F470499

General Info

Members Datasets Scaffolds Average Seq Length
626 403 1252 257

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0599463|Ga0496105_0599463_60_818
Length 252
Sequence VNDGDGTLAAEAQGRRFGPLGTALVIIPTYNEAENIKKIVGRVRSAVPEAHVLVADDNSPDGTGKLADELAADDENVQVLHRKGKEGLGAAYLAGFRWGLEHGYGVLIEMDADGSHQPEELPRLLTALKGADLVLGSRWVPGGRVVNWPKSREFISRGGSLYSRVLLAFRRETLEGLGLGEVASQGYCFQVDLARRAVKAGYHVVEVPITFVERELGDSKMSRDILVEALWRVTTWGVGERVGRLTARRKQS

Samples

Sample ID Description Type Environment
1 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
67 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
106 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
109 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
112 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
113 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
114 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
123 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
124 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
125 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
126 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
127 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
128 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
129 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
130 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
131 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
132 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
134 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
135 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
136 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
141 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
152 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
153 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
154 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
155 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
158 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
159 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
160 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
161 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
162 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
163 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
164 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
165 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
166 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
167 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
168 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
169 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
170 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
171 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
172 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
173 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
174 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
191 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
205 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
206 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
212 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
213 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
214 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
215 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
219 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
220 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
228 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
229 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
237 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
238 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
245 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
246 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
247 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
248 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
249 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
250 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
251 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
252 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
253 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
254 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
255 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
256 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
261 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
268 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
269 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
270 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
286 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
289 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
290 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
291 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
295 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
296 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
297 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
304 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
305 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
306 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
307 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
308 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
309 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
310 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
311 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
312 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
313 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
314 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
315 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
316 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
317 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
318 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
319 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
320 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
321 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
322 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
323 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
324 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
325 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
326 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
327 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
328 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
329 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
330 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
331 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
332 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
333 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
334 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
335 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
336 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
