F470476

General Info

Members Datasets Scaffolds Average Seq Length
626 320 1252 101

Family's Representative Sequence

Representative Sequence 3300034816|Ga0373930_0065263|Ga0373930_0065263_136_468
Length 110
Sequence MARQLRVSGSMKVRIYKPAKTAMQSGQAKTKEWLLESEPTPKILDPLMGWTGSRDTMQQVQLWFHTLDEAKAHAEKNGWQFTVEQPHQRHIRPKAYADNFAYTRVGRWTH

Samples

Sample ID Description Type Environment
1 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
181 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
182 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
186 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
187 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
188 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
189 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
190 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
191 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
192 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
193 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
194 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
195 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
196 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
197 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
198 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
199 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
200 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
213 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
214 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
215 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
216 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
217 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
218 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
219 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
220 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
221 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
222 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
223 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
224 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
225 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
226 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
227 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
228 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
229 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
230 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
236 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
237 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
238 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
241 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
260 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
271 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
284 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
285 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
286 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
287 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
288 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
289 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
290 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
291 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
292 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
293 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
294 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
295 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
296 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
297 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
298 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
299 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
300 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
301 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
302 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
303 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
304 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
305 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
306 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
307 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
308 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
309 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
310 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
311 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
312 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
313 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
314 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
315 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
316 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
317 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
318 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
319 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
320 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.49
Nodule 0
Rhizoplane 4.63
Rhizosphere 74.6
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373930_0065263 3300034816 Bacteria 819
2 JGI24749J21850_1049240 3300002076 Bacteria 626
3 Ga0070658_10063306 3300005327 Bacteria 3015
4 Ga0070658_10212926 3300005327 Bacteria 1633
5 Ga0070676_10415651 3300005328 Bacteria 939
6 Ga0070683_100007009 3300005329 Bacteria 9486
7 Ga0070690_100959900 3300005330 Bacteria 671
8 Ga0070690_101709309 3300005330 Bacteria 512
9 Ga0070670_101194763 3300005331 Bacteria 695
10 Ga0070677_10188202 3300005333 Bacteria 988
11 Ga0070677_10242239 3300005333 Bacteria 891
12 Ga0070666_10348056 3300005335 Bacteria 1060
13 Ga0070680_100019671 3300005336 Bacteria 5355
14 Ga0070680_100338942 3300005336 Bacteria 1277
15 Ga0070682_101354386 3300005337 Bacteria 607
16 Ga0068868_100564227 3300005338 Bacteria 1005
17 Ga0068868_101559548 3300005338 Bacteria 620
18 Ga0070660_100294350 3300005339 Bacteria 1330
19 Ga0070689_100016405 3300005340 Bacteria 5421
20 Ga0070689_100316709 3300005340 Bacteria 1302
21 Ga0070689_100406608 3300005340 Bacteria 1152
22 Ga0070691_10015786 3300005341 Bacteria 3471
23 Ga0070661_100081622 3300005344 Bacteria 2387
24 Ga0070692_10526039 3300005345 Bacteria 771
25 Ga0070668_100455137 3300005347 Bacteria 1101
26 Ga0070669_100497671 3300005353 Bacteria 1011
27 Ga0070669_101271956 3300005353 Bacteria 637
28 Ga0070675_100119158 3300005354 Bacteria 2242
29 Ga0070675_100288668 3300005354 Bacteria 1443
30 Ga0070675_101148794 3300005354 Bacteria 715
