F470406
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 625 | 405 | 583 | 78 |
Family's Representative Sequence
| Representative Sequence | 3300049581|Ga0501047_0412965|Ga0501047_0412965_264_584 |
| Length | 106 |
| Sequence | MRSNNDILFKMYILEKSMRVAKWGNSLAVRLPKKLVEELGLKENDEIRLVPSPDRREVQIAQSGDARQARREAALKRLAELRWQLPADYEFDREEANARRGFSEPE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 2 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 3 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 4 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 5 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 6 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 7 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 8 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 9 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 10 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 11 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 12 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 13 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 14 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 15 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 16 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 17 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 18 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 19 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 20 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 21 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 22 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 23 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 24 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 25 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 26 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 27 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 28 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 85 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 99 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 126 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 127 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 128 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 129 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 130 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 131 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 132 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 133 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 188 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 189 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 197 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 201 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 211 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 212 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 213 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 225 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 226 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 230 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 233 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 234 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 235 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 236 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 237 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 238 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 239 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 240 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 241 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 242 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 243 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 244 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 245 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 246 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 305 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 306 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 307 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 308 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 309 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 314 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 315 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 316 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 317 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 318 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 319 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 320 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 321 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 333 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 334 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 337 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 340 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 341 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 347 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 352 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 353 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 355 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 356 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 357 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 358 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 359 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 360 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 361 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 362 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 363 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 364 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 365 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 366 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 367 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 368 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 369 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 370 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 371 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 372 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 373 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 374 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 375 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 376 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 377 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 378 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 379 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 380 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 381 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 382 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 383 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 384 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 385 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 386 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 387 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 388 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 389 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 390 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 391 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 392 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 393 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 394 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 395 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 396 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 397 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 398 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 399 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 400 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 401 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 402 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 403 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 404 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 405 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.28 |
| Metatranscriptomes | 0 |
| Isolates | 6.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.96 |
| Nodule | 6.56 |
| Rhizoplane | 5.6 |
| Rhizosphere | 73.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1024865 | 3300002070 | Bacteria | 856 |