337 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
338 2643221548 Streptomyces sp. Root55 Isolate Unclassified
339 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
340 2643221578 Streptomyces sp. Root63 Isolate Unclassified
341 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
342 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
343 2643221647 Streptomyces sp. Root369 Isolate Unclassified
344 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
345 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
346 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
347 2643221714 Streptomyces sp. Root264 Isolate Unclassified
348 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
349 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
350 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
351 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
352 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
353 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
354 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
355 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
356 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
357 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
358 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
359 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
360 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
361 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
362 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
363 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
364 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
365 2862574272 Streptomyces sp. AcE210 Isolate Nodule
366 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
367 2867428634 Streptomyces sp. RP5T Isolate Unclassified
368 2867475112 Streptomyces sp. TM32 Isolate Unclassified
369 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
370 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
371 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
372 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
373 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
374 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
375 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
376 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
377 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
378 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
379 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
380 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
381 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
382 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
383 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
384 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
385 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
386 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
387 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
388 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
389 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
390 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
391 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
392 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
393 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
394 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
395 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
396 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
397 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
398 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
399 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
400 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
401 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
402 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
403 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.26
Metatranscriptomes 1.92
Isolates 11.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.59
Nodule 0.96
Rhizoplane 4.15
Rhizosphere 79.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496105_0599463 3300048908 Bacteria 855
2 JGI24735J21928_10061776 3300002067 Bacteria 1076
3 rootH1_10008653 3300003316 Bacteria 2382
4 rootL2_10020556 3300003322 Bacteria 5416
5 JGI25160J50197_1016844 3300003354 Bacteria 2339
6 Ga0006562J51391_1102868 3300003578 Bacteria 2040
7 Ga0070658_10000677 3300005327 Bacteria 29445
8 Ga0070660_100160255 3300005339 Bacteria 1813
9 Ga0070667_100690369 3300005367 Bacteria 944
10 Ga0070709_10006485 3300005434 Bacteria 6378
11 Ga0070714_100000002 3300005435 Bacteria 386673
12 Ga0070714_100001182 3300005435 Bacteria 18802
13 Ga0070713_100035240 3300005436 Bacteria 4027
14 Ga0070713_100076323 3300005436 Bacteria 2845
15 Ga0070713_100094701 3300005436 Bacteria 2575
16 Ga0070713_100313334 3300005436 Bacteria 1447
17 Ga0070710_10019284 3300005437 Bacteria 3522
18 Ga0070700_100000072 3300005441 Bacteria 71205
19 Ga0070708_100032555 3300005445 Bacteria 4524
20 Ga0070708_100033754 3300005445 Bacteria 4446
21 Ga0070706_100002091 3300005467 Bacteria 20346
22 Ga0070706_100002349 3300005467 Bacteria 19092
23 Ga0070706_100005716 3300005467 Bacteria 11827
24 Ga0070706_100462369 3300005467 Bacteria 1180
25 Ga0070707_100001004 3300005468 Bacteria 27958
26 Ga0070707_100003928 3300005468 Bacteria 13990
27 Ga0070707_100012739 3300005468 Bacteria 7852
28 Ga0070698_100000637 3300005471 Bacteria 37691
29 Ga0070698_100001515 3300005471 Bacteria 25747
30 Ga0070698_100001711 3300005471 Bacteria 24475
31 Ga0070698_100061633 3300005471 Bacteria 3785
32 Ga0070679_100047535 3300005530 Bacteria 4276
33 Ga0070684_100079493 3300005535 Bacteria 2899
34 Ga0070697_100015965 3300005536 Bacteria 5903
35 Ga0070697_100023402 3300005536 Bacteria 4911
36 Ga0068853_100006392 3300005539 Bacteria 9360
37 Ga0070672_100215790 3300005543 Bacteria 1608
38 Ga0070696_100013349 3300005546 Bacteria 5512
39 Ga0070696_100017170 3300005546 Bacteria 4884
40 Ga0070704_100021974 3300005549 Bacteria 4146
41 Ga0068855_100050257 3300005563 Bacteria 4914
42 Ga0068855_100248898 3300005563 Bacteria 1983
43 Ga0068855_100608856 3300005563 Bacteria 1177
44 Ga0070664_100181796 3300005564 Bacteria 1869
45 Ga0068857_100486208 3300005577 Bacteria 1157
46 Ga0068854_100585294 3300005578 Bacteria 951
47 Ga0068856_100153437 3300005614 Bacteria 2313
48 Ga0068852_100008381 3300005616 Bacteria 7618
49 Ga0068852_100118577 3300005616 Bacteria 2419
50 Ga0068859_100005559 3300005617 Bacteria 12838
51 Ga0068864_100001246 3300005618 Bacteria 21141
52 Ga0068863_100033398 3300005841 Bacteria 4901
53 Ga0068858_100386258 3300005842 Bacteria 1344
54 Ga0081538_10000016 3300005981 Bacteria 147022
55 Ga0081540_1001512 3300005983 Bacteria 19996
56 Ga0070717_10011636 3300006028 Bacteria 6692
57 Ga0070717_10028408 3300006028 Bacteria 4477
58 Ga0070717_10039201 3300006028 Bacteria 3854
59 Ga0070717_10057152 3300006028 Bacteria 3225
60 Ga0075365_10128166 3300006038 Bacteria 1755