31 Ga0070671_100106948 3300005355 Bacteria 2349
32 Ga0070671_100529148 3300005355 Bacteria 1015
33 Ga0070674_100191250 3300005356 Bacteria 1575
34 Ga0070674_100249834 3300005356 Bacteria 1392
35 Ga0070674_100435816 3300005356 Bacteria 1079
36 Ga0070673_100349684 3300005364 Bacteria 1312
37 Ga0070673_100581820 3300005364 Bacteria 1020
38 Ga0070673_100838016 3300005364 Bacteria 851
39 Ga0070673_102261616 3300005364 Bacteria 517
40 Ga0070688_100058977 3300005365 Bacteria 2419
41 Ga0070688_100717703 3300005365 Bacteria 776
42 Ga0070659_100520420 3300005366 Bacteria 1016
43 Ga0070659_100796877 3300005366 Bacteria 821
44 Ga0070659_102022037 3300005366 Bacteria 517
45 Ga0070667_101202097 3300005367 Bacteria 710
46 Ga0070709_10744330 3300005434 Bacteria 766
47 Ga0070713_100682775 3300005436 Bacteria 980
48 Ga0070710_10064189 3300005437 Bacteria 2100
49 Ga0070701_10540693 3300005438 Bacteria 763
50 Ga0070711_100222968 3300005439 Bacteria 1466
51 Ga0070700_100263206 3300005441 Bacteria 1243
52 Ga0070700_100432951 3300005441 Bacteria 997
53 Ga0070663_101914706 3300005455 Bacteria 533
54 Ga0070678_100044681 3300005456 Bacteria 3165
55 Ga0070678_100110306 3300005456 Bacteria 2152
56 Ga0070678_100373628 3300005456 Bacteria 1232
57 Ga0070678_100561250 3300005456 Bacteria 1015
58 Ga0070681_10011836 3300005458 Bacteria 8649
59 Ga0070681_10327441 3300005458 Bacteria 1442
60 Ga0070685_10357181 3300005466 Bacteria 1001
61 Ga0070685_10712599 3300005466 Bacteria 733
62 Ga0070679_100008662 3300005530 Bacteria 9586
63 Ga0070679_100113235 3300005530 Bacteria 2698
64 Ga0070684_100230369 3300005535 Bacteria 1691
65 Ga0070684_101038181 3300005535 Bacteria 770
66 Ga0068853_100103209 3300005539 Bacteria 2524
67 Ga0070672_100086569 3300005543 Bacteria 2520
68 Ga0070672_100373513 3300005543 Bacteria 1219
69 Ga0070672_101156666 3300005543 Bacteria 689
70 Ga0070672_101594070 3300005543 Bacteria 586
71 Ga0070686_100178859 3300005544 Bacteria 1506
72 Ga0070686_100582209 3300005544 Bacteria 880
73 Ga0070686_100934270 3300005544 Bacteria 708
74 Ga0070686_101303619 3300005544 Bacteria 607
75 Ga0070696_100887644 3300005546 Bacteria 739
76 Ga0070693_100479349 3300005547 Bacteria 879
77 Ga0070665_100060881 3300005548 Bacteria 3784
78 Ga0070665_100557821 3300005548 Bacteria 1158
79 Ga0070665_102468884 3300005548 Bacteria 521
80 Ga0070704_101425931 3300005549 Bacteria 636
81 Ga0068855_100009168 3300005563 Bacteria 11950
82 Ga0068855_100347368 3300005563 Bacteria 1635
83 Ga0068855_101813728 3300005563 Bacteria 620
84 Ga0070664_100068048 3300005564 Bacteria 3044
85 Ga0068857_100071335 3300005577 Bacteria 3095
86 Ga0068856_100007944 3300005614 Bacteria 10359
87 Ga0068856_100143336 3300005614 Bacteria 2397
88 Ga0068856_100793686 3300005614 Bacteria 967
89 Ga0068852_100064619 3300005616 Bacteria 3190
90 Ga0068859_100035263 3300005617 Bacteria 5020
91 Ga0068864_100027180 3300005618 Bacteria 4829
92 Ga0068864_100232877 3300005618 Bacteria 1704
93 Ga0068866_10198231 3300005718 Bacteria 1198
94 Ga0068861_100190339 3300005719 Bacteria 1715
95 Ga0068861_100540769 3300005719 Bacteria 1060
96 Ga0068861_101569777 3300005719 Bacteria 648
97 Ga0068851_10337019 3300005834 Bacteria 875
98 Ga0068870_10680923 3300005840 Bacteria 707
99 Ga0068863_100354239 3300005841 Bacteria 1430
100 Ga0068863_100481050 3300005841 Bacteria 1221
101 Ga0068858_100803537 3300005842 Bacteria 918
102 Ga0068858_101117088 3300005842 Bacteria 774
103 Ga0068858_101311349 3300005842 Bacteria 713
104 Ga0068860_100056230 3300005843 Bacteria 3742
105 Ga0068860_100542165 3300005843 Bacteria 1165
106 Ga0068860_101455121 3300005843 Bacteria 707
107 Ga0068860_101575864 3300005843 Bacteria 679
108 Ga0068862_100213585 3300005844 Bacteria 1744
109 Ga0068862_100841237 3300005844 Bacteria 899
110 Ga0068862_101138757 3300005844 Bacteria 777
111 Ga0068862_101182433 3300005844 Bacteria 763
112 Ga0081455_10001698 3300005937 Bacteria 26658
113 Ga0081455_10073855 3300005937 Bacteria 2818
114 Ga0081540_1208180 3300005983 Bacteria 705
115 Ga0081539_10007943 3300005985 Bacteria 9447
116 Ga0070717_10731102 3300006028 Bacteria 900
117 Ga0075365_10033370 3300006038 Bacteria 3316
118 Ga0075365_10276083 3300006038 Bacteria 1182
119 Ga0075365_10338432 3300006038 Bacteria 1060
120 Ga0075365_10928666 3300006038 Bacteria 613
121 Ga0075368_10018184 3300006042 Bacteria 2639
122 Ga0075368_10049228 3300006042 Bacteria 1671
123 Ga0075368_10140886 3300006042 Bacteria 1005
124 Ga0075368_10369981 3300006042 Bacteria 626
125 Ga0075363_100055210 3300006048 Bacteria 2127
126 Ga0075363_100321810 3300006048 Bacteria 900
127 Ga0075363_100957834 3300006048 Unclassified 526
128 Ga0075364_10003494 3300006051 Bacteria 8946
129 Ga0075364_10064137 3300006051 Bacteria 2411
130 Ga0075364_10072536 3300006051 Bacteria 2269
131 Ga0075364_10140630 3300006051 Bacteria 1623
132 Ga0075364_10171067 3300006051 Bacteria 1469
133 Ga0075364_10226081 3300006051 Bacteria 1271
134 Ga0075364_10580941 3300006051 Bacteria 766
135 Ga0070715_10066538 3300006163 Bacteria 1598
136 Ga0070715_10264623 3300006163 Bacteria 905
137 Ga0070716_101127803 3300006173 Bacteria 627
138 Ga0070712_101962031 3300006175 Bacteria 513
139 Ga0075362_10006769 3300006177 Bacteria 4285
140 Ga0075362_10008536 3300006177 Bacteria 3922
141 Ga0075362_10062598 3300006177 Bacteria 1686
142 Ga0075362_10111543 3300006177 Bacteria 1288
143 Ga0075362_10184086 3300006177 Bacteria 1013
144 Ga0075362_10786597 3300006177 Bacteria 500
145 Ga0075367_10007145 3300006178 Bacteria 5697
146 Ga0075367_10119614 3300006178 Bacteria 1622
147 Ga0075367_10291550 3300006178 Bacteria 1026
148 Ga0075367_10377449 3300006178 Bacteria 896
149 Ga0075367_10670550 3300006178 Bacteria 659
150 Ga0075367_10839149 3300006178 Bacteria 586
151 Ga0075369_10031658 3300006186 Bacteria 2234
152 Ga0075369_10037010 3300006186 Bacteria 2078
153 Ga0075369_10068757 3300006186 Bacteria 1557
154 Ga0075369_10158909 3300006186 Bacteria 1035
155 Ga0075369_10564459 3300006186 Bacteria 543
156 Ga0075366_10005248 3300006195 Bacteria 7013
157 Ga0075366_10012744 3300006195 Bacteria 4776
158 Ga0075366_10089426 3300006195 Bacteria 1844
159 Ga0075366_10119378 3300006195 Bacteria 1588
160 Ga0075366_10241859 3300006195 Bacteria 1100
161 Ga0075366_10319239 3300006195 Bacteria 951
162 Ga0075366_10815417 3300006195 Bacteria 581
163 Ga0075366_10951073 3300006195 Bacteria 536
164 Ga0097621_100148017 3300006237 Bacteria 2012
165 Ga0097621_102158938 3300006237 Bacteria 533