| 2 | rootH2_10319174 | 3300003320 | Bacteria | 1216 |
| 3 | Ga0055529_1009520 | 3300003763 | Bacteria | 1273 |
| 4 | Ga0065165_1001154 | 3300005262 | Bacteria | 30829 |
| 5 | Ga0065707_10540224 | 3300005295 | Unclassified | 728 |
| 6 | Ga0070683_101060502 | 3300005329 | Unclassified | 778 |
| 7 | Ga0070690_100112997 | 3300005330 | Bacteria | 1815 |
| 8 | Ga0070690_100434527 | 3300005330 | Bacteria | 970 |
| 9 | Ga0070670_100264320 | 3300005331 | Bacteria | 1500 |
| 10 | Ga0070680_100034242 | 3300005336 | Bacteria | 4095 |
| 11 | Ga0068868_100128888 | 3300005338 | Bacteria | 2069 |
| 12 | Ga0070660_100877182 | 3300005339 | Bacteria | 756 |
| 13 | Ga0070660_101137909 | 3300005339 | Unclassified | 661 |
| 14 | Ga0070689_100071198 | 3300005340 | Bacteria | 2716 |
| 15 | Ga0070689_100091672 | 3300005340 | Bacteria | 2396 |
| 16 | Ga0070689_101031825 | 3300005340 | Bacteria | 733 |
| 17 | Ga0070687_100115211 | 3300005343 | Bacteria | 1528 |
| 18 | Ga0070661_100805769 | 3300005344 | Unclassified | 771 |
| 19 | Ga0070661_101550811 | 3300005344 | Bacteria | 559 |
| 20 | Ga0070668_100007904 | 3300005347 | Bacteria | 7896 |
| 21 | Ga0070668_100228198 | 3300005347 | Bacteria | 1538 |
| 22 | Ga0070669_100079827 | 3300005353 | Bacteria | 2434 |
| 23 | Ga0070669_100793561 | 3300005353 | Unclassified | 804 |
| 24 | Ga0070669_101354938 | 3300005353 | Bacteria | 617 |
| 25 | Ga0070675_100219909 | 3300005354 | Bacteria | 1654 |
| 26 | Ga0070675_101498687 | 3300005354 | Bacteria | 622 |
| 27 | Ga0070671_100019566 | 3300005355 | Bacteria | 5512 |
| 28 | Ga0070671_100157221 | 3300005355 | Bacteria | 1921 |
| 29 | Ga0070671_100699259 | 3300005355 | Unclassified | 879 |
| 30 | Ga0070674_100022315 | 3300005356 | Bacteria | 4081 |
| 31 | Ga0070673_100012554 | 3300005364 | Bacteria | 5820 |
| 32 | Ga0070688_100526967 | 3300005365 | Bacteria | 895 |
| 33 | Ga0070659_100198704 | 3300005366 | Bacteria | 1650 |
| 34 | Ga0070667_100024229 | 3300005367 | Bacteria | 5041 |
| 35 | Ga0070709_10042880 | 3300005434 | Bacteria | 2796 |
| 36 | Ga0070714_100018965 | 3300005435 | Bacteria | 5596 |
| 37 | Ga0070714_100574540 | 3300005435 | Bacteria | 1081 |
| 38 | Ga0070713_100521626 | 3300005436 | Bacteria | 1123 |
| 39 | Ga0070713_101166851 | 3300005436 | Bacteria | 745 |
| 40 | Ga0070713_101207546 | 3300005436 | Unclassified | 732 |
| 41 | Ga0070710_10391777 | 3300005437 | Bacteria | 929 |
| 42 | Ga0070705_101292475 | 3300005440 | Unclassified | 604 |
| 43 | Ga0070700_100091204 | 3300005441 | Bacteria | 1989 |
| 44 | Ga0070663_100020160 | 3300005455 | Bacteria | 4411 |
| 45 | Ga0070663_100438238 | 3300005455 | Bacteria | 1075 |
| 46 | Ga0070663_100931794 | 3300005455 | Bacteria | 752 |
| 47 | Ga0070663_101208803 | 3300005455 | Unclassified | 664 |
| 48 | Ga0070663_101247664 | 3300005455 | Bacteria | 654 |
| 49 | Ga0070678_100125843 | 3300005456 | Bacteria | 2028 |
| 50 | Ga0070678_100654298 | 3300005456 | Bacteria | 943 |
| 51 | Ga0070662_100061582 | 3300005457 | Bacteria | 2740 |
| 52 | Ga0070662_100351699 | 3300005457 | Bacteria | 1207 |
| 53 | Ga0070681_10031663 | 3300005458 | Bacteria | 5310 |
| 54 | Ga0068867_100018716 | 3300005459 | Bacteria | 4924 |
| 55 | Ga0068867_100900431 | 3300005459 | Bacteria | 796 |
| 56 | Ga0070679_100018245 | 3300005530 | Bacteria | 6805 |
| 57 | Ga0070684_100703808 | 3300005535 | Bacteria | 942 |
| 58 | Ga0070697_100158569 | 3300005536 | Bacteria | 1911 |
| 59 | Ga0068853_101757833 | 3300005539 | Unclassified | 601 |
| 60 | Ga0070672_100065589 | 3300005543 | Bacteria | 2873 |
| 61 | Ga0070686_100154960 | 3300005544 | Bacteria | 1608 |
| 62 | Ga0070686_100721307 | 3300005544 | Unclassified | 797 |
| 63 | Ga0070686_101081700 | 3300005544 | Unclassified | 661 |
| 64 | Ga0070693_100095437 | 3300005547 | Bacteria | 1801 |
| 65 | Ga0070693_100178400 | 3300005547 | Bacteria | 1366 |
| 66 | Ga0070693_100519685 | 3300005547 | Bacteria | 847 |
| 67 | Ga0070665_100126888 | 3300005548 | Bacteria | 2554 |
| 68 | Ga0070665_100276729 | 3300005548 | Bacteria | 1680 |
| 69 | Ga0070665_101821754 | 3300005548 | Bacteria | 615 |