61 Ga0075363_100026941 3300006048 Bacteria 2944
62 Ga0075432_10026398 3300006058 Bacteria 1995
63 Ga0070712_100033504 3300006175 Bacteria 3477
64 Ga0070712_100146736 3300006175 Bacteria 1806
65 Ga0075367_10001282 3300006178 Bacteria 10633
66 Ga0075428_100197641 3300006844 Bacteria 2175
67 Ga0075429_100632464 3300006880 Bacteria 938
68 Ga0075436_100072030 3300006914 Bacteria 2390
69 Ga0097620_100005559 3300006931 Bacteria 12838
70 Ga0099826_10061147 3300006948 Bacteria 2449
71 Ga0075435_100389050 3300007076 Bacteria 1198
72 Ga0105240_10012952 3300009093 Bacteria 11487
73 Ga0111539_10139586 3300009094 Bacteria 2838
74 Ga0105245_10041510 3300009098 Bacteria 4101
75 Ga0105245_10109397 3300009098 Bacteria 2568
76 Ga0105245_10783582 3300009098 Bacteria 991
77 Ga0114129_10142368 3300009147 Bacteria 3286
78 Ga0105241_10029549 3300009174 Bacteria 4091
79 Ga0105241_10060165 3300009174 Bacteria 2921
80 Ga0105241_10249598 3300009174 Bacteria 1504
81 Ga0105248_10422949 3300009177 Bacteria 1500
82 Ga0105248_10515278 3300009177 Bacteria 1348
83 Ga0105237_10006081 3300009545 Bacteria 13504
84 Ga0105237_10713174 3300009545 Bacteria 1010
85 Ga0105238_10028580 3300009551 Bacteria 5680
86 Ga0105246_10054690 3300011119 Bacteria 2752
87 Ga0157370_10000875 3300013104 Bacteria 38190
88 Ga0157369_10060040 3300013105 Bacteria 4101
89 Ga0157369_10060175 3300013105 Bacteria 4096
90 Ga0157374_10206269 3300013296 Bacteria 1926
91 Ga0157374_10715648 3300013296 Bacteria 1015
92 Ga0157372_10227571 3300013307 Bacteria 2162
93 Ga0157372_10551176 3300013307 Bacteria 1344
94 Ga0157375_10566930 3300013308 Bacteria 1296
95 Ga0157375_10717214 3300013308 Bacteria 1153
96 Ga0163163_10028049 3300014325 Bacteria 5401
97 Ga0163163_10064075 3300014325 Bacteria 3647
98 Ga0163163_10336218 3300014325 Bacteria 1565
99 Ga0182007_10000166 3300015262 Bacteria 45125
100 Ga0183367_1017 3300015688 Bacteria 126691
101 Ga0197907_11057858 3300020069 Bacteria 2027
102 Ga0197907_11476537 3300020069 Bacteria 1819
103 Ga0206349_1459813 3300020075 Bacteria 2016
104 Ga0206350_10732310 3300020080 Bacteria 2007
105 Ga0206354_10304190 3300020081 Bacteria 2050
106 Ga0206353_10352472 3300020082 Bacteria 3155
107 Ga0206353_10636788 3300020082 Bacteria 2006
108 Ga0206353_10986400 3300020082 Bacteria 2749
109 Ga0213876_10052438 3300021384 Bacteria 2156
110 Ga0213875_10058102 3300021388 Bacteria 1811
111 Ga0224712_10019050 3300022467 Bacteria 2307
112 Ga0224712_10047061 3300022467 Bacteria 1658
113 Ga0224712_10061124 3300022467 Bacteria 1501
114 Ga0224572_1000548 3300024225 Bacteria 4587
115 Ga0209758_1003531 3300025297 Bacteria 14099
116 Ga0207426_1000643 3300025302 Bacteria 43590
117 Ga0207426_1003231 3300025302 Bacteria 9142
118 Ga0207426_1013430 3300025302 Bacteria 3035
119 Ga0207426_1021292 3300025302 Bacteria 2242
120 Ga0207692_10014932 3300025898 Bacteria 3405
121 Ga0207710_10004454 3300025900 Bacteria 6111
122 Ga0207699_10035919 3300025906 Bacteria 2822
123 Ga0207705_10004269 3300025909 Bacteria 10824
124 Ga0207684_10002360 3300025910 Bacteria 19118
125 Ga0207684_10006588 3300025910 Bacteria 10563
126 Ga0207684_10377484 3300025910 Bacteria 1219
127 Ga0207654_10038553 3300025911 Bacteria 2682
128 Ga0207695_10287711 3300025913 Bacteria 1536
129 Ga0207671_10008914 3300025914 Bacteria 8448
130 Ga0207693_10294402 3300025915 Bacteria 1272
131 Ga0207663_10039815 3300025916 Bacteria 2851
132 Ga0207652_10536072 3300025921 Bacteria 1053
133 Ga0207646_10000544 3300025922 Bacteria 49768
134 Ga0207646_10008213 3300025922 Bacteria 10490
135 Ga0207646_10072169 3300025922 Bacteria 3083
136 Ga0207687_10024077 3300025927 Bacteria 4063
137 Ga0207700_10015521 3300025928 Bacteria 5027
138 Ga0207700_10159095 3300025928 Bacteria 1874
139 Ga0207700_10604903 3300025928 Bacteria 976
140 Ga0207664_10000038 3300025929 Bacteria 166264
141 Ga0207664_10009968 3300025929 Bacteria 6694
142 Ga0207664_10472206 3300025929 Bacteria 1121
143 Ga0207665_10406979 3300025939 Bacteria 1037
144 Ga0207711_10217994 3300025941 Bacteria 1744
145 Ga0207661_10340743 3300025944 Bacteria 1351
146 Ga0207667_10097483 3300025949 Bacteria 3035
147 Ga0207667_10342436 3300025949 Bacteria 1526
148 Ga0207667_10409487 3300025949 Bacteria 1380
149 Ga0207667_10543195 3300025949 Bacteria 1176
150 Ga0207703_10354333 3300026035 Bacteria 1352
151 Ga0207639_10015349 3300026041 Bacteria 5403
152 Ga0207708_10000023 3300026075 Bacteria 176615
153 Ga0207708_10131913 3300026075 Bacteria 1954
154 Ga0207702_10083627 3300026078 Bacteria 2777
155 Ga0207702_10149223 3300026078 Bacteria 2125
156 Ga0207676_10019388 3300026095 Bacteria 4962
157 Ga0207674_10554656 3300026116 Bacteria 1110
158 Ga0207698_10066734 3300026142 Bacteria 2833
159 Ga0209371_1034207 3300027312 Bacteria 1079
160 Ga0209282_1048740 3300027666 Bacteria 2449
161 Ga0209813_10067141 3300027866 Bacteria 1158
162 Ga0307515_10009395 3300028794 Bacteria 18921
163 Ga0307515_10140063 3300028794 Bacteria 2601
164 Ga0307515_10233747 3300028794 Bacteria 1624
165 Ga0307511_10000410 3300030521 Bacteria 45774
166 Ga0307511_10015650 3300030521 Bacteria 7340
167 Ga0307511_10046036 3300030521 Bacteria 3595
168 Ga0307512_10002135 3300030522 Bacteria 25918
169 Ga0307512_10021907 3300030522 Bacteria 5753
170 Ga0307513_10052390 3300031456 Bacteria 4395
171 Ga0307509_10166344 3300031507 Bacteria 2093
172 Ga0307508_10024914 3300031616 Bacteria 5427
173 Ga0307508_10225231 3300031616 Bacteria 1474
174 Ga0307514_10004854 3300031649 Bacteria 12229
175 Ga0307514_10015345 3300031649 Bacteria 6324
176 Ga0316576_10000270 3300031727 Bacteria 22702
177 Ga0316576_10018290 3300031727 Bacteria 4781
178 Ga0307516_10011429 3300031730 Bacteria 9644
179 Ga0307516_10280546 3300031730 Bacteria 1348
180 Ga0307405_10003123 3300031731 Bacteria 7528
181 Ga0307413_10259827 3300031824 Bacteria 1294
182 Ga0307410_10065150 3300031852 Bacteria 2506
183 Ga0307410_10111003 3300031852 Bacteria 1984
184 Ga0307409_100003337 3300031995 Bacteria 8689
185 Ga0307416_100001296 3300032002 Bacteria 13482
186 Ga0307416_100226077 3300032002 Bacteria 1800
187 Ga0307416_100380457 3300032002 Bacteria 1441
188 Ga0307415_100000260 3300032126 Bacteria 22804
189 Ga0307415_100095637 3300032126 Bacteria 2163
190 Ga0307415_100131151 3300032126 Bacteria 1898
191 Ga0307507_10120829 3300033179 Bacteria 2096
192 Ga0307507_10231552 3300033179 Bacteria 1224
193 Ga0307510_10056448 3300033180 Bacteria 4089
194 Ga0373948_0010364 3300034817 Bacteria 1626
195 Ga0373950_0007304 3300034818 Bacteria 1712
196 Ga0373959_0008854 3300034820 Bacteria 1723
197 Ga0373938_0036541 3300034957 Bacteria 1075
198 Ga0373928_0004634 3300035084 Bacteria 2620
199 Ga0373929_0019788 3300035085 Bacteria 1351
200 Ga0373934_0001411 3300035086 Bacteria 8784
201 Ga0373940_0014329 3300035088 Bacteria 1932
202 Ga0373923_0029446 3300035111 Bacteria 2202
203 Ga0373939_0010717 3300035114 Bacteria 2299
204 Ga0373941_0016515 3300035115 Bacteria 2008
205 Ga0373953_0000268 3300035117 Bacteria 14200
206 Ga0373954_0001771 3300035118 Bacteria 8872