166 Ga0075370_10010139 3300006353 Bacteria 4912
167 Ga0075370_10404047 3300006353 Unclassified 819
168 Ga0075370_10546206 3300006353 Bacteria 701
169 Ga0068871_100235579 3300006358 Bacteria 1590
170 Ga0068871_101173229 3300006358 Bacteria 720
171 Ga0075434_100354169 3300006871 Bacteria 1489
172 Ga0075429_100854058 3300006880 Bacteria 797
173 Ga0068865_100083712 3300006881 Bacteria 2297
174 Ga0068865_100205151 3300006881 Bacteria 1533
175 Ga0097620_100035263 3300006931 Bacteria 5020
176 Ga0099794_10341851 3300007265 Bacteria 778
177 Ga0099795_10615304 3300007788 Unclassified 518
178 Ga0105240_10006208 3300009093 Bacteria 17574
179 Ga0105240_10045983 3300009093 Bacteria 5534
180 Ga0105240_10723892 3300009093 Bacteria 1084
181 Ga0111539_10018297 3300009094 Bacteria 8679
182 Ga0111539_12764036 3300009094 Bacteria 569
183 Ga0111539_12768537 3300009094 Bacteria 568
184 Ga0111539_13003127 3300009094 Bacteria 545
185 Ga0111539_13291305 3300009094 Bacteria 520
186 Ga0105245_10521325 3300009098 Bacteria 1207
187 Ga0105245_11155810 3300009098 Bacteria 821
188 Ga0105245_11959181 3300009098 Bacteria 639
189 Ga0105245_12023025 3300009098 Bacteria 629
190 Ga0105245_12706911 3300009098 Bacteria 549
191 Ga0105247_10173878 3300009101 Bacteria 1434
192 Ga0105247_10613621 3300009101 Bacteria 808
193 Ga0105247_10641778 3300009101 Bacteria 792
194 Ga0114129_10551156 3300009147 Bacteria 1499
195 Ga0114129_11380940 3300009147 Bacteria 870
196 Ga0114129_13162638 3300009147 Bacteria 536
197 Ga0105243_11495742 3300009148 Bacteria 699
198 Ga0105243_12290672 3300009148 Bacteria 578
199 Ga0105243_12681990 3300009148 Bacteria 538
200 Ga0105243_12754218 3300009148 Bacteria 532
201 Ga0105241_12024271 3300009174 Bacteria 567
202 Ga0105241_12090043 3300009174 Bacteria 559
203 Ga0105242_11546071 3300009176 Bacteria 695
204 Ga0105242_11855221 3300009176 Bacteria 642
205 Ga0105242_12315941 3300009176 Bacteria 584
206 Ga0105248_10017324 3300009177 Bacteria 7940
207 Ga0105248_10272846 3300009177 Bacteria 1904
208 Ga0105248_11814449 3300009177 Bacteria 692
209 Ga0105248_11986468 3300009177 Bacteria 661
210 Ga0105237_10150295 3300009545 Bacteria 2325
211 Ga0105237_10153651 3300009545 Bacteria 2298
212 Ga0105237_10264116 3300009545 Bacteria 1724
213 Ga0105238_10050694 3300009551 Bacteria 4178
214 Ga0105238_10281037 3300009551 Bacteria 1646
215 Ga0105238_10483534 3300009551 Bacteria 1238
216 Ga0105238_12448134 3300009551 Bacteria 558
217 Ga0105249_10744045 3300009553 Bacteria 1042
218 Ga0105249_11654353 3300009553 Bacteria 713
219 Ga0105249_12123941 3300009553 Bacteria 634
220 Ga0099796_10129655 3300010159 Bacteria 977
221 Ga0105239_10297747 3300010375 Bacteria 1817
222 Ga0105239_11348321 3300010375 Bacteria 823
223 Ga0105239_11658198 3300010375 Bacteria 740
224 Ga0105246_10421761 3300011119 Bacteria 1114
225 Ga0105246_10759808 3300011119 Bacteria 856
226 Ga0105246_10908138 3300011119 Bacteria 790
227 Ga0105246_11008002 3300011119 Bacteria 754
228 Ga0105246_11302426 3300011119 Bacteria 673
229 Ga0105246_12312711 3300011119 Bacteria 525
230 Ga0157373_11324934 3300013100 Bacteria 546
231 Ga0157371_10061894 3300013102 Bacteria 2654
232 Ga0157370_10081370 3300013104 Bacteria 3047
233 Ga0157370_10641490 3300013104 Bacteria 971
234 Ga0157369_10243580 3300013105 Bacteria 1877
235 Ga0157374_11231164 3300013296 Bacteria 770
236 Ga0157378_10518628 3300013297 Bacteria 1193
237 Ga0157378_10590579 3300013297 Bacteria 1120
238 Ga0163162_10095722 3300013306 Bacteria 3056
239 Ga0163162_11231776 3300013306 Bacteria 850
240 Ga0163162_11537024 3300013306 Bacteria 758
241 Ga0163162_12700645 3300013306 Bacteria 571
242 Ga0157372_10347993 3300013307 Bacteria 1727
243 Ga0157375_10420291 3300013308 Bacteria 1503
244 Ga0157375_12155529 3300013308 Bacteria 664
245 Ga0157375_12540293 3300013308 Bacteria 612
246 Ga0157375_13408741 3300013308 Bacteria 529
247 Ga0163163_10044533 3300014325 Bacteria 4354
248 Ga0163163_10640569 3300014325 Bacteria 1126
249 Ga0163163_12074273 3300014325 Bacteria 628
250 Ga0163163_12723439 3300014325 Bacteria 551
251 Ga0157380_10623227 3300014326 Bacteria 1071
252 Ga0157380_11782595 3300014326 Bacteria 674
253 Ga0157380_12537899 3300014326 Bacteria 578
254 Ga0182008_10032676 3300014497 Bacteria 2613
255 Ga0157377_10646941 3300014745 Bacteria 760
256 Ga0157377_11029907 3300014745 Bacteria 626
257 Ga0157379_10051335 3300014968 Bacteria 3684
258 Ga0157379_10758980 3300014968 Bacteria 913
259 Ga0157379_12399181 3300014968 Bacteria 526
260 Ga0157376_10334995 3300014969 Bacteria 1443
261 Ga0157376_10586944 3300014969 Bacteria 1107
262 Ga0157376_10927713 3300014969 Bacteria 890
263 Ga0157376_11860474 3300014969 Bacteria 639
264 Ga0182005_1228293 3300015265 Bacteria 569
265 Ga0163161_10164066 3300017792 Bacteria 1696
266 Ga0163161_10584621 3300017792 Bacteria 919
267 Ga0163161_11237054 3300017792 Bacteria 647
268 Ga0163161_11312753 3300017792 Bacteria 629
269 Ga0206356_10916934 3300020070 Bacteria 752
270 Ga0213872_10395255 3300021361 Bacteria 561
271 Ga0207697_10214177 3300025315 Bacteria 849
272 Ga0207682_10174812 3300025893 Bacteria 978
273 Ga0207682_10458330 3300025893 Bacteria 604
274 Ga0207692_10345121 3300025898 Bacteria 917
275 Ga0207710_10285287 3300025900 Bacteria 831
276 Ga0207680_10165721 3300025903 Bacteria 1485
277 Ga0207680_11011128 3300025903 Bacteria 595
278 Ga0207680_11017689 3300025903 Bacteria 593
279 Ga0207647_10503944 3300025904 Bacteria 675
280 Ga0207685_10026251 3300025905 Bacteria 2023
281 Ga0207699_10361153 3300025906 Bacteria 1027
282 Ga0207645_10381332 3300025907 Bacteria 946
283 Ga0207705_10008414 3300025909 Bacteria 7532
284 Ga0207705_10266173 3300025909 Unclassified 1310
285 Ga0207705_10452637 3300025909 Bacteria 995
286 Ga0207654_10648125 3300025911 Bacteria 756
287 Ga0207707_10012111 3300025912 Bacteria 7498
288 Ga0207707_11132485 3300025912 Bacteria 636
289 Ga0207707_11219049 3300025912 Bacteria 608
290 Ga0207695_10075060 3300025913 Bacteria 3441
291 Ga0207695_10464880 3300025913 Bacteria 1148
292 Ga0207671_10175339 3300025914 Bacteria 1666
293 Ga0207693_10535095 3300025915 Bacteria 914
294 Ga0207663_10306749 3300025916 Bacteria 1188
295 Ga0207663_10395135 3300025916 Bacteria 1056
296 Ga0207660_10011800 3300025917 Bacteria 5696
297 Ga0207660_11702519 3300025917 Bacteria 507
298 Ga0207657_10113231 3300025919 Bacteria 2239
299 Ga0207657_10292237 3300025919 Bacteria 1292
300 Ga0207649_10068640 3300025920 Bacteria 2255
