1196 | 2644632458 | |||
| 1197 | 2753073180 | |||
| 1198 | 2785345816 | |||
| 1199 | 2785367071 | |||
| 1200 | 2786668110 | |||
| 1201 | 2799186383 | |||
| 1202 | 2808847575 | |||
| 1203 | 2808918308 | |||
| 1204 | 2811846889 | |||
| 1205 | 2812360391 | |||
| 1206 | 2816426040 | |||
| 1207 | 2816510236 | |||
| 1208 | 2819699814 | |||
| 1209 | 2837273822 | |||
| 1210 | 2852637638 | |||
| 1211 | 2862289743 | |||
| 1212 | 2862383674 | |||
| 1213 | 2862510347 | |||
| 1214 | 2862583795 | |||
| 1215 | 2863407049 | |||
| 1216 | 2867434252 | |||
| 1217 | 2867479264 | |||
| 1218 | 2873157754 | |||
| 1219 | 2875392623 | |||
| 1220 | 2912722581 | |||
| 1221 | 2912726267 | |||
| 1222 | 2919472269 | |||
| 1223 | 2946052093 | |||
| 1224 | 2946065498 | |||
| 1225 | 2946073852 | |||
| 1226 | 2947231912 | |||
| 1227 | 2954011154 | |||
| 1228 | 2954388728 | |||
| 1229 | 2954674398 | |||
| 1230 | 2954689733 | |||
| 1231 | 2954699516 | |||
| 1232 | 2954702702 | |||
| 1233 | 2954718455 | |||
| 1234 | 2954728425 | |||
| 1235 | 2954733384 | |||
| 1236 | 2954747321 | |||
| 1237 | 2954752267 | |||
| 1238 | 2966604511 | |||
| 1239 | 2990059657 | |||
| 1240 | 2990091134 | |||
| 1241 | 3006487440 | |||
| 1242 | 8008486878 | |||
| 1243 | 8008561232 | |||
| 1244 | 8025414885 | |||
| 1245 | 8025526135 | |||
| 1246 | 8025535396 | |||
| 1247 | 8033685515 | |||
| 1248 | 8048408090 | |||
| 1249 | 8054162087 | |||
| 1250 | 8055162683 | |||
| 1251 | 8056669570 | |||
| 1252 | 8056835792 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5mm1-assembly1.cif.gz_A | dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose | 0.8172 | 10 | 249 |
| 5mm0-assembly1.cif.gz_A | dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) | 0.8124 | 9 | 249 |
| 5eke-assembly1.cif.gz_A | structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) | 0.7808 | 5 | 210 |
| 5mm0-assembly1.cif.gz_A | dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) | 0.7731 | 9 | 249 |
| 5ekp-assembly1.cif.gz_A | structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) | 0.7685 | 5 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53493_586_855_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9557 | 4 | 253 | 3.90.550.10 |
| af_O53493_586_855_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9409 | 4 | 253 | 3.90.550.10 |
| af_A4ICW5_2_228_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8821 | 10 | 233 | 3.90.550.10 |
| af_Q57964_2_229_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8768 | 13 | 239 | 3.90.550.10 |
| af_Q58619_2_238_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8744 | 11 | 233 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2C8B7B8-F1-model_v4 | ApolipoproteiN n-acyltransferase Lnt/dolichol-phosphate-mannosyl transferase Dpm1 | 0.988 | 9 | 252 |
GO:0004582
GO:0009247 GO:0016020 GO:0016746 |
| AF-A0A1W9GKS7-F1-model_v4 | Glycosyltransferase 2-like domain-containing protein | 0.9877 | 12 | 239 |
GO:0004582
GO:0009247 GO:0016020 |
| AF-A0A7V9KKX8-F1-model_v4 | Polyprenol monophosphomannose synthase | 0.9869 | 5 | 203 |
GO:0004582
GO:0009247 GO:0016020 |
| AF-A0A5J4KNB5-F1-model_v4 | Dolichol-phosphate mannosyltransferase | 0.9865 | 10 | 240 |
GO:0004582
GO:0009247 GO:0016020 |
| AF-A0A7I8EGP5-F1-model_v4 | Dolichyl-phosphate beta-D-mannosyltransferase | 0.9857 | 10 | 239 |
GO:0004582
GO:0009247 GO:0016020 |