207 Ga0373956_0002251 3300035119 Bacteria 7946
208 Ga0373946_0193481 3300035171 Bacteria 971
209 Ga0373955_0000016 3300035172 Bacteria 71862
210 Ga0373962_0014421 3300035242 Bacteria 2014
211 Ga0373924_0000752 3300035410 Bacteria 10094
212 Ga0373927_0017018 3300035695 Bacteria 4790
213 Ga0373933_0000001 3300035724 Bacteria 228234
214 Ga0373937_0003722 3300036401 Bacteria 12886
215 Ga0316584_0007960 3300036712 Bacteria 7272
216 Ga0395900_0177367 3300037418 Bacteria 2167
217 Ga0395900_0547115 3300037418 Bacteria 1103
218 Ga0395900_0573274 3300037418 Bacteria 1071
219 Ga0395898_0018140 3300037466 Bacteria 7182
220 Ga0436364_0819810 3300037853 Bacteria 1454
221 Ga0436364_0911612 3300037853 Bacteria 5012
222 Ga0395901_0381100 3300038443 Bacteria 1451
223 Ga0436365_1298945 3300039437 Bacteria 5479
224 Ga0436363_0412211 3300039450 Bacteria 1042
225 Ga0439436_0016730 3300041404 Bacteria 2198
226 Ga0439439_0013511 3300041406 Bacteria 1979
227 Ga0451793_0478337 3300041452 Bacteria 1706
228 Ga0451795_1417318 3300041456 Bacteria 1016
229 Ga0451853_1859136 3300041512 Bacteria 2903
230 Ga0439433_0005340 3300041999 Bacteria 2758
231 Ga0439448_0009516 3300042005 Bacteria 2867
232 Ga0439448_0020807 3300042005 Bacteria 2033
233 Ga0439449_0001268 3300042007 Bacteria 9896
234 Ga0439450_019828 3300042008 Bacteria 1429
235 Ga0439454_004515 3300042011 Bacteria 1610
236 Ga0439455_0041912 3300042012 Bacteria 1175
237 Ga0439457_000025 3300042014 Bacteria 30691
238 Ga0439457_003276 3300042014 Bacteria 4433
239 Ga0439463_032717 3300042016 Bacteria 1314
240 Ga0450890_009948 3300042127 Bacteria 1222
241 Ga0450894_000356 3300042131 Bacteria 8039
242 Ga0450896_000092 3300042133 Bacteria 6296
243 Ga0450898_000154 3300042134 Bacteria 6958
244 Ga0450899_000359 3300042135 Bacteria 5064
245 Ga0450900_018926 3300042136 Bacteria 947
246 Ga0450903_000014 3300042138 Bacteria 34118
247 Ga0450906_000431 3300042145 Bacteria 8701
248 Ga0450907_013450 3300042146 Bacteria 1363
249 Ga0439458_0003690 3300042157 Bacteria 3553
250 Ga0439458_0005624 3300042157 Bacteria 2813
251 Ga0466969_0033688 3300044656 Bacteria 2599
252 Ga0466972_0002210 3300044658 Bacteria 9550
253 Ga0466972_0006993 3300044658 Bacteria 5659
254 Ga0466972_0041761 3300044658 Bacteria 2232
255 Ga0466972_0159789 3300044658 Bacteria 1059
256 Ga0466965_0066143 3300044683 Bacteria 1812
257 Ga0466965_0179896 3300044683 Bacteria 1115
258 Ga0466965_0257605 3300044683 Bacteria 937
259 Ga0466966_0005225 3300044684 Bacteria 8534
260 Ga0466966_0068619 3300044684 Bacteria 2226
261 Ga0466966_0074846 3300044684 Bacteria 2116
262 Ga0466966_0159099 3300044684 Bacteria 1375
263 Ga0466961_0009410 3300044693 Bacteria 6221
264 Ga0466961_0056479 3300044693 Bacteria 2501
265 Ga0466961_0080533 3300044693 Bacteria 2061
266 Ga0466961_0293735 3300044693 Bacteria 993
267 Ga0466963_0009635 3300044694 Bacteria 5823
268 Ga0466963_0019873 3300044694 Bacteria 4219
269 Ga0466963_0026566 3300044694 Bacteria 3703
270 Ga0466963_0061057 3300044694 Bacteria 2519
271 Ga0466963_0203924 3300044694 Bacteria 1383
272 Ga0466963_0352602 3300044694 Bacteria 1036
273 Ga0466963_0464246 3300044694 Bacteria 893
274 Ga0466964_0000816 3300044706 Bacteria 10197
275 Ga0466964_0016897 3300044706 Bacteria 2790
276 Ga0466964_0026131 3300044706 Bacteria 2284
277 Ga0466971_0013457 3300044719 Bacteria 3595
278 Ga0466971_0031222 3300044719 Bacteria 2385
279 Ga0466971_0056576 3300044719 Bacteria 1769
280 Ga0466968_0031788 3300044735 Bacteria 2192
281 Ga0466970_0044372 3300044765 Bacteria 2367
282 Ga0466970_0069313 3300044765 Bacteria 1895
283 Ga0466957_0027238 3300044842 Bacteria 3395
284 Ga0466957_0042779 3300044842 Bacteria 2741
285 Ga0466957_0045603 3300044842 Bacteria 2659
286 Ga0466960_0015448 3300044901 Bacteria 3291
287 Ga0466960_0207327 3300044901 Bacteria 1073
288 Ga0466959_0137822 3300045049 Bacteria 1726
289 Ga0466958_0019128 3300045836 Bacteria 3984
290 Ga0466958_0032372 3300045836 Bacteria 3110
291 Ga0466958_0057283 3300045836 Bacteria 2368
292 Ga0466958_0123455 3300045836 Bacteria 1622
293 Ga0466958_0125739 3300045836 Bacteria 1607
294 Ga0466958_0177408 3300045836 Bacteria 1351
295 Ga0466967_0000184 3300045976 Bacteria 25866
296 Ga0466967_0004866 3300045976 Bacteria 9170
297 Ga0466967_0021072 3300045976 Bacteria 5282
298 Ga0466967_0033405 3300045976 Bacteria 4355
299 Ga0466967_0036728 3300045976 Bacteria 4185
300 Ga0466967_0071032 3300045976 Bacteria 3116
301 Ga0466967_0247056 3300045976 Bacteria 1703
302 Ga0466967_0319504 3300045976 Bacteria 1497
303 Ga0466967_0425619 3300045976 Bacteria 1295
304 Ga0495617_012782 3300046452 Bacteria 2862
305 Ga0495627_043789 3300046453 Bacteria 1368
306 Ga0495592_0000025 3300046454 Bacteria 136324
307 Ga0495592_0019855 3300046454 Bacteria 5109
308 Ga0495603_0000942 3300046455 Bacteria 16736
309 Ga0495603_0003385 3300046455 Bacteria 9496
310 Ga0495603_0006063 3300046455 Bacteria 7229
311 Ga0495603_0006479 3300046455 Bacteria 7011
312 Ga0495603_0042449 3300046455 Bacteria 2718
313 Ga0495590_0010403 3300046457 Bacteria 3500
314 Ga0495629_0000666 3300046459 Bacteria 27787
315 Ga0495629_0008880 3300046459 Bacteria 7390
316 Ga0495629_0012169 3300046459 Bacteria 6234
317 Ga0495629_0081444 3300046459 Bacteria 2259
318 Ga0495629_0148539 3300046459 Bacteria 1629
319 Ga0495629_0275487 3300046459 Bacteria 1155
320 Ga0495638_0063743 3300046460 Bacteria 2271
321 Ga0495638_0226928 3300046460 Bacteria 1041
322 Ga0495651_0000014 3300046462 Bacteria 136312
323 Ga0495651_0067958 3300046462 Bacteria 2717
324 Ga0495653_0004684 3300046463 Bacteria 11067
325 Ga0495605_0004741 3300046474 Bacteria 7952
326 Ga0495639_0010582 3300046475 Bacteria 3972
327 Ga0495639_0204204 3300046475 Bacteria 968
328 Ga0495662_0038157 3300046476 Bacteria 2321
329 Ga0495662_0056238 3300046476 Bacteria 1900
330 Ga0495585_0043139 3300046492 Bacteria 2524
331 Ga0495594_0013603 3300046499 Bacteria 4250
332 Ga0495594_0076416 3300046499 Bacteria 1867
333 Ga0495594_0083620 3300046499 Bacteria 1784
334 Ga0495596_0044346 3300046500 Bacteria 1750
335 Ga0495607_0041262 3300046501 Bacteria 2742
336 Ga0495606_0006736 3300046507 Bacteria 10515
337 Ga0495608_0000055 3300046511 Bacteria 93015
338 Ga0495608_0113768 3300046511 Bacteria 1738
339 Ga0495616_0003647 3300046513 Bacteria 9834
340 Ga0495628_0000102 3300046516 Bacteria 68520
341 Ga0495630_0340303 3300046517 Bacteria 1148
342 Ga0495631_0004943 3300046518 Bacteria 7024
343 Ga0495632_0155774 3300046519 Bacteria 1054
344 Ga0495632_0176816 3300046519 Bacteria 979
345 Ga0495637_0107972 3300046520 Bacteria 1081
346 Ga0495643_0001437 3300046522 Bacteria 21986
347 Ga0495643_0002988 3300046522 Bacteria 12777
348 Ga0495648_0098666 3300046524 Bacteria 1617
349 Ga0495652_0004463 3300046529 Bacteria 13363
350 Ga0495587_0000029 3300046536 Bacteria 136321
351 Ga0495609_0028621 3300046538 Bacteria 2542
352 Ga0495597_0088188 3300046542 Bacteria 1319
353 Ga0495622_0002415 3300046557 Bacteria 9079
354 Ga0495622_0028338 3300046557 Bacteria 2615