301 Ga0207652_10037437 3300025921 Bacteria 4106
302 Ga0207652_10182246 3300025921 Bacteria 1887
303 Ga0207681_10786612 3300025923 Bacteria 794
304 Ga0207694_10192589 3300025924 Bacteria 1657
305 Ga0207694_10212713 3300025924 Bacteria 1575
306 Ga0207650_11792327 3300025925 Bacteria 519
307 Ga0207659_10161900 3300025926 Bacteria 1758
308 Ga0207659_11306501 3300025926 Bacteria 623
309 Ga0207687_11367153 3300025927 Bacteria 609
310 Ga0207687_11686787 3300025927 Bacteria 543
311 Ga0207700_10008440 3300025928 Bacteria 6382
312 Ga0207664_10434484 3300025929 Bacteria 1170
313 Ga0207644_10162746 3300025931 Bacteria 1736
314 Ga0207644_10585844 3300025931 Bacteria 925
315 Ga0207690_10143478 3300025932 Bacteria 1762
316 Ga0207706_10293843 3300025933 Bacteria 1416
317 Ga0207670_10000705 3300025936 Bacteria 17626
318 Ga0207670_10329065 3300025936 Bacteria 1204
319 Ga0207670_10413081 3300025936 Bacteria 1081
320 Ga0207670_10912054 3300025936 Bacteria 736
321 Ga0207669_10283627 3300025937 Bacteria 1250
322 Ga0207669_11171281 3300025937 Bacteria 650
323 Ga0207669_11209087 3300025937 Bacteria 640
324 Ga0207704_10026299 3300025938 Bacteria 3191
325 Ga0207704_11224046 3300025938 Bacteria 641
326 Ga0207665_10061952 3300025939 Bacteria 2537
327 Ga0207691_10106662 3300025940 Bacteria 2495
328 Ga0207691_10372591 3300025940 Bacteria 1219
329 Ga0207691_11206018 3300025940 Bacteria 627
330 Ga0207691_11560314 3300025940 Bacteria 538
331 Ga0207711_10004964 3300025941 Bacteria 11291
332 Ga0207711_10538770 3300025941 Bacteria 1089
333 Ga0207711_11514318 3300025941 Bacteria 614
334 Ga0207689_10369561 3300025942 Bacteria 1193
335 Ga0207679_10123452 3300025945 Bacteria 2065
336 Ga0207667_10113151 3300025949 Bacteria 2798
337 Ga0207667_10138217 3300025949 Bacteria 2509
338 Ga0207667_12161519 3300025949 Bacteria 514
339 Ga0207651_10276732 3300025960 Bacteria 1385
340 Ga0207658_10083309 3300025986 Bacteria 2458
341 Ga0207677_10608558 3300026023 Bacteria 960
342 Ga0207677_11781324 3300026023 Bacteria 571
343 Ga0207703_10822675 3300026035 Bacteria 887
344 Ga0207703_10994670 3300026035 Bacteria 805
345 Ga0207703_11657520 3300026035 Bacteria 615
346 Ga0207639_10805376 3300026041 Bacteria 875
347 Ga0207708_10135468 3300026075 Bacteria 1929
348 Ga0207708_10425357 3300026075 Bacteria 1102
349 Ga0207702_10023630 3300026078 Bacteria 5099
350 Ga0207702_10088867 3300026078 Bacteria 2701
351 Ga0207702_10739050 3300026078 Bacteria 971
352 Ga0207641_11002057 3300026088 Bacteria 832
353 Ga0207648_10150978 3300026089 Bacteria 2050
354 Ga0207648_12262167 3300026089 Bacteria 504
355 Ga0207676_10022058 3300026095 Bacteria 4680
356 Ga0207674_10140469 3300026116 Bacteria 2374
357 Ga0207675_100259669 3300026118 Bacteria 1683
358 Ga0207675_101975701 3300026118 Bacteria 601
359 Ga0207675_102085529 3300026118 Bacteria 584
360 Ga0207683_10049337 3300026121 Bacteria 3685
361 Ga0207683_10087939 3300026121 Bacteria 2763
362 Ga0207683_10612391 3300026121 Bacteria 1008
363 Ga0207683_11046628 3300026121 Bacteria 757
364 Ga0207683_11769170 3300026121 Bacteria 567
365 Ga0207683_12108521 3300026121 Bacteria 512
366 Ga0207698_11210706 3300026142 Bacteria 769
367 Ga0209813_10007760 3300027866 Bacteria 2684
368 Ga0209813_10038656 3300027866 Bacteria 1443
369 Ga0209813_10077663 3300027866 Bacteria 1092
370 Ga0209813_10099275 3300027866 Bacteria 988
371 Ga0207428_10188072 3300027907 Bacteria 1557
372 Ga0268266_10020562 3300028379 Bacteria 5624
373 Ga0268266_10081341 3300028379 Bacteria 2824
374 Ga0268265_10603009 3300028380 Bacteria 1050
375 Ga0268265_11708513 3300028380 Bacteria 635
376 Ga0268264_10054720 3300028381 Bacteria 3333
377 Ga0268264_11219528 3300028381 Bacteria 762
378 Ga0265325_10000126 3300031241 Bacteria 52410
379 Ga0265325_10144476 3300031241 Bacteria 1129
380 Ga0265340_10195198 3300031247 Bacteria 912
381 Ga0265340_10216363 3300031247 Bacteria 859
382 Ga0265339_10098293 3300031249 Bacteria 1527
383 Ga0265331_10133547 3300031250 Bacteria 1131
384 Ga0265313_10379953 3300031595 Bacteria 556
385 Ga0265314_10164767 3300031711 Bacteria 1345
386 Ga0307409_102700844 3300031995 Bacteria 525
387 Ga0307411_12297054 3300032005 Bacteria 507
388 Ga0373930_0050353 3300034816 Bacteria 908
389 Ga0373948_0028198 3300034817 Bacteria 1116
390 Ga0373950_0132727 3300034818 Bacteria 559
391 Ga0373958_0004094 3300034819 Bacteria 2141
392 Ga0373959_0171862 3300034820 Bacteria 559
393 Ga0373938_0017133 3300034957 Bacteria 1424
394 Ga0373928_0047734 3300035084 Bacteria 1003
395 Ga0373929_0064432 3300035085 Bacteria 865
396 Ga0373940_0166877 3300035088 Bacteria 710
397 Ga0373932_0324862 3300035112 Unclassified 580
398 Ga0373939_0010416 3300035114 Bacteria 2325
399 Ga0373939_0285783 3300035114 Bacteria 653
400 Ga0373941_0399292 3300035115 Bacteria 568
401 Ga0373945_0289615 3300035116 Bacteria 699
402 Ga0373960_0059158 3300035121 Bacteria 1158
403 Ga0373942_0047204 3300035207 Bacteria 1196
404 Ga0373942_0100355 3300035207 Bacteria 884
405 Ga0373942_0129379 3300035207 Bacteria 795
406 Ga0373961_0017662 3300035241 Bacteria 1855
407 Ga0373962_0218262 3300035242 Bacteria 651
408 Ga0373931_0001501 3300035691 Bacteria 10046
409 Ga0373931_0021036 3300035691 Bacteria 3269
410 Ga0373931_0129872 3300035691 Bacteria 1449
411 Ga0373931_0311114 3300035691 Bacteria 975
412 Ga0373931_0650884 3300035691 Bacteria 692
413 Ga0373935_0644265 3300035692 Bacteria 777
414 Ga0373927_0016179 3300035695 Bacteria 4922
415 Ga0373927_0199318 3300035695 Bacteria 1314
416 Ga0373927_0961315 3300035695 Bacteria 564
417 Ga0373933_0213399 3300035724 Bacteria 1237
418 Ga0373937_0755359 3300036401 Bacteria 920
419 Ga0373937_1266438 3300036401 Bacteria 686
420 Ga0373925_0137220 3300037068 Bacteria 1912
421 Ga0373925_0357993 3300037068 Bacteria 1186
422 Ga0373925_1184591 3300037068 Bacteria 628
423 Ga0395899_0009531 3300037312 Bacteria 7455
424 Ga0395899_0150578 3300037312 Bacteria 1649
425 Ga0395899_0767716 3300037312 Bacteria 598
426 Ga0395900_0001262 3300037418 Bacteria 30960
427 Ga0395900_0023451 3300037418 Bacteria 6316
428 Ga0395900_0070977 3300037418 Bacteria 3580
429 Ga0395898_0123461 3300037466 Bacteria 2481
430 Ga0395901_0007515 3300038443 Bacteria 11004
431 Ga0395901_0026827 3300038443 Bacteria 5915
432 Ga0395901_0035220 3300038443 Bacteria 5172
433 Ga0436365_1743638 3300039437 Bacteria 515
434 Ga0436365_1844784 3300039437 Bacteria 837
435 Ga0436360_0753824 3300039438 Bacteria 841
436 Ga0436360_0953749 3300039438 Bacteria 5249