| 70 | Ga0068855_100202260 | 3300005563 | Bacteria | 2235 |
| 71 | Ga0070664_101062918 | 3300005564 | Bacteria | 762 |
| 72 | Ga0070664_101222382 | 3300005564 | Bacteria | 709 |
| 73 | Ga0068857_100761112 | 3300005577 | Bacteria | 923 |
| 74 | Ga0068854_100764450 | 3300005578 | Bacteria | 839 |
| 75 | Ga0068854_101249425 | 3300005578 | Bacteria | 667 |
| 76 | Ga0068856_101121751 | 3300005614 | Unclassified | 804 |
| 77 | Ga0068856_101291964 | 3300005614 | Bacteria | 745 |
| 78 | Ga0068856_101497677 | 3300005614 | Unclassified | 689 |
| 79 | Ga0070702_100076996 | 3300005615 | Bacteria | 1987 |
| 80 | Ga0070702_101269170 | 3300005615 | Unclassified | 597 |
| 81 | Ga0068852_100582866 | 3300005616 | Bacteria | 1121 |
| 82 | Ga0068852_101666922 | 3300005616 | Bacteria | 660 |
| 83 | Ga0068859_100029735 | 3300005617 | Bacteria | 5481 |
| 84 | Ga0068859_100687559 | 3300005617 | Bacteria | 1114 |
| 85 | Ga0068864_100083027 | 3300005618 | Bacteria | 2813 |
| 86 | Ga0068864_100377388 | 3300005618 | Bacteria | 1343 |
| 87 | Ga0068864_101616663 | 3300005618 | Unclassified | 652 |
| 88 | Ga0068866_10163536 | 3300005718 | Bacteria | 1300 |
| 89 | Ga0068861_100022727 | 3300005719 | Bacteria | 4522 |
| 90 | Ga0068861_100033637 | 3300005719 | Bacteria | 3784 |
| 91 | Ga0068861_100976646 | 3300005719 | Bacteria | 807 |
| 92 | Ga0068851_10616160 | 3300005834 | Bacteria | 662 |
| 93 | Ga0068858_101283057 | 3300005842 | Bacteria | 721 |
| 94 | Ga0068860_100000268 | 3300005843 | Bacteria | 76328 |
| 95 | Ga0068860_100016951 | 3300005843 | Bacteria | 7101 |
| 96 | Ga0068860_101790294 | 3300005843 | Bacteria | 636 |
| 97 | Ga0068860_102461346 | 3300005843 | Bacteria | 540 |
| 98 | Ga0068862_100040308 | 3300005844 | Bacteria | 3970 |
| 99 | Ga0068862_100057617 | 3300005844 | Bacteria | 3333 |
| 100 | Ga0068862_101091892 | 3300005844 | Unclassified | 793 |
| 101 | Ga0070717_10247006 | 3300006028 | Bacteria | 1575 |
| 102 | Ga0070717_11088945 | 3300006028 | Unclassified | 728 |
| 103 | Ga0075365_10130295 | 3300006038 | Bacteria | 1740 |
| 104 | Ga0070715_10092266 | 3300006163 | Bacteria | 1396 |
| 105 | Ga0070716_101666091 | 3300006173 | Unclassified | 525 |
| 106 | Ga0070712_100931594 | 3300006175 | Unclassified | 750 |
| 107 | Ga0075369_10016504 | 3300006186 | Bacteria | 2981 |
| 108 | Ga0075369_10177128 | 3300006186 | Bacteria | 980 |
| 109 | Ga0097621_100177153 | 3300006237 | Bacteria | 1841 |
| 110 | Ga0097621_101663767 | 3300006237 | Bacteria | 607 |
| 111 | Ga0068871_100047607 | 3300006358 | Bacteria | 3459 |
| 112 | Ga0075428_100195559 | 3300006844 | Unclassified | 2187 |
| 113 | Ga0075434_101256052 | 3300006871 | Unclassified | 752 |
| 114 | Ga0075434_101951931 | 3300006871 | Unclassified | 593 |
| 115 | Ga0075434_102127478 | 3300006871 | Unclassified | 566 |
| 116 | Ga0068865_100030701 | 3300006881 | Bacteria | 3577 |
| 117 | Ga0075436_100152759 | 3300006914 | Bacteria | 1625 |
| 118 | Ga0075436_100391785 | 3300006914 | Bacteria | 1006 |
| 119 | Ga0075436_101506194 | 3300006914 | Unclassified | 511 |
| 120 | Ga0097620_100029735 | 3300006931 | Bacteria | 5481 |
| 121 | Ga0097620_100687631 | 3300006931 | Bacteria | 1114 |
| 122 | Ga0097620_101289292 | 3300006931 | Unclassified | 805 |
| 123 | Ga0099823_1022011 | 3300006944 | Bacteria | 5921 |
| 124 | Ga0075435_101662010 | 3300007076 | Unclassified | 560 |
| 125 | Ga0099794_10157232 | 3300007265 | Bacteria | 1155 |
| 126 | Ga0105244_10486580 | 3300009036 | Bacteria | 568 |
| 127 | Ga0105240_10083631 | 3300009093 | Bacteria | 3916 |
| 128 | Ga0105240_10989914 | 3300009093 | Unclassified | 900 |
| 129 | Ga0105240_12637619 | 3300009093 | Bacteria | 519 |
| 130 | Ga0111539_10079945 | 3300009094 | Unclassified | 3846 |
| 131 | Ga0111539_10372851 | 3300009094 | Bacteria | 1661 |
| 132 | Ga0111539_10388958 | 3300009094 | Bacteria | 1624 |
| 133 | Ga0105245_10142087 | 3300009098 | Bacteria | 2262 |
| 134 | Ga0105245_10292220 | 3300009098 | Bacteria | 1596 |
| 135 | Ga0105245_11186593 | 3300009098 | Bacteria | 811 |
| 136 | Ga0105247_10467834 | 3300009101 | Bacteria | 912 |
| 137 | Ga0105247_10620167 | 3300009101 | Bacteria | 804 |