355 Ga0495633_0009359 3300046558 Bacteria 5418
356 Ga0495667_0000036 3300046559 Bacteria 136146
357 Ga0495667_0072804 3300046559 Bacteria 2239
358 Ga0495668_0018178 3300046616 Bacteria 4065
359 Ga0495634_0055061 3300046642 Bacteria 2661
360 Ga0495611_0014917 3300046648 Bacteria 3319
361 Ga0495611_0087777 3300046648 Bacteria 1435
362 Ga0495611_0209154 3300046648 Bacteria 909
363 Ga0495625_0043187 3300046660 Bacteria 3271
364 Ga0495635_0080795 3300046663 Bacteria 2225
365 Ga0495661_0019156 3300046665 Bacteria 4490
366 Ga0495588_0005319 3300046674 Bacteria 5725
367 Ga0495588_0075376 3300046674 Bacteria 1757
368 Ga0495657_0000319 3300046675 Bacteria 44250
369 Ga0495657_0003160 3300046675 Bacteria 13581
370 Ga0495599_0000006 3300046678 Bacteria 283487
371 Ga0495599_0149101 3300046678 Bacteria 1449
372 Ga0495623_0000852 3300046679 Bacteria 20658
373 Ga0495613_0115601 3300046689 Bacteria 1930
374 Ga0495613_0157177 3300046689 Bacteria 1619
375 Ga0495613_0203854 3300046689 Bacteria 1393
376 Ga0495613_0280226 3300046689 Bacteria 1158
377 Ga0495624_0130991 3300046690 Bacteria 1537
378 Ga0495670_0120367 3300046691 Bacteria 1363
379 Ga0495670_0211684 3300046691 Bacteria 1028
380 Ga0495671_0022010 3300046692 Bacteria 3343
381 Ga0495649_0015923 3300046694 Bacteria 4270
382 Ga0495649_0132849 3300046694 Bacteria 1313
383 Ga0495589_0020073 3300046794 Bacteria 3418
384 Ga0495589_0043687 3300046794 Bacteria 2229
385 Ga0495600_0075163 3300046809 Bacteria 2206
386 Ga0495600_0358084 3300046809 Bacteria 913
387 Ga0495581_0166233 3300047315 Bacteria 1290
388 Ga0495604_0001010 3300047317 Bacteria 23432
389 Ga0495604_0070818 3300047317 Bacteria 2639
390 Ga0495636_0005508 3300047318 Bacteria 4969
391 Ga0495636_0006017 3300047318 Bacteria 4760
392 Ga0495636_0006557 3300047318 Bacteria 4574
393 Ga0495636_0166035 3300047318 Bacteria 996
394 Ga0495674_0263922 3300047319 Bacteria 1414
395 Ga0495672_0071260 3300047320 Bacteria 1967
396 Ga0495676_0004421 3300047321 Bacteria 12853
397 Ga0495676_0007217 3300047321 Bacteria 10194
398 Ga0495676_0034935 3300047321 Bacteria 4211
399 Ga0495680_0000117 3300047322 Bacteria 76289
400 Ga0495680_0027717 3300047322 Bacteria 4649
401 Ga0495687_008131 3300047443 Bacteria 6052
402 Ga0495687_009032 3300047443 Bacteria 5621
403 Ga0495687_062714 3300047443 Bacteria 1524
404 Ga0495675_0005582 3300047444 Bacteria 7677
405 Ga0495675_0034028 3300047444 Bacteria 3252
406 Ga0495677_0101604 3300047445 Bacteria 1089
407 Ga0495677_0142813 3300047445 Bacteria 919
408 Ga0495685_000398 3300047447 Bacteria 13796
409 Ga0495685_030716 3300047447 Bacteria 1847
410 Ga0495673_0071475 3300047469 Bacteria 1459
411 Ga0495681_0002268 3300047470 Bacteria 13832
412 Ga0495681_0007946 3300047470 Bacteria 6699
413 Ga0495681_0064993 3300047470 Bacteria 1669
414 Ga0495686_0131468 3300047472 Bacteria 1483
415 Ga0495602_0008141 3300048088 Bacteria 10945
416 Ga0495614_0001460 3300048089 Bacteria 10221
417 Ga0495614_0048231 3300048089 Bacteria 1826
418 Ga0495614_0049344 3300048089 Bacteria 1804
419 Ga0495614_0065879 3300048089 Bacteria 1558
420 Ga0495614_0114676 3300048089 Bacteria 1184
421 Ga0495626_0014277 3300048091 Bacteria 4102
422 Ga0496100_0232895 3300048903 Bacteria 1356
423 Ga0496102_0012617 3300048905 Bacteria 7319
424 Ga0496104_0007571 3300048907 Bacteria 9608
425 Ga0496104_0019746 3300048907 Bacteria 6169
426 Ga0496104_0117917 3300048907 Bacteria 2547
427 Ga0496105_0016494 3300048908 Bacteria 5899
428 Ga0496105_0024100 3300048908 Bacteria 4942
429 Ga0496105_0084531 3300048908 Bacteria 2621
430 Ga0496107_0132239 3300048910 Bacteria 1842
431 Ga0496107_0150240 3300048910 Bacteria 1723
432 Ga0496108_0007825 3300048911 Bacteria 8661
433 Ga0496108_0146559 3300048911 Bacteria 2035
434 Ga0496108_0385386 3300048911 Bacteria 1224
435 Ga0496109_0021077 3300048912 Bacteria 5763
436 Ga0496109_0040765 3300048912 Bacteria 4206
437 Ga0496109_0295242 3300048912 Bacteria 1528
438 Ga0496110_0032602 3300048913 Bacteria 4501
439 Ga0496110_0098021 3300048913 Bacteria 2626
440 Ga0496112_0122871 3300048915 Bacteria 2566
441 Ga0496112_0368410 3300048915 Bacteria 1378
442 Ga0496113_0002281 3300048916 Bacteria 11069
443 Ga0496113_0614099 3300048916 Bacteria 870
444 Ga0496115_0101298 3300048918 Bacteria 2361
445 Ga0496119_0001193 3300048922 Bacteria 32523
446 Ga0496120_0019811 3300048923 Bacteria 4291
447 Ga0495678_024644 3300049459 Bacteria 2595
448 Ga0501031_0003628 3300049568 Bacteria 9933
449 Ga0501032_0002891 3300049569 Bacteria 13354
450 Ga0501032_0093750 3300049569 Bacteria 1991
451 Ga0501033_0007128 3300049570 Bacteria 8724
452 Ga0501033_0039007 3300049570 Bacteria 3548
453 Ga0501033_0084822 3300049570 Bacteria 2321
454 Ga0501033_0099496 3300049570 Bacteria 2123
455 Ga0501033_0108476 3300049570 Bacteria 2022
456 Ga0501034_0003111 3300049571 Bacteria 19126
457 Ga0501034_0011530 3300049571 Bacteria 9158
458 Ga0501034_0038283 3300049571 Bacteria 4857
459 Ga0501034_0045311 3300049571 Bacteria 4445
460 Ga0501034_0083394 3300049571 Bacteria 3198
461 Ga0501036_0001833 3300049572 Bacteria 16501
462 Ga0501036_0002710 3300049572 Bacteria 13988
463 Ga0501036_0005689 3300049572 Bacteria 10114
464 Ga0501036_0017323 3300049572 Bacteria 6021
465 Ga0501036_0191115 3300049572 Bacteria 1722
466 Ga0501037_0003656 3300049573 Bacteria 11158
467 Ga0501037_0022883 3300049573 Bacteria 4621
468 Ga0501038_0005910 3300049574 Bacteria 11311
469 Ga0501038_0009008 3300049574 Bacteria 9159
470 Ga0501038_0016504 3300049574 Bacteria 6693
471 Ga0501038_0084612 3300049574 Bacteria 2668
472 Ga0501039_0046359 3300049575 Bacteria 3358
473 Ga0501039_0343275 3300049575 Bacteria 1173
474 Ga0501039_0585412 3300049575 Bacteria 875
475 Ga0501040_0004768 3300049576 Bacteria 8795
476 Ga0501042_0000316 3300049578 Bacteria 24201
477 Ga0501042_0032483 3300049578 Bacteria 3696
478 Ga0501042_0166868 3300049578 Bacteria 1588
479 Ga0501043_0000948 3300049579 Bacteria 25739
480 Ga0501043_0006631 3300049579 Bacteria 9261
481 Ga0501043_0043640 3300049579 Bacteria 3524
482 Ga0501043_0055481 3300049579 Bacteria 3113
483 Ga0501043_0392454 3300049579 Bacteria 1049
484 Ga0501047_0011570 3300049581 Bacteria 8349
485 Ga0501048_0007895 3300049582 Bacteria 8059
486 Ga0501048_0027267 3300049582 Bacteria 4154
487 Ga0501048_0183903 3300049582 Bacteria 1481
488 Ga0501067_0055362 3300049583 Bacteria 2198
489 Ga0501070_0022271 3300049586 Bacteria 5309
490 Ga0501070_0143517 3300049586 Bacteria 1971
491 Ga0501070_0176299 3300049586 Bacteria 1760
492 Ga0501072_0005844 3300049588 Bacteria 9375
493 Ga0501073_0525187 3300049589 Bacteria 818
494 Ga0501074_0005511 3300049590 Bacteria 9107
495 Ga0501074_0139161 3300049590 Bacteria 1736
496 Ga0501076_0000957 3300049592 Bacteria 18872
497 Ga0501079_0114668 3300049741 Bacteria 2094
498 Ga0501079_0394942 3300049741 Bacteria 1085
499 Ga0501080_0263596 3300049742 Bacteria 1569
500 Ga0501081_0021363 3300049743 Bacteria 4319
501 Ga0501081_0189671 3300049743 Bacteria 1488