437 Ga0436361_0326736 3300039447 Bacteria 634
438 Ga0436361_1108206 3300039447 Bacteria 1075
439 Ga0436363_1456337 3300039450 Bacteria 814
440 Ga0436362_0735027 3300039453 Bacteria 591
441 Ga0436362_1192524 3300039453 Bacteria 784
442 Ga0439453_0006761 3300041408 Bacteria 1798
443 Ga0451791_1093831 3300041451 Bacteria 660
444 Ga0451802_1673099 3300041460 Bacteria 610
445 Ga0451807_0002414 3300041486 Unclassified 627
446 Ga0451807_0811399 3300041486 Bacteria 1087
447 Ga0451835_1197112 3300041492 Bacteria 682
448 Ga0451837_0541161 3300041494 Bacteria 505
449 Ga0451841_0675298 3300041498 Bacteria 714
450 Ga0451845_0445836 3300041501 Bacteria 560
451 Ga0439435_0012397 3300042436 Bacteria 2065
452 Ga0439459_0074935 3300042438 Bacteria 789
453 Ga0439460_0096640 3300042461 Bacteria 944
454 Ga0466963_0039690 3300044694 Bacteria 3084
455 Ga0466971_0148953 3300044719 Bacteria 1092
456 Ga0466957_0169861 3300044842 Bacteria 1420
457 Ga0466959_0493796 3300045049 Bacteria 828
458 Ga0451576_1468704 3300045051 Bacteria 709
459 Ga0466967_0497937 3300045976 Bacteria 1195
460 Ga0495638_0560161 3300046460 Bacteria 567
461 Ga0495628_0185113 3300046516 Bacteria 1574
462 Ga0495587_0623181 3300046536 Bacteria 593
463 Ga0495598_0402377 3300046537 Bacteria 535
464 Ga0495621_0139142 3300046539 Bacteria 949
465 Ga0495656_0170525 3300046615 Bacteria 1064
466 Ga0495658_0755483 3300046683 Bacteria 623
467 Ga0495669_0320940 3300046684 Bacteria 747
468 Ga0495649_0385312 3300046694 Bacteria 705
469 Ga0495676_0645377 3300047321 Unclassified 687
470 Ga0495680_0416958 3300047322 Bacteria 924
471 Ga0495602_0704449 3300048088 Bacteria 685
472 Ga0496100_0068498 3300048903 Bacteria 2360
473 Ga0496101_0051229 3300048904 Bacteria 2974
474 Ga0496101_0786216 3300048904 Bacteria 751
475 Ga0496102_0053023 3300048905 Bacteria 3697
476 Ga0496102_1566784 3300048905 Bacteria 577
477 Ga0496104_0079211 3300048907 Bacteria 3131
478 Ga0496105_0008367 3300048908 Bacteria 8038
479 Ga0496106_0086305 3300048909 Bacteria 2417
480 Ga0496106_0553205 3300048909 Bacteria 923
481 Ga0496107_0256481 3300048910 Bacteria 1301
482 Ga0496108_0072046 3300048911 Bacteria 2916
483 Ga0496109_0373196 3300048912 Bacteria 1347
484 Ga0496110_0016576 3300048913 Bacteria 6153
485 Ga0496110_1191256 3300048913 Bacteria 670
486 Ga0496111_0087019 3300048914 Bacteria 2287
487 Ga0496112_0218095 3300048915 Bacteria 1864
488 Ga0496112_0248023 3300048915 Bacteria 1732
489 Ga0496112_0565491 3300048915 Bacteria 1070
490 Ga0496112_1758798 3300048915 Bacteria 532
491 Ga0496113_0193906 3300048916 Bacteria 1613
492 Ga0496113_0537594 3300048916 Bacteria 938
493 Ga0496113_0806697 3300048916 Bacteria 746
494 Ga0496114_0071218 3300048917 Bacteria 2921
495 Ga0496114_1687704 3300048917 Bacteria 522
496 Ga0496115_0179513 3300048918 Bacteria 1750
497 Ga0496126_0139878 3300048929 Bacteria 2085
498 Ga0501033_0209868 3300049570 Bacteria 1389
499 Ga0501033_0278547 3300049570 Bacteria 1181
500 Ga0501034_0005785 3300049571 Bacteria 13447
501 Ga0501034_0138972 3300049571 Bacteria 2409
502 Ga0501034_1041554 3300049571 Bacteria 701
503 Ga0501034_1139652 3300049571 Bacteria 660
504 Ga0501036_0571554 3300049572 Bacteria 939
505 Ga0501037_0275228 3300049573 Bacteria 1174
506 Ga0501040_0308248 3300049576 Bacteria 1132
507 Ga0501043_0238132 3300049579 Bacteria 1404
508 Ga0501043_0358316 3300049579 Bacteria 1107
509 Ga0501046_0066311 3300049580 Bacteria 2814
510 Ga0501047_0133012 3300049581 Bacteria 2367
511 Ga0501047_0256232 3300049581 Bacteria 1598
512 Ga0501047_1418521 3300049581 Bacteria 510
513 Ga0501048_0179724 3300049582 Bacteria 1500
514 Ga0501067_0264323 3300049583 Bacteria 958
515 Ga0501069_0181364 3300049585 Bacteria 1217
516 Ga0501069_0279599 3300049585 Bacteria 976
517 Ga0501070_0187714 3300049586 Bacteria 1700
518 Ga0501070_1539062 3300049586 Bacteria 502
519 Ga0501072_0828914 3300049588 Bacteria 724
520 Ga0501072_1007032 3300049588 Bacteria 649
521 Ga0501073_0100413 3300049589 Bacteria 2009
522 Ga0501073_0107560 3300049589 Bacteria 1935
523 Ga0501073_0235133 3300049589 Bacteria 1266
524 Ga0501073_0264551 3300049589 Bacteria 1187
525 Ga0501073_0336406 3300049589 Bacteria 1042
526 Ga0501073_0644729 3300049589 Bacteria 731
527 Ga0501073_0732990 3300049589 Bacteria 682
528 Ga0501074_0199465 3300049590 Bacteria 1426
529 Ga0501076_0768957 3300049592 Bacteria 795
530 Ga0501230_116561 3300049667 Bacteria 588
531 Ga0501079_0613520 3300049741 Bacteria 856
532 Ga0501080_0137502 3300049742 Bacteria 2260
533 Ga0501080_1016093 3300049742 Bacteria 719
534 Ga0501083_0222582 3300049744 Bacteria 1229
535 Ga0501035_0508892 3300049822 Bacteria 990
536 Ga0501035_1001210 3300049822 Bacteria 657
537 Ga0501044_0106946 3300049823 Bacteria 2809
538 Ga0501044_0268742 3300049823 Bacteria 1642
539 Ga0501044_0456748 3300049823 Bacteria 1183
540 nmdc:mga03683_242084_c1 3300050489 Bacteria 836
541 nmdc:mga03683_242828_c1 3300050489 Bacteria 835
542 nmdc:mga03683_252466_c1 3300050489 Bacteria 819
543 nmdc:mga03683_263455_c1 3300050489 Bacteria 803
544 nmdc:mga03683_2754_c1 3300050489 Bacteria 5517
545 nmdc:mga03683_374253_c1 3300050489 Bacteria 677
546 nmdc:mga03683_391361_c1 3300050489 Bacteria 663
547 nmdc:mga03683_465155_c1 3300050489 Bacteria 610
548 nmdc:mga03683_47296_c1 3300050489 Bacteria 1785
549 nmdc:mga03683_55978_c1 3300050489 Bacteria 1657
550 nmdc:mga03683_572627_c1 3300050489 Bacteria 551
551 nmdc:mga03683_603744_c1 3300050489 Bacteria 537
552 nmdc:mga03683_705512_c1 3300050489 Bacteria 500
553 nmdc:mga03n38_39577_c1 3300050490 Bacteria 2045
554 nmdc:mga03n38_406174_c1 3300050490 Bacteria 751
555 nmdc:mga00v17_1020710_c1 3300050491 Bacteria 520
556 nmdc:mga00v17_121337_c1 3300050491 Bacteria 1664
557 nmdc:mga00v17_484715_c1 3300050491 Bacteria 802
558 nmdc:mga00v17_8746_c1 3300050491 Bacteria 5454
559 nmdc:mga0yw44_1000447_c1 3300050492 Bacteria 566
560 nmdc:mga0yw44_114658_c1 3300050492 Bacteria 1730
561 nmdc:mga0yw44_123301_c1 3300050492 Bacteria 1671
562 nmdc:mga0yw44_162590_c1 3300050492 Bacteria 1462
563 nmdc:mga0yw44_184102_c1 3300050492 Bacteria 1376
564 nmdc:mga0yw44_265765_c1 3300050492 Bacteria 1144
565 nmdc:mga0yw44_567974_c1 3300050492 Bacteria 770
566 nmdc:mga0k408_187718_c1 3300050493 Bacteria 1233
567 nmdc:mga0k408_272556_c1 3300050493 Bacteria 1010
568 nmdc:mga0k408_285203_c1 3300050493 Bacteria 986
569 nmdc:mga0k408_68583_c1 3300050493 Bacteria 2069
570 nmdc:mga06z11_209700_c1 3300050494 Bacteria 1135
571 nmdc:mga06z11_90916_c1 3300050494 Bacteria 1657