| 138 | Ga0114129_10101757 | 3300009147 | Unclassified | 3975 |
| 139 | Ga0105243_10161008 | 3300009148 | Bacteria | 1935 |
| 140 | Ga0105243_10330818 | 3300009148 | Bacteria | 1391 |
| 141 | Ga0105243_10652983 | 3300009148 | Bacteria | 1020 |
| 142 | Ga0105241_10365962 | 3300009174 | Bacteria | 1256 |
| 143 | Ga0105241_10408075 | 3300009174 | Bacteria | 1193 |
| 144 | Ga0105241_12642981 | 3300009174 | Unclassified | 505 |
| 145 | Ga0105242_11299373 | 3300009176 | Bacteria | 751 |
| 146 | Ga0105248_10343146 | 3300009177 | Bacteria | 1681 |
| 147 | Ga0105237_10230692 | 3300009545 | Bacteria | 1852 |
| 148 | Ga0105237_10737447 | 3300009545 | Bacteria | 991 |
| 149 | Ga0105237_11679179 | 3300009545 | Unclassified | 642 |
| 150 | Ga0105237_12392469 | 3300009545 | Bacteria | 538 |
| 151 | Ga0105238_10479338 | 3300009551 | Bacteria | 1243 |
| 152 | Ga0105238_12095174 | 3300009551 | Bacteria | 600 |
| 153 | Ga0105238_12172458 | 3300009551 | Unclassified | 590 |
| 154 | Ga0105238_12876569 | 3300009551 | Unclassified | 518 |
| 155 | Ga0105249_10210530 | 3300009553 | Bacteria | 1908 |
| 156 | Ga0105239_10029546 | 3300010375 | Bacteria | 6026 |
| 157 | Ga0105239_10164651 | 3300010375 | Bacteria | 2479 |
| 158 | Ga0105239_10421145 | 3300010375 | Bacteria | 1513 |
| 159 | Ga0105239_10505029 | 3300010375 | Bacteria | 1375 |
| 160 | Ga0105239_12983064 | 3300010375 | Bacteria | 552 |
| 161 | Ga0105246_10067042 | 3300011119 | Bacteria | 2514 |
| 162 | Ga0105246_10978190 | 3300011119 | Bacteria | 764 |
| 163 | Ga0105246_11903295 | 3300011119 | Bacteria | 571 |
| 164 | Ga0105246_11904209 | 3300011119 | Unclassified | 571 |
| 165 | Ga0157369_10235971 | 3300013105 | Bacteria | 1911 |
| 166 | Ga0157374_10517778 | 3300013296 | Unclassified | 1198 |
| 167 | Ga0157374_10932818 | 3300013296 | Bacteria | 886 |
| 168 | Ga0157378_10395102 | 3300013297 | Bacteria | 1361 |
| 169 | Ga0157378_10931766 | 3300013297 | Bacteria | 901 |
| 170 | Ga0157378_11122201 | 3300013297 | Unclassified | 824 |
| 171 | Ga0157378_11339907 | 3300013297 | Bacteria | 758 |
| 172 | Ga0163162_10316100 | 3300013306 | Bacteria | 1694 |
| 173 | Ga0163162_10601418 | 3300013306 | Bacteria | 1226 |
| 174 | Ga0163162_11026732 | 3300013306 | Bacteria | 933 |
| 175 | Ga0157372_12014894 | 3300013307 | Bacteria | 663 |
| 176 | Ga0157375_13613425 | 3300013308 | Unclassified | 514 |
| 177 | Ga0163163_10573307 | 3300014325 | Bacteria | 1191 |
| 178 | Ga0157380_10007924 | 3300014326 | Bacteria | 7561 |
| 179 | Ga0157380_10167313 | 3300014326 | Bacteria | 1917 |
| 180 | Ga0157380_10252991 | 3300014326 | Unclassified | 1595 |
| 181 | Ga0157377_10279372 | 3300014745 | Bacteria | 1094 |
| 182 | Ga0157377_10692885 | 3300014745 | Unclassified | 739 |
| 183 | Ga0157376_10050292 | 3300014969 | Bacteria | 3457 |
| 184 | Ga0157376_10875651 | 3300014969 | Bacteria | 915 |
| 185 | Ga0157376_12954952 | 3300014969 | Unclassified | 515 |
| 186 | Ga0163161_10023605 | 3300017792 | Bacteria | 4340 |
| 187 | Ga0213874_10050250 | 3300021377 | Bacteria | 1277 |
| 188 | Ga0213876_10009102 | 3300021384 | Bacteria | 5346 |
| 189 | Ga0213876_10499196 | 3300021384 | Unclassified | 647 |
| 190 | Ga0213875_10090708 | 3300021388 | Bacteria | 1426 |
| 191 | Ga0213871_10164551 | 3300021441 | Bacteria | 680 |
| 192 | Ga0224569_101604 | 3300022732 | Bacteria | 1884 |
| 193 | Ga0224571_102028 | 3300022734 | Bacteria | 1283 |
| 194 | Ga0224572_1107773 | 3300024225 | Bacteria | 515 |
| 195 | Ga0228598_1009083 | 3300024227 | Bacteria | 1997 |
| 196 | Ga0209148_1000743 | 3300025254 | Bacteria | 25189 |
| 197 | Ga0209233_1011156 | 3300025261 | Bacteria | 2656 |
| 198 | Ga0209455_1006185 | 3300025272 | Bacteria | 3574 |
| 199 | Ga0209758_1134290 | 3300025297 | Bacteria | 650 |
| 200 | Ga0207426_1086606 | 3300025302 | Bacteria | 838 |
| 201 | Ga0207692_10624012 | 3300025898 | Unclassified | 695 |
| 202 | Ga0207642_10151539 | 3300025899 | Bacteria | 1235 |
| 203 | Ga0207688_10065013 | 3300025901 | Bacteria | 2061 |
| 204 | Ga0207688_10118753 | 3300025901 | Bacteria | 1541 |
| 205 | Ga0207699_10063045 | 3300025906 | Bacteria | 2237 |
| 206 | Ga0207643_10319237 | 3300025908 | Bacteria | 970 |