502 Ga0501035_0005137 3300049822 Bacteria 12386
503 Ga0501035_0033368 3300049822 Bacteria 4682
504 Ga0501035_0040949 3300049822 Bacteria 4184
505 Ga0501035_0062954 3300049822 Bacteria 3300
506 Ga0501035_0117999 3300049822 Bacteria 2322
507 Ga0501035_0126155 3300049822 Bacteria 2234
508 Ga0501044_0006572 3300049823 Bacteria 12839
509 Ga0501044_0101311 3300049823 Bacteria 2897
510 Ga0501044_0139417 3300049823 Bacteria 2414
511 Ga0501044_0385753 3300049823 Bacteria 1315
512 Ga0501044_0442331 3300049823 Bacteria 1207
513 Ga0501045_0090840 3300049824 Bacteria 2257
514 nmdc:mga0yw44_200915_c1 3300050492 Bacteria 1316
515 nmdc:mga06z11_4065_c1 3300050494 Bacteria 5718
516 nmdc:mga04h51_25220_c1 3300050495 Bacteria 1828
517 nmdc:mga05p37_123536_c1 3300050507 Bacteria 3180
518 nmdc:mga05p37_224670_c1 3300050507 Bacteria 2264
519 nmdc:mga05p37_372922_c1 3300050507 Bacteria 1674
520 nmdc:mga09592_205672_c1 3300050508 Bacteria 1705
521 nmdc:mga06r32_3633_c1 3300050510 Bacteria 13772
522 nmdc:mga08y16_175936_c1 3300050511 Bacteria 2222
523 nmdc:mga0n895_142738_c1 3300050512 Bacteria 2424
524 nmdc:mga0a205_260040_c1 3300050515 Bacteria 1614
525 Ga0495612_0041308 3300053078 Bacteria 1881
526 Ga0495655_0048196 3300053083 Bacteria 1117
527 Ga0495595_0001781 3300053084 Bacteria 8401
528 Ga0500578_0014450 3300053086 Bacteria 5075
529 Ga0500583_0052093 3300053092 Bacteria 1904
530 Ga0500566_0071602 3300053094 Bacteria 1945
531 Ga0500641_0045666 3300053096 Bacteria 1785
532 Ga0500654_018344 3300053099 Bacteria 4545
533 Ga0500660_124265 3300053100 Bacteria 1066
534 Ga0500553_152121 3300053101 Bacteria 888
535 Ga0500580_072681 3300053113 Bacteria 1412
536 Ga0500614_027383 3300053123 Bacteria 1369
537 Ga0500652_095795 3300053131 Bacteria 1239
538 Ga0500658_0007775 3300053134 Bacteria 3959
539 Ga0500561_0001350 3300053137 Bacteria 3986
540 Ga0500573_0015109 3300053140 Bacteria 4374
541 Ga0500588_0008282 3300053146 Bacteria 2423
542 Ga0500600_0068915 3300053149 Bacteria 1945
543 Ga0500616_0062643 3300053153 Bacteria 1920
544 Ga0500627_0170673 3300053158 Bacteria 980
545 Ga0500633_0002033 3300053160 Bacteria 4044
546 Ga0500633_0056884 3300053160 Bacteria 1366
547 Ga0500634_0108311 3300053161 Bacteria 1376
548 Ga0500656_004474 3300053732 Bacteria 1350
549 Ga0500587_001783 3300053739 Bacteria 3059
550 Ga0501084_0007270 3300054114 Bacteria 9126
551 Ga0501082_0097829 3300060353 Bacteria 2537
552 Ga0466962_0049165 3300061719 Bacteria 2016
553 2547406452 2547132111 Bacteria 8013147
554 2554258600 2554235005 Bacteria 6457341
555 2554259619 2554235005 Bacteria 6457341
556 2585300928 2582581312 Bacteria 7308206
557 2585303445 2582581313 Bacteria 10042643
558 2585316918 2582581314 Bacteria 11452267
559 2616695531 2616644814 Bacteria 11555299
560 2616906184 2616644941 Bacteria 8510691
561 2643760308 2643221548 Bacteria 8053412
562 2643849904 2643221567 Bacteria 4163945
563 2643904417 2643221578 Bacteria 9213798
564 2644135906 2643221624 Bacteria 4384879
565 2644179535 2643221631 Bacteria 8168043
566 2644267938 2643221647 Bacteria 10741251
567 2644406315 2643221673 Bacteria 9196637
568 2644443613 2643221678 Bacteria 9540101
569 2644459995 2643221682 Bacteria 6743283
570 2644632458 2643221714 Bacteria 9015452
571 2753073180 2751185734 Bacteria 8863695
572 2785345816 2784746763 Bacteria 9783172
573 2785367071 2784746768 Bacteria 10036182
574 2786668110 2786546132 Bacteria 10419719
575 2799186383 2799112218 Bacteria 4315149
576 2808847575 2808606359 Bacteria 9866990
577 2808918308 2808606375 Bacteria 9466072
578 2811846889 2808606982 Bacteria 7791042
579 2812360391 2811994879 Bacteria 9313447
580 2816426040 2816332119 Bacteria 8120218
581 2816510236 2816332139 Bacteria 9138787
582 2819699814 2818991463 Bacteria 7948711
583 2837273822 2837268691 Bacteria 7850704
584 2852637638 2852635781 Bacteria 8251373
585 2862289743 2862281513 Bacteria 9621493
586 2862383674 2862382967 Bacteria 10317375
587 2862510347 2862507626 Bacteria 9425308
588 2862583795 2862574272 Bacteria 10567477
589 2863407049 2863404153 Bacteria 9672205
590 2867434252 2867428634 Bacteria 9590268
591 2867479264 2867475112 Bacteria 6909112
592 2873157754 2873151551 Bacteria 8625867
593 2875392623 2875391855 Bacteria 7600475
594 2912722581 2912715099 Bacteria 9460473
595 2912726267 2912723979 Bacteria 8557534
596 2919472269 2919468124 Bacteria 9133025
597 2946052093 2946045630 Bacteria 8527308
598 2946065498 2946064051 Bacteria 8957905
599 2946073852 2946072368 Bacteria 8999607
600 2947231912 2947224130 Bacteria 9938529
601 2954011154 2954002825 Bacteria 9173742
602 2954388728 2954380949 Bacteria 10050426
603 2954674398 2954673503 Bacteria 9685905
604 2954689733 2954682443 Bacteria 9862841
605 2954699516 2954691527 Bacteria 10720516
606 2954702702 2954701450 Bacteria 10834262
607 2954718455 2954711539 Bacteria 10867210
608 2954728425 2954721474 Bacteria 10456478
609 2954733384 2954731030 Bacteria 10243860
610 2954747321 2954740390 Bacteria 10229294
611 2954752267 2954749733 Bacteria 10366972
612 2966604511 2966598605 Bacteria 7676064
613 2990059657 2990059506 Bacteria 9321252
614 2990091134 2990088156 Bacteria 6657676
615 3006487440 3006486233 Bacteria 8157040
616 8008486878 8008485437 Bacteria 7198341
617 8008561232 8008558824 Bacteria 10610750
618 8025414885 8025413630 Bacteria 7014048
619 8025526135 8025524527 Bacteria 7197316
620 8025535396 8025530807 Bacteria 8495698
621 8033685515 8033684223 Bacteria 6906479
622 8048408090 8048406513 Bacteria 8936924
623 8054162087 8054160619 Bacteria 7783213
624 8055162683 8055157932 Bacteria 6429399
625 8056669570 8056667051 Bacteria 6953971
626 8056835792 8056829672 Bacteria 9045328
627 Ga0496105_0599463
628 JGI24735J21928_10061776
629 rootH1_10008653
630 rootL2_10020556
631 JGI25160J50197_1016844
632 Ga0006562J51391_1102868
633 Ga0070658_10000677
634 Ga0070660_100160255
635 Ga0070667_100690369
636 Ga0070709_10006485
637 Ga0070714_100000002
638 Ga0070714_100001182
639 Ga0070713_100035240
640 Ga0070713_100076323
641 Ga0070713_100094701
642 Ga0070713_100313334
643 Ga0070710_10019284
644 Ga0070700_100000072
645 Ga0070708_100032555
646 Ga0070708_100033754
647 Ga0070706_100002091
648 Ga0070706_100002349
649 Ga0070706_100005716
650 Ga0070706_100462369
651 Ga0070707_100001004
652 Ga0070707_100003928
653 Ga0070707_100012739
654 Ga0070698_100000637
655 Ga0070698_100001515
656 Ga0070698_100001711
657 Ga0070698_100061633
658 Ga0070679_100047535
659 Ga0070684_100079493
660 Ga0070697_100015965
661 Ga0070697_100023402
662 Ga0068853_100006392
663 Ga0070672_100215790
664 Ga0070696_100013349
665 Ga0070696_100017170
666 Ga0070704_100021974
667 Ga0068855_100050257
668 Ga0068855_100248898
669 Ga0068855_100608856
670 Ga0070664_100181796
671 Ga0068857_100486208
672 Ga0068854_100585294
673 Ga0068856_100153437
674 Ga0068852_100008381
675 Ga0068852_100118577
676 Ga0068859_100005559
677 Ga0068864_100001246
678 Ga0068863_100033398
679 Ga0068858_100386258
680 Ga0081538_10000016
681 Ga0081540_1001512