572 nmdc:mga04h51_117332_c1 3300050495 Bacteria 988
573 nmdc:mga04h51_164960_c1 3300050495 Bacteria 855
574 nmdc:mga04h51_31659_c1 3300050495 Bacteria 1673
575 nmdc:mga04h51_3538_c1 3300050495 Bacteria 3802
576 nmdc:mga04h51_381306_c1 3300050495 Bacteria 587
577 nmdc:mga07m45_29822_c1 3300050496 Bacteria 3020
578 nmdc:mga07m45_338554_c1 3300050496 Bacteria 874
579 nmdc:mga07m45_350260_c1 3300050496 Bacteria 858
580 nmdc:mga07m45_46540_c1 3300050496 Bacteria 2438
581 nmdc:mga07m45_501323_c1 3300050496 Bacteria 703
582 nmdc:mga05p37_1911402_c1 3300050507 Bacteria 566
583 nmdc:mga05p37_325238_c1 3300050507 Bacteria 1818
584 nmdc:mga09592_449036_c1 3300050508 Bacteria 1112
585 nmdc:mga0qj67_701167_c1 3300050509 Bacteria 805
586 nmdc:mga08y16_1200800_c1 3300050511 Bacteria 729
587 nmdc:mga08y16_2053359_c1 3300050511 Bacteria 520
588 nmdc:mga08y16_289960_c1 3300050511 Bacteria 1687
589 nmdc:mga08y16_37367_c1 3300050511 Bacteria 5100
590 nmdc:mga0n895_95716_c1 3300050512 Bacteria 2974
591 nmdc:mga0sz30_25567_c1 3300050516 Bacteria 2414
592 nmdc:mga0sz30_341471_c1 3300050516 Bacteria 669
593 nmdc:mga0sz30_446266_c1 3300050516 Bacteria 581
594 nmdc:mga0sz30_570795_c1 3300050516 Bacteria 511
595 Ga0495601_0626434 3300053077 Bacteria 689
596 Ga0495595_0109533 3300053084 Bacteria 1338
597 Ga0500578_0488963 3300053086 Bacteria 694
598 Ga0500644_0173255 3300053088 Bacteria 879
599 Ga0500646_0052819 3300053090 Bacteria 1177
600 Ga0500647_0035556 3300053091 Bacteria 2381
601 Ga0500651_0440011 3300053093 Bacteria 727
602 Ga0500651_0560565 3300053093 Bacteria 624
603 Ga0500566_0163189 3300053094 Bacteria 1159
604 Ga0500641_0040820 3300053096 Bacteria 1875
605 Ga0500641_0122591 3300053096 Bacteria 1120
606 Ga0500557_055015 3300053105 Bacteria 1283
607 Ga0500595_002972 3300053119 Bacteria 8074
608 Ga0500595_012905 3300053119 Bacteria 3215
609 Ga0500595_037630 3300053119 Bacteria 1577
610 Ga0500597_199399 3300053120 Bacteria 841
611 Ga0500652_000003 3300053131 Bacteria 221528
612 Ga0500655_138867 3300053133 Bacteria 521
613 Ga0500658_0295486 3300053134 Bacteria 745
614 Ga0500568_0017756 3300053139 Bacteria 3132
615 Ga0500616_0012180 3300053153 Bacteria 5040
616 Ga0500616_0039990 3300053153 Bacteria 2525
617 Ga0500616_0044895 3300053153 Bacteria 2357
618 Ga0500627_0080595 3300053158 Bacteria 1451
619 Ga0500611_028122 3300053727 Bacteria 1139
620 Ga0500609_050820 3300053731 Bacteria 576
621 Ga0500552_004195 3300053733 Bacteria 1505
622 Ga0500552_013292 3300053733 Bacteria 1067
623 Ga0501084_0143386 3300054114 Bacteria 2012
624 Ga0501084_0765438 3300054114 Bacteria 813
625 Ga0501082_0185364 3300060353 Bacteria 1811
626 Ga0530510_1186022 3300061734 Bacteria 585
627 Ga0373930_0065263
628 JGI24749J21850_1049240
629 Ga0070658_10063306
630 Ga0070658_10212926
631 Ga0070676_10415651
632 Ga0070683_100007009
633 Ga0070690_100959900
634 Ga0070690_101709309
635 Ga0070670_101194763
636 Ga0070677_10188202
637 Ga0070677_10242239
638 Ga0070666_10348056
639 Ga0070680_100019671
640 Ga0070680_100338942
641 Ga0070682_101354386
642 Ga0068868_100564227
643 Ga0068868_101559548
644 Ga0070660_100294350
645 Ga0070689_100016405
646 Ga0070689_100316709
647 Ga0070689_100406608
648 Ga0070691_10015786
649 Ga0070661_100081622
650 Ga0070692_10526039
651 Ga0070668_100455137
652 Ga0070669_100497671
653 Ga0070669_101271956
654 Ga0070675_100119158
655 Ga0070675_100288668
656 Ga0070675_101148794
657 Ga0070671_100106948
658 Ga0070671_100529148
659 Ga0070674_100191250
660 Ga0070674_100249834
661 Ga0070674_100435816
662 Ga0070673_100349684
663 Ga0070673_100581820
664 Ga0070673_100838016
665 Ga0070673_102261616
666 Ga0070688_100058977
667 Ga0070688_100717703
668 Ga0070659_100520420
669 Ga0070659_100796877
670 Ga0070659_102022037
671 Ga0070667_101202097
672 Ga0070709_10744330
673 Ga0070713_100682775
674 Ga0070710_10064189
675 Ga0070701_10540693
676 Ga0070711_100222968
677 Ga0070700_100263206
678 Ga0070700_100432951
679 Ga0070663_101914706
680 Ga0070678_100044681
681 Ga0070678_100110306
682 Ga0070678_100373628
683 Ga0070678_100561250
684 Ga0070681_10011836
685 Ga0070681_10327441
686 Ga0070685_10357181
687 Ga0070685_10712599
688 Ga0070679_100008662
689 Ga0070679_100113235
690 Ga0070684_100230369
691 Ga0070684_101038181
692 Ga0068853_100103209
693 Ga0070672_100086569
694 Ga0070672_100373513
695 Ga0070672_101156666
696 Ga0070672_101594070
697 Ga0070686_100178859
698 Ga0070686_100582209
699 Ga0070686_100934270
700 Ga0070686_101303619
701 Ga0070696_100887644
702 Ga0070693_100479349
703 Ga0070665_100060881
704 Ga0070665_100557821
705 Ga0070665_102468884
706 Ga0070704_101425931
707 Ga0068855_100009168
708 Ga0068855_100347368
709 Ga0068855_101813728
710 Ga0070664_100068048
711 Ga0068857_100071335
712 Ga0068856_100007944
713 Ga0068856_100143336
714 Ga0068856_100793686
715 Ga0068852_100064619
716 Ga0068859_100035263
717 Ga0068864_100027180
718 Ga0068864_100232877
719 Ga0068866_10198231
720 Ga0068861_100190339
721 Ga0068861_100540769
722 Ga0068861_101569777
723 Ga0068851_10337019
724 Ga0068870_10680923
725 Ga0068863_100354239
726 Ga0068863_100481050
727 Ga0068858_100803537
728 Ga0068858_101117088
729 Ga0068858_101311349
730 Ga0068860_100056230
731 Ga0068860_100542165
732 Ga0068860_101455121
733 Ga0068860_101575864
734 Ga0068862_100213585
735 Ga0068862_100841237
736 Ga0068862_101138757
737 Ga0068862_101182433
738 Ga0081455_10001698
739 Ga0081455_10073855
740 Ga0081540_1208180
741 Ga0081539_10007943
742 Ga0070717_10731102
743 Ga0075365_10033370
744 Ga0075365_10276083
745 Ga0075365_10338432
746 Ga0075365_10928666
747 Ga0075368_10018184
748 Ga0075368_10049228
749 Ga0075368_10140886
750 Ga0075368_10369981
751 Ga0075363_100055210
752 Ga0075363_100321810
753 Ga0075363_100957834
754 Ga0075364_10003494
755 Ga0075364_10064137
756 Ga0075364_10072536
757 Ga0075364_10140630
758 Ga0075364_10171067
759 Ga0075364_10226081
760 Ga0075364_10580941
761 Ga0070715_10066538
762 Ga0070715_10264623
763 Ga0070716_101127803
764 Ga0070712_101962031
765 Ga0075362_10006769
766 Ga0075362_10008536
767 Ga0075362_10062598
768 Ga0075362_10111543
769 Ga0075362_10184086
770 Ga0075362_10786597
771 Ga0075367_10007145
772 Ga0075367_10119614
773 Ga0075367_10291550
774 Ga0075367_10377449
775 Ga0075367_10670550
776 Ga0075367_10839149
777 Ga0075369_10031658
778 Ga0075369_10037010
779 Ga0075369_10068757
780 Ga0075369_10158909
781 Ga0075369_10564459
782 Ga0075366_10005248
783 Ga0075366_10012744
784 Ga0075366_10089426
785 Ga0075366_10119378
786 Ga0075366_10241859
787 Ga0075366_10319239
788 Ga0075366_10815417
789 Ga0075366_10951073
790 Ga0097621_100148017
791 Ga0097621_102158938
792 Ga0075370_10010139
793 Ga0075370_10404047
794 Ga0075370_10546206
795 Ga0068871_100235579
796 Ga0068871_101173229
797 Ga0075434_100354169
798 Ga0075429_100854058
799 Ga0068865_100083712
800 Ga0068865_100205151
801 Ga0097620_100035263
802 Ga0099794_10341851
803 Ga0099795_10615304
804 Ga0105240_10006208
805 Ga0105240_10045983
806 Ga0105240_10723892
807 Ga0111539_10018297
808 Ga0111539_12764036
809 Ga0111539_12768537
810 Ga0111539_13003127
811 Ga0111539_13291305
812 Ga0105245_10521325
813 Ga0105245_11155810
814 Ga0105245_11959181
815 Ga0105245_12023025
816 Ga0105245_12706911
817 Ga0105247_10173878
818 Ga0105247_10613621
819 Ga0105247_10641778
820 Ga0114129_10551156
821 Ga0114129_11380940
822 Ga0114129_13162638
823 Ga0105243_11495742
824 Ga0105243_12290672
825 Ga0105243_12681990
826 Ga0105243_12754218
827 Ga0105241_12024271
828 Ga0105241_12090043
829 Ga0105242_11546071
830 Ga0105242_11855221
831 Ga0105242_12315941
832 Ga0105248_10017324
833 Ga0105248_10272846
834 Ga0105248_11814449
835 Ga0105248_11986468
836 Ga0105237_10150295
837 Ga0105237_10153651
838 Ga0105237_10264116
839 Ga0105238_10050694
840 Ga0105238_10281037
841 Ga0105238_10483534
842 Ga0105238_12448134
843 Ga0105249_10744045
844 Ga0105249_11654353
845 Ga0105249_12123941
846 Ga0099796_10129655
847 Ga0105239_10297747
848 Ga0105239_11348321
849 Ga0105239_11658198
850 Ga0105246_10421761
851 Ga0105246_10759808
852 Ga0105246_10908138
853 Ga0105246_11008002
854 Ga0105246_11302426
855 Ga0105246_12312711
856 Ga0157373_11324934
857 Ga0157371_10061894
858 Ga0157370_10081370
859 Ga0157370_10641490
860 Ga0157369_10243580
861 Ga0157374_11231164
862 Ga0157378_10518628
863 Ga0157378_10590579
864 Ga0163162_10095722
865 Ga0163162_11231776
866 Ga0163162_11537024
867 Ga0163162_12700645
868 Ga0157372_10347993
869 Ga0157375_10420291
870 Ga0157375_12155529
871 Ga0157375_12540293
872 Ga0157375_13408741
873 Ga0163163_10044533
874 Ga0163163_10640569
875 Ga0163163_12074273
876 Ga0163163_12723439
877 Ga0157380_10623227
878 Ga0157380_11782595
879 Ga0157380_12537899
880 Ga0182008_10032676
881 Ga0157377_10646941
882 Ga0157377_11029907
883 Ga0157379_10051335
884 Ga0157379_10758980
885 Ga0157379_12399181
886 Ga0157376_10334995
887 Ga0157376_10586944
888 Ga0157376_10927713
889 Ga0157376_11860474
890 Ga0182005_1228293
891 Ga0163161_10164066
892 Ga0163161_10584621
893 Ga0163161_11237054
894 Ga0163161_11312753
895 Ga0206356_10916934
896 Ga0213872_10395255
897 Ga0207697_10214177
898 Ga0207682_10174812
899 Ga0207682_10458330
900 Ga0207692_10345121
901 Ga0207710_10285287
902 Ga0207680_10165721
903 Ga0207680_11011128
904 Ga0207680_11017689
905 Ga0207647_10503944
906 Ga0207685_10026251
907 Ga0207699_10361153
908 Ga0207645_10381332
909 Ga0207705_10008414
910 Ga0207705_10266173
911 Ga0207705_10452637
912 Ga0207654_10648125
913 Ga0207707_10012111
914 Ga0207707_11132485
915 Ga0207707_11219049
916 Ga0207695_10075060
917 Ga0207695_10464880
918 Ga0207671_10175339
919 Ga0207693_10535095
920 Ga0207663_10306749
921 Ga0207663_10395135
922 Ga0207660_10011800
923 Ga0207660_11702519
924 Ga0207657_10113231
925 Ga0207657_10292237
926 Ga0207649_10068640
927 Ga0207652_10037437
928 Ga0207652_10182246
929 Ga0207681_10786612
930 Ga0207694_10192589
931 Ga0207694_10212713
932 Ga0207650_11792327
933 Ga0207659_10161900
934 Ga0207659_11306501
935 Ga0207687_11367153
936 Ga0207687_11686787
937 Ga0207700_10008440
938 Ga0207664_10434484
939 Ga0207644_10162746
940 Ga0207644_10585844
941 Ga0207690_10143478
942 Ga0207706_10293843
943 Ga0207670_10000705
944 Ga0207670_10329065
945 Ga0207670_10413081
946 Ga0207670_10912054
947 Ga0207669_10283627
948 Ga0207669_11171281
949 Ga0207669_11209087
950 Ga0207704_10026299
951 Ga0207704_11224046
952 Ga0207665_10061952
953 Ga0207691_10106662
954 Ga0207691_10372591
955 Ga0207691_11206018
956 Ga0207691_11560314
957 Ga0207711_10004964
958 Ga0207711_10538770
959 Ga0207711_11514318
960 Ga0207689_10369561
961 Ga0207679_10123452
962 Ga0207667_10113151
963 Ga0207667_10138217
964 Ga0207667_12161519
965 Ga0207651_10276732
966 Ga0207658_10083309
967 Ga0207677_10608558
968 Ga0207677_11781324
969 Ga0207703_10822675
970 Ga0207703_10994670
971 Ga0207703_11657520
972 Ga0207639_10805376
973 Ga0207708_10135468
974 Ga0207708_10425357
975 Ga0207702_10023630
976 Ga0207702_10088867
977 Ga0207702_10739050
978 Ga0207641_11002057
979 Ga0207648_10150978
980 Ga0207648_12262167
981 Ga0207676_10022058
982 Ga0207674_10140469
983 Ga0207675_100259669
984 Ga0207675_101975701
985 Ga0207675_102085529
986 Ga0207683_10049337
987 Ga0207683_10087939
988 Ga0207683_10612391
989 Ga0207683_11046628
990 Ga0207683_11769170
991 Ga0207683_12108521
992 Ga0207698_11210706
993 Ga0209813_10007760
994 Ga0209813_10038656
995 Ga0209813_10077663
996 Ga0209813_10099275
997 Ga0207428_10188072
998 Ga0268266_10020562
999 Ga0268266_10081341
1000 Ga0268265_10603009
1001 Ga0268265_11708513
1002 Ga0268264_10054720
1003 Ga0268264_11219528
1004 Ga0265325_10000126
1005 Ga0265325_10144476
1006 Ga0265340_10195198
1007 Ga0265340_10216363
1008 Ga0265339_10098293
1009 Ga0265331_10133547
1010 Ga0265313_10379953
1011 Ga0265314_10164767
1012 Ga0307409_102700844
1013 Ga0307411_12297054
1014 Ga0373930_0050353
1015 Ga0373948_0028198
1016 Ga0373950_0132727
1017 Ga0373958_0004094
1018 Ga0373959_0171862
1019 Ga0373938_0017133
1020 Ga0373928_0047734
1021 Ga0373929_0064432
1022 Ga0373940_0166877
1023 Ga0373932_0324862
1024 Ga0373939_0010416
1025 Ga0373939_0285783
1026 Ga0373941_0399292
1027 Ga0373945_0289615
1028 Ga0373960_0059158
1029 Ga0373942_0047204
1030 Ga0373942_0100355
1031 Ga0373942_0129379
1032 Ga0373961_0017662
1033 Ga0373962_0218262
1034 Ga0373931_0001501
1035 Ga0373931_0021036
1036 Ga0373931_0129872
1037 Ga0373931_0311114
1038 Ga0373931_0650884
1039 Ga0373935_0644265
1040 Ga0373927_0016179
1041 Ga0373927_0199318
1042 Ga0373927_0961315
1043 Ga0373933_0213399
1044 Ga0373937_0755359
1045 Ga0373937_1266438
1046 Ga0373925_0137220
1047 Ga0373925_0357993
1048 Ga0373925_1184591
1049 Ga0395899_0009531
1050 Ga0395899_0150578
1051 Ga0395899_0767716
1052 Ga0395900_0001262
1053 Ga0395900_0023451
1054 Ga0395900_0070977
1055 Ga0395898_0123461
1056 Ga0395901_0007515
1057 Ga0395901_0026827
1058 Ga0395901_0035220
1059 Ga0436365_1743638
1060 Ga0436365_1844784
1061 Ga0436360_0753824
1062 Ga0436360_0953749
1063 Ga0436361_0326736