682 Ga0070717_10011636
683 Ga0070717_10028408
684 Ga0070717_10039201
685 Ga0070717_10057152
686 Ga0075365_10128166
687 Ga0075363_100026941
688 Ga0075432_10026398
689 Ga0070712_100033504
690 Ga0070712_100146736
691 Ga0075367_10001282
692 Ga0075428_100197641
693 Ga0075429_100632464
694 Ga0075436_100072030
695 Ga0097620_100005559
696 Ga0099826_10061147
697 Ga0075435_100389050
698 Ga0105240_10012952
699 Ga0111539_10139586
700 Ga0105245_10041510
701 Ga0105245_10109397
702 Ga0105245_10783582
703 Ga0114129_10142368
704 Ga0105241_10029549
705 Ga0105241_10060165
706 Ga0105241_10249598
707 Ga0105248_10422949
708 Ga0105248_10515278
709 Ga0105237_10006081
710 Ga0105237_10713174
711 Ga0105238_10028580
712 Ga0105246_10054690
713 Ga0157370_10000875
714 Ga0157369_10060040
715 Ga0157369_10060175
716 Ga0157374_10206269
717 Ga0157374_10715648
718 Ga0157372_10227571
719 Ga0157372_10551176
720 Ga0157375_10566930
721 Ga0157375_10717214
722 Ga0163163_10028049
723 Ga0163163_10064075
724 Ga0163163_10336218
725 Ga0182007_10000166
726 Ga0183367_1017
727 Ga0197907_11057858
728 Ga0197907_11476537
729 Ga0206349_1459813
730 Ga0206350_10732310
731 Ga0206354_10304190
732 Ga0206353_10352472
733 Ga0206353_10636788
734 Ga0206353_10986400
735 Ga0213876_10052438
736 Ga0213875_10058102
737 Ga0224712_10019050
738 Ga0224712_10047061
739 Ga0224712_10061124
740 Ga0224572_1000548
741 Ga0209758_1003531
742 Ga0207426_1000643
743 Ga0207426_1003231
744 Ga0207426_1013430
745 Ga0207426_1021292
746 Ga0207692_10014932
747 Ga0207710_10004454
748 Ga0207699_10035919
749 Ga0207705_10004269
750 Ga0207684_10002360
751 Ga0207684_10006588
752 Ga0207684_10377484
753 Ga0207654_10038553
754 Ga0207695_10287711
755 Ga0207671_10008914
756 Ga0207693_10294402
757 Ga0207663_10039815
758 Ga0207652_10536072
759 Ga0207646_10000544
760 Ga0207646_10008213
761 Ga0207646_10072169
762 Ga0207687_10024077
763 Ga0207700_10015521
764 Ga0207700_10159095
765 Ga0207700_10604903
766 Ga0207664_10000038
767 Ga0207664_10009968
768 Ga0207664_10472206
769 Ga0207665_10406979
770 Ga0207711_10217994
771 Ga0207661_10340743
772 Ga0207667_10097483
773 Ga0207667_10342436
774 Ga0207667_10409487
775 Ga0207667_10543195
776 Ga0207703_10354333
777 Ga0207639_10015349
778 Ga0207708_10000023
779 Ga0207708_10131913
780 Ga0207702_10083627
781 Ga0207702_10149223
782 Ga0207676_10019388
783 Ga0207674_10554656
784 Ga0207698_10066734
785 Ga0209371_1034207
786 Ga0209282_1048740
787 Ga0209813_10067141
788 Ga0307515_10009395
789 Ga0307515_10140063
790 Ga0307515_10233747
791 Ga0307511_10000410
792 Ga0307511_10015650
793 Ga0307511_10046036
794 Ga0307512_10002135
795 Ga0307512_10021907
796 Ga0307513_10052390
797 Ga0307509_10166344
798 Ga0307508_10024914
799 Ga0307508_10225231
800 Ga0307514_10004854
801 Ga0307514_10015345
802 Ga0316576_10000270
803 Ga0316576_10018290
804 Ga0307516_10011429
805 Ga0307516_10280546
806 Ga0307405_10003123
807 Ga0307413_10259827
808 Ga0307410_10065150
809 Ga0307410_10111003
810 Ga0307409_100003337
811 Ga0307416_100001296
812 Ga0307416_100226077
813 Ga0307416_100380457
814 Ga0307415_100000260
815 Ga0307415_100095637
816 Ga0307415_100131151
817 Ga0307507_10120829
818 Ga0307507_10231552
819 Ga0307510_10056448
820 Ga0373948_0010364
821 Ga0373950_0007304
822 Ga0373959_0008854
823 Ga0373938_0036541
824 Ga0373928_0004634
825 Ga0373929_0019788
826 Ga0373934_0001411
827 Ga0373940_0014329
828 Ga0373923_0029446
829 Ga0373939_0010717
830 Ga0373941_0016515
831 Ga0373953_0000268
832 Ga0373954_0001771
833 Ga0373956_0002251
834 Ga0373946_0193481
835 Ga0373955_0000016
836 Ga0373962_0014421
837 Ga0373924_0000752
838 Ga0373927_0017018
839 Ga0373933_0000001
840 Ga0373937_0003722
841 Ga0316584_0007960
842 Ga0395900_0177367
843 Ga0395900_0547115
844 Ga0395900_0573274
845 Ga0395898_0018140
846 Ga0436364_0819810
847 Ga0436364_0911612
848 Ga0395901_0381100
849 Ga0436365_1298945
850 Ga0436363_0412211
851 Ga0439436_0016730
852 Ga0439439_0013511
853 Ga0451793_0478337
854 Ga0451795_1417318
855 Ga0451853_1859136
856 Ga0439433_0005340
857 Ga0439448_0009516
858 Ga0439448_0020807
859 Ga0439449_0001268
860 Ga0439450_019828
861 Ga0439454_004515
862 Ga0439455_0041912
863 Ga0439457_000025
864 Ga0439457_003276
865 Ga0439463_032717
866 Ga0450890_009948
867 Ga0450894_000356
868 Ga0450896_000092
869 Ga0450898_000154
870 Ga0450899_000359
871 Ga0450900_018926
872 Ga0450903_000014
873 Ga0450906_000431
874 Ga0450907_013450
875 Ga0439458_0003690
876 Ga0439458_0005624
877 Ga0466969_0033688
878 Ga0466972_0002210
879 Ga0466972_0006993
880 Ga0466972_0041761
881 Ga0466972_0159789
882 Ga0466965_0066143
883 Ga0466965_0179896
884 Ga0466965_0257605
885 Ga0466966_0005225
886 Ga0466966_0068619
887 Ga0466966_0074846
888 Ga0466966_0159099
889 Ga0466961_0009410
890 Ga0466961_0056479
891 Ga0466961_0080533
892 Ga0466961_0293735
893 Ga0466963_0009635
894 Ga0466963_0019873
895 Ga0466963_0026566
896 Ga0466963_0061057
897 Ga0466963_0203924
898 Ga0466963_0352602
899 Ga0466963_0464246
900 Ga0466964_0000816
901 Ga0466964_0016897
902 Ga0466964_0026131
903 Ga0466971_0013457
904 Ga0466971_0031222
905 Ga0466971_0056576
906 Ga0466968_0031788
907 Ga0466970_0044372
908 Ga0466970_0069313
909 Ga0466957_0027238
910 Ga0466957_0042779
911 Ga0466957_0045603
912 Ga0466960_0015448
913 Ga0466960_0207327
914 Ga0466959_0137822
915 Ga0466958_0019128
916 Ga0466958_0032372
917 Ga0466958_0057283
918 Ga0466958_0123455
919 Ga0466958_0125739
920 Ga0466958_0177408
921 Ga0466967_0000184
922 Ga0466967_0004866
923 Ga0466967_0021072
924 Ga0466967_0033405
925 Ga0466967_0036728
926 Ga0466967_0071032
927 Ga0466967_0247056
928 Ga0466967_0319504
929 Ga0466967_0425619
930 Ga0495617_012782
931 Ga0495627_043789
932 Ga0495592_0000025
933 Ga0495592_0019855
934 Ga0495603_0000942
935 Ga0495603_0003385
936 Ga0495603_0006063
937 Ga0495603_0006479
938 Ga0495603_0042449
939 Ga0495590_0010403
940 Ga0495629_0000666
941 Ga0495629_0008880
942 Ga0495629_0012169
943 Ga0495629_0081444
944 Ga0495629_0148539
945 Ga0495629_0275487
946 Ga0495638_0063743
947 Ga0495638_0226928
948 Ga0495651_0000014
949 Ga0495651_0067958
950 Ga0495653_0004684
951 Ga0495605_0004741
952 Ga0495639_0010582
953 Ga0495639_0204204
954 Ga0495662_0038157
955 Ga0495662_0056238
956 Ga0495585_0043139
957 Ga0495594_0013603
958 Ga0495594_0076416
959 Ga0495594_0083620
960 Ga0495596_0044346
961 Ga0495607_0041262
962 Ga0495606_0006736
963 Ga0495608_0000055
964 Ga0495608_0113768
965 Ga0495616_0003647
966 Ga0495628_0000102
967 Ga0495630_0340303
968 Ga0495631_0004943
969 Ga0495632_0155774
970 Ga0495632_0176816
971 Ga0495637_0107972
972 Ga0495643_0001437
973 Ga0495643_0002988
974 Ga0495648_0098666
975 Ga0495652_0004463
976 Ga0495587_0000029
977 Ga0495609_0028621
978 Ga0495597_0088188
979 Ga0495622_0002415
980 Ga0495622_0028338
981 Ga0495633_0009359
982 Ga0495667_0000036
983 Ga0495667_0072804
984 Ga0495668_0018178
985 Ga0495634_0055061
986 Ga0495611_0014917
987 Ga0495611_0087777
988 Ga0495611_0209154
989 Ga0495625_0043187
990 Ga0495635_0080795
991 Ga0495661_0019156
992 Ga0495588_0005319
993 Ga0495588_0075376
994 Ga0495657_0000319
995 Ga0495657_0003160
996 Ga0495599_0000006
997 Ga0495599_0149101
998 Ga0495623_0000852
999 Ga0495613_0115601
1000 Ga0495613_0157177
1001 Ga0495613_0203854
1002 Ga0495613_0280226
1003 Ga0495624_0130991
1004 Ga0495670_0120367
1005 Ga0495670_0211684
1006 Ga0495671_0022010
1007 Ga0495649_0015923
1008 Ga0495649_0132849
1009 Ga0495589_0020073
1010 Ga0495589_0043687
1011 Ga0495600_0075163
1012 Ga0495600_0358084
1013 Ga0495581_0166233
1014 Ga0495604_0001010
1015 Ga0495604_0070818
1016 Ga0495636_0005508
1017 Ga0495636_0006017
1018 Ga0495636_0006557
1019 Ga0495636_0166035
1020 Ga0495674_0263922
1021 Ga0495672_0071260
1022 Ga0495676_0004421
1023 Ga0495676_0007217
1024 Ga0495676_0034935
1025 Ga0495680_0000117
1026 Ga0495680_0027717
1027 Ga0495687_008131
1028 Ga0495687_009032
1029 Ga0495687_062714
1030 Ga0495675_0005582
1031 Ga0495675_0034028
1032 Ga0495677_0101604
1033 Ga0495677_0142813
1034 Ga0495685_000398
1035 Ga0495685_030716
1036 Ga0495673_0071475
1037 Ga0495681_0002268
1038 Ga0495681_0007946
1039 Ga0495681_0064993
1040 Ga0495686_0131468
1041 Ga0495602_0008141
1042 Ga0495614_0001460
1043 Ga0495614_0048231
1044 Ga0495614_0049344
1045 Ga0495614_0065879
1046 Ga0495614_0114676
1047 Ga0495626_0014277
1048 Ga0496100_0232895
1049 Ga0496102_0012617
1050 Ga0496104_0007571
1051 Ga0496104_0019746
1052 Ga0496104_0117917
1053 Ga0496105_0016494
1054 Ga0496105_0024100
1055 Ga0496105_0084531
1056 Ga0496107_0132239
1057 Ga0496107_0150240
1058 Ga0496108_0007825
1059 Ga0496108_0146559
1060 Ga0496108_0385386
1061 Ga0496109_0021077
1062 Ga0496109_0040765
1063 Ga0496109_0295242
1064 Ga0496110_0032602
1065 Ga0496110_0098021
1066 Ga0496112_0122871
1067 Ga0496112_0368410
1068 Ga0496113_0002281
1069 Ga0496113_0614099
1070 Ga0496115_0101298
1071 Ga0496119_0001193
1072 Ga0496120_0019811
1073 Ga0495678_024644
1074 Ga0501031_0003628
1075 Ga0501032_0002891
1076 Ga0501032_0093750
1077 Ga0501033_0007128
1078 Ga0501033_0039007
1079 Ga0501033_0084822
1080 Ga0501033_0099496
1081 Ga0501033_0108476
1082 Ga0501034_0003111
1083 Ga0501034_0011530
1084 Ga0501034_0038283
1085 Ga0501034_0045311
1086 Ga0501034_0083394
1087 Ga0501036_0001833
1088 Ga0501036_0002710
1089 Ga0501036_0005689
1090 Ga0501036_0017323
1091 Ga0501036_0191115
1092 Ga0501037_0003656
1093 Ga0501037_0022883
1094 Ga0501038_0005910
1095 Ga0501038_0009008
1096 Ga0501038_0016504
1097 Ga0501038_0084612
1098 Ga0501039_0046359
1099 Ga0501039_0343275
1100 Ga0501039_0585412
1101 Ga0501040_0004768
1102 Ga0501042_0000316
1103 Ga0501042_0032483
1104 Ga0501042_0166868
1105 Ga0501043_0000948
1106 Ga0501043_0006631
1107 Ga0501043_0043640
1108 Ga0501043_0055481
1109 Ga0501043_0392454
1110 Ga0501047_0011570
1111 Ga0501048_0007895
1112 Ga0501048_0027267
1113 Ga0501048_0183903
1114 Ga0501067_0055362
1115 Ga0501070_0022271
1116 Ga0501070_0143517
1117 Ga0501070_0176299
1118 Ga0501072_0005844
1119 Ga0501073_0525187
1120 Ga0501074_0005511
1121 Ga0501074_0139161
1122 Ga0501076_0000957
1123 Ga0501079_0114668
1124 Ga0501079_0394942
1125 Ga0501080_0263596
1126 Ga0501081_0021363
1127 Ga0501081_0189671
1128 Ga0501035_0005137
1129 Ga0501035_0033368
1130 Ga0501035_0040949
1131 Ga0501035_0062954
1132 Ga0501035_0117999
1133 Ga0501035_0126155
1134 Ga0501044_0006572
1135 Ga0501044_0101311
1136 Ga0501044_0139417
1137 Ga0501044_0385753
1138 Ga0501044_0442331
1139 Ga0501045_0090840
1140 nmdc:mga0yw44_200915_c1
1141 nmdc:mga06z11_4065_c1
1142 nmdc:mga04h51_25220_c1
1143 nmdc:mga05p37_123536_c1
1144 nmdc:mga05p37_224670_c1
1145 nmdc:mga05p37_372922_c1
1146 nmdc:mga09592_205672_c1
1147 nmdc:mga06r32_3633_c1
1148 nmdc:mga08y16_175936_c1
1149 nmdc:mga0n895_142738_c1
1150 nmdc:mga0a205_260040_c1
1151 Ga0495612_0041308
1152 Ga0495655_0048196
1153 Ga0495595_0001781
1154 Ga0500578_0014450
1155 Ga0500583_0052093
1156 Ga0500566_0071602
1157 Ga0500641_0045666
1158 Ga0500654_018344
1159 Ga0500660_124265
1160 Ga0500553_152121
1161 Ga0500580_072681
1162 Ga0500614_027383
1163 Ga0500652_095795
1164 Ga0500658_0007775
1165 Ga0500561_0001350
1166 Ga0500573_0015109
1167 Ga0500588_0008282
1168 Ga0500600_0068915
1169 Ga0500616_0062643
1170 Ga0500627_0170673
1171 Ga0500633_0002033
1172 Ga0500633_0056884
1173 Ga0500634_0108311
1174 Ga0500656_004474
1175 Ga0500587_001783
1176 Ga0501084_0007270
1177 Ga0501082_0097829
1178 Ga0466962_0049165
1179 2547406452
1180 2554258600
1181 2554259619
1182 2585300928
1183 2585303445
1184 2585316918
1185 2616695531
1186 2616906184
1187 2643760308
1188 2643849904
1189 2643904417
1190 2644135906
1191 2644179535
1192 2644267938
1193 2644406315
1194 2644443613
1195 2644459995
1196 2644632458
1197 2753073180
1198 2785345816
1199 2785367071
1200 2786668110
1201 2799186383
1202 2808847575
1203 2808918308
1204 2811846889
1205 2812360391
1206 2816426040
1207 2816510236
1208 2819699814
1209 2837273822
1210 2852637638
1211 2862289743
1212 2862383674
1213 2862510347
1214 2862583795
1215 2863407049
1216 2867434252
1217 2867479264
1218 2873157754
1219 2875392623
1220 2912722581
1221 2912726267
1222 2919472269
1223 2946052093
1224 2946065498
1225 2946073852
1226 2947231912
1227 2954011154
1228 2954388728
1229 2954674398
1230 2954689733
1231 2954699516
1232 2954702702
1233 2954718455
1234 2954728425
1235 2954733384
1236 2954747321
1237 2954752267
1238 2966604511
1239 2990059657
1240 2990091134
1241 3006487440
1242 8008486878
1243 8008561232
1244 8025414885
1245 8025526135
1246 8025535396
1247 8033685515
1248 8048408090
1249 8054162087
1250 8055162683
1251 8056669570
1252 8056835792

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

24

188

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.8172 10 249
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.8124 9 249
5eke-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.7808 5 210
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.7731 9 249
5ekp-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.7685 5 210
ID Description Score Start End Superfamily
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9557 4 253 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9409 4 253 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8821 10 233 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8768 13 239 3.90.550.10
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8744 11 233 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A2C8B7B8-F1-model_v4 ApolipoproteiN n-acyltransferase Lnt/dolichol-phosphate-mannosyl transferase Dpm1 0.988 9 252 GO:0004582
GO:0009247
GO:0016020
GO:0016746
AF-A0A1W9GKS7-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9877 12 239 GO:0004582
GO:0009247
GO:0016020
AF-A0A7V9KKX8-F1-model_v4 Polyprenol monophosphomannose synthase 0.9869 5 203 GO:0004582
GO:0009247
GO:0016020
AF-A0A5J4KNB5-F1-model_v4 Dolichol-phosphate mannosyltransferase 0.9865 10 240 GO:0004582
GO:0009247
GO:0016020
AF-A0A7I8EGP5-F1-model_v4 Dolichyl-phosphate beta-D-mannosyltransferase 0.9857 10 239 GO:0004582
GO:0009247
GO:0016020

Map