1064 Ga0436361_1108206
1065 Ga0436363_1456337
1066 Ga0436362_0735027
1067 Ga0436362_1192524
1068 Ga0439453_0006761
1069 Ga0451791_1093831
1070 Ga0451802_1673099
1071 Ga0451807_0002414
1072 Ga0451807_0811399
1073 Ga0451835_1197112
1074 Ga0451837_0541161
1075 Ga0451841_0675298
1076 Ga0451845_0445836
1077 Ga0439435_0012397
1078 Ga0439459_0074935
1079 Ga0439460_0096640
1080 Ga0466963_0039690
1081 Ga0466971_0148953
1082 Ga0466957_0169861
1083 Ga0466959_0493796
1084 Ga0451576_1468704
1085 Ga0466967_0497937
1086 Ga0495638_0560161
1087 Ga0495628_0185113
1088 Ga0495587_0623181
1089 Ga0495598_0402377
1090 Ga0495621_0139142
1091 Ga0495656_0170525
1092 Ga0495658_0755483
1093 Ga0495669_0320940
1094 Ga0495649_0385312
1095 Ga0495676_0645377
1096 Ga0495680_0416958
1097 Ga0495602_0704449
1098 Ga0496100_0068498
1099 Ga0496101_0051229
1100 Ga0496101_0786216
1101 Ga0496102_0053023
1102 Ga0496102_1566784
1103 Ga0496104_0079211
1104 Ga0496105_0008367
1105 Ga0496106_0086305
1106 Ga0496106_0553205
1107 Ga0496107_0256481
1108 Ga0496108_0072046
1109 Ga0496109_0373196
1110 Ga0496110_0016576
1111 Ga0496110_1191256
1112 Ga0496111_0087019
1113 Ga0496112_0218095
1114 Ga0496112_0248023
1115 Ga0496112_0565491
1116 Ga0496112_1758798
1117 Ga0496113_0193906
1118 Ga0496113_0537594
1119 Ga0496113_0806697
1120 Ga0496114_0071218
1121 Ga0496114_1687704
1122 Ga0496115_0179513
1123 Ga0496126_0139878
1124 Ga0501033_0209868
1125 Ga0501033_0278547
1126 Ga0501034_0005785
1127 Ga0501034_0138972
1128 Ga0501034_1041554
1129 Ga0501034_1139652
1130 Ga0501036_0571554
1131 Ga0501037_0275228
1132 Ga0501040_0308248
1133 Ga0501043_0238132
1134 Ga0501043_0358316
1135 Ga0501046_0066311
1136 Ga0501047_0133012
1137 Ga0501047_0256232
1138 Ga0501047_1418521
1139 Ga0501048_0179724
1140 Ga0501067_0264323
1141 Ga0501069_0181364
1142 Ga0501069_0279599
1143 Ga0501070_0187714
1144 Ga0501070_1539062
1145 Ga0501072_0828914
1146 Ga0501072_1007032
1147 Ga0501073_0100413
1148 Ga0501073_0107560
1149 Ga0501073_0235133
1150 Ga0501073_0264551
1151 Ga0501073_0336406
1152 Ga0501073_0644729
1153 Ga0501073_0732990
1154 Ga0501074_0199465
1155 Ga0501076_0768957
1156 Ga0501230_116561
1157 Ga0501079_0613520
1158 Ga0501080_0137502
1159 Ga0501080_1016093
1160 Ga0501083_0222582
1161 Ga0501035_0508892
1162 Ga0501035_1001210
1163 Ga0501044_0106946
1164 Ga0501044_0268742
1165 Ga0501044_0456748
1166 nmdc:mga03683_242084_c1
1167 nmdc:mga03683_242828_c1
1168 nmdc:mga03683_252466_c1
1169 nmdc:mga03683_263455_c1
1170 nmdc:mga03683_2754_c1
1171 nmdc:mga03683_374253_c1
1172 nmdc:mga03683_391361_c1
1173 nmdc:mga03683_465155_c1
1174 nmdc:mga03683_47296_c1
1175 nmdc:mga03683_55978_c1
1176 nmdc:mga03683_572627_c1
1177 nmdc:mga03683_603744_c1
1178 nmdc:mga03683_705512_c1
1179 nmdc:mga03n38_39577_c1
1180 nmdc:mga03n38_406174_c1
1181 nmdc:mga00v17_1020710_c1
1182 nmdc:mga00v17_121337_c1
1183 nmdc:mga00v17_484715_c1
1184 nmdc:mga00v17_8746_c1
1185 nmdc:mga0yw44_1000447_c1
1186 nmdc:mga0yw44_114658_c1
1187 nmdc:mga0yw44_123301_c1
1188 nmdc:mga0yw44_162590_c1
1189 nmdc:mga0yw44_184102_c1
1190 nmdc:mga0yw44_265765_c1
1191 nmdc:mga0yw44_567974_c1
1192 nmdc:mga0k408_187718_c1
1193 nmdc:mga0k408_272556_c1
1194 nmdc:mga0k408_285203_c1
1195 nmdc:mga0k408_68583_c1
1196 nmdc:mga06z11_209700_c1
1197 nmdc:mga06z11_90916_c1
1198 nmdc:mga04h51_117332_c1
1199 nmdc:mga04h51_164960_c1
1200 nmdc:mga04h51_31659_c1
1201 nmdc:mga04h51_3538_c1
1202 nmdc:mga04h51_381306_c1
1203 nmdc:mga07m45_29822_c1
1204 nmdc:mga07m45_338554_c1
1205 nmdc:mga07m45_350260_c1
1206 nmdc:mga07m45_46540_c1
1207 nmdc:mga07m45_501323_c1
1208 nmdc:mga05p37_1911402_c1
1209 nmdc:mga05p37_325238_c1
1210 nmdc:mga09592_449036_c1
1211 nmdc:mga0qj67_701167_c1
1212 nmdc:mga08y16_1200800_c1
1213 nmdc:mga08y16_2053359_c1
1214 nmdc:mga08y16_289960_c1
1215 nmdc:mga08y16_37367_c1
1216 nmdc:mga0n895_95716_c1
1217 nmdc:mga0sz30_25567_c1
1218 nmdc:mga0sz30_341471_c1
1219 nmdc:mga0sz30_446266_c1
1220 nmdc:mga0sz30_570795_c1
1221 Ga0495601_0626434
1222 Ga0495595_0109533
1223 Ga0500578_0488963
1224 Ga0500644_0173255
1225 Ga0500646_0052819
1226 Ga0500647_0035556
1227 Ga0500651_0440011
1228 Ga0500651_0560565
1229 Ga0500566_0163189
1230 Ga0500641_0040820
1231 Ga0500641_0122591
1232 Ga0500557_055015
1233 Ga0500595_002972
1234 Ga0500595_012905
1235 Ga0500595_037630
1236 Ga0500597_199399
1237 Ga0500652_000003
1238 Ga0500655_138867
1239 Ga0500658_0295486
1240 Ga0500568_0017756
1241 Ga0500616_0012180
1242 Ga0500616_0039990
1243 Ga0500616_0044895
1244 Ga0500627_0080595
1245 Ga0500611_028122
1246 Ga0500609_050820
1247 Ga0500552_004195
1248 Ga0500552_013292
1249 Ga0501084_0143386
1250 Ga0501084_0765438
1251 Ga0501082_0185364
1252 Ga0530510_1186022

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04800

NDUS4

NADH dehydrogenase ubiquinone Fe-S protein 4

12

106

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dp2-assembly1.cif.gz_A crystal structure of udp-n-acetylmuramoylalanine--d-glutamate ligase (murd) from pseudomonas aeruginosa pao1 in complex with uma (uridine-5'-diphosphate-n-acetylmuramoyl-l-alanine) 0.7681 59 76
5b3h-assembly2.cif.gz_D the crystal structure of the jackdaw/idd10 bound to the heterodimeric shr-scr complex 0.7591 59 76
5gpn-assembly1.cif.gz_w architecture of mammalian respirasome 0.7553 2 93
6zkc-assembly1.cif.gz_c complex i during turnover, closed 0.7552 2 96
8olt-assembly1.cif.gz_Q mitochondrial complex i from mus musculus in the active state bound with piericidin a 0.7477 2 96
ID Description Score Start End Superfamily
af_Q2G1X6_7_221_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8726 59 76 3.40.50.620
af_Q5XIF3_73_151_3.30.160.190 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;atu1810 like domain 0.8253 2 75 3.30.160.190
af_Q54G43_587_704_3.30.505.10 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;SH2 domain 0.8165 51 71 3.30.505.10
af_P39325_23_126_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8009 59 81 3.30.420.40
af_Q55EN4_593_717_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7838 59 77 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A1X7LLV4-F1-model_v4 ETC complex I subunit conserved region 0.895 2 78 GO:0022900
AF-C3KPG7-F1-model_v4 NADH-ubiquinone oxidoreductase 0.8919 2 73 GO:0022900
AF-A0A3D2GUU3-F1-model_v4 ETC complex I subunit 0.8898 3 75 GO:0022900
AF-A0A258W7V8-F1-model_v4 ETC complex I subunit 0.8843 1 67 GO:0022900
AF-A0A1M7SQV1-F1-model_v4 ETC complex I subunit conserved region 0.8819 2 83 GO:0022900

Map