| 207 | Ga0207705_10671469 | 3300025909 | Bacteria | 806 |
| 208 | Ga0207654_10475195 | 3300025911 | Bacteria | 880 |
| 209 | Ga0207707_10030602 | 3300025912 | Bacteria | 4709 |
| 210 | Ga0207695_10124972 | 3300025913 | Bacteria | 2536 |
| 211 | Ga0207671_10992947 | 3300025914 | Bacteria | 662 |
| 212 | Ga0207671_11044254 | 3300025914 | Bacteria | 643 |
| 213 | Ga0207693_10351953 | 3300025915 | Bacteria | 1153 |
| 214 | Ga0207693_10645401 | 3300025915 | Unclassified | 822 |
| 215 | Ga0207663_10110496 | 3300025916 | Bacteria | 1864 |
| 216 | Ga0207663_11261955 | 3300025916 | Bacteria | 595 |
| 217 | Ga0207660_10032900 | 3300025917 | Bacteria | 3582 |
| 218 | Ga0207657_10738076 | 3300025919 | Bacteria | 763 |
| 219 | Ga0207652_10062805 | 3300025921 | Bacteria | 3210 |
| 220 | Ga0207681_10146919 | 3300025923 | Bacteria | 1763 |
| 221 | Ga0207681_10579884 | 3300025923 | Bacteria | 925 |
| 222 | Ga0207694_10690124 | 3300025924 | Bacteria | 861 |
| 223 | Ga0207694_11652217 | 3300025924 | Bacteria | 539 |
| 224 | Ga0207650_10119740 | 3300025925 | Bacteria | 2048 |
| 225 | Ga0207650_10152749 | 3300025925 | Bacteria | 1823 |
| 226 | Ga0207687_10030630 | 3300025927 | Bacteria | 3628 |
| 227 | Ga0207687_11354651 | 3300025927 | Bacteria | 612 |
| 228 | Ga0207700_10346389 | 3300025928 | Bacteria | 1293 |
| 229 | Ga0207700_10863242 | 3300025928 | Bacteria | 810 |
| 230 | Ga0207700_11213512 | 3300025928 | Unclassified | 673 |
| 231 | Ga0207644_10006764 | 3300025931 | Bacteria | 7473 |
| 232 | Ga0207644_10111530 | 3300025931 | Bacteria | 2069 |
| 233 | Ga0207690_11230578 | 3300025932 | Bacteria | 625 |
| 234 | Ga0207706_10285462 | 3300025933 | Bacteria | 1439 |
| 235 | Ga0207706_10633921 | 3300025933 | Bacteria | 916 |
| 236 | Ga0207686_10528968 | 3300025934 | Bacteria | 919 |
| 237 | Ga0207686_11478431 | 3300025934 | Bacteria | 560 |
| 238 | Ga0207709_10056794 | 3300025935 | Bacteria | 2424 |
| 239 | Ga0207709_10179535 | 3300025935 | Bacteria | 1494 |
| 240 | Ga0207709_10757538 | 3300025935 | Bacteria | 781 |
| 241 | Ga0207670_10027789 | 3300025936 | Bacteria | 3582 |
| 242 | Ga0207669_10013041 | 3300025937 | Bacteria | 4112 |
| 243 | Ga0207704_10045939 | 3300025938 | Bacteria | 2598 |
| 244 | Ga0207704_11302956 | 3300025938 | Unclassified | 621 |
| 245 | Ga0207691_10075934 | 3300025940 | Bacteria | 3029 |
| 246 | Ga0207691_10135438 | 3300025940 | Bacteria | 2173 |
| 247 | Ga0207711_10621994 | 3300025941 | Bacteria | 1008 |
| 248 | Ga0207711_10968208 | 3300025941 | Bacteria | 790 |
| 249 | Ga0207679_10084497 | 3300025945 | Bacteria | 2436 |
| 250 | Ga0207667_10120516 | 3300025949 | Bacteria | 2703 |
| 251 | Ga0207651_10005889 | 3300025960 | Bacteria | 6342 |
| 252 | Ga0207712_10022637 | 3300025961 | Bacteria | 4140 |
| 253 | Ga0207668_10018118 | 3300025972 | Bacteria | 4424 |
| 254 | Ga0207668_10089108 | 3300025972 | Bacteria | 2261 |
| 255 | Ga0207668_10147330 | 3300025972 | Bacteria | 1818 |
| 256 | Ga0207668_10489869 | 3300025972 | Bacteria | 1056 |
| 257 | Ga0207640_10825610 | 3300025981 | Bacteria | 805 |
| 258 | Ga0207640_12110885 | 3300025981 | Bacteria | 511 |
| 259 | Ga0207658_10345394 | 3300025986 | Bacteria | 1294 |
| 260 | Ga0207677_11459398 | 3300026023 | Bacteria | 631 |
| 261 | Ga0207703_10983140 | 3300026035 | Bacteria | 809 |
| 262 | Ga0207703_11111933 | 3300026035 | Unclassified | 759 |
| 263 | Ga0207703_11594689 | 3300026035 | Bacteria | 628 |
| 264 | Ga0207639_10992261 | 3300026041 | Bacteria | 786 |
| 265 | Ga0207678_10146041 | 3300026067 | Bacteria | 2019 |
| 266 | Ga0207678_10407399 | 3300026067 | Bacteria | 1178 |
| 267 | Ga0207678_10976460 | 3300026067 | Bacteria | 749 |
| 268 | Ga0207678_11371221 | 3300026067 | Bacteria | 625 |
| 269 | Ga0207678_11581433 | 3300026067 | Bacteria | 578 |
| 270 | Ga0207708_10114806 | 3300026075 | Bacteria | 2093 |
| 271 | Ga0207702_11143497 | 3300026078 | Bacteria | 772 |
| 272 | Ga0207702_11749581 | 3300026078 | Unclassified | 614 |
| 273 | Ga0207648_10020966 | 3300026089 | Bacteria | 5883 |
| 274 | Ga0207648_12124193 | 3300026089 | Bacteria | 522 |
| 275 | Ga0207676_10147427 | 3300026095 | Bacteria | 2022 |
| 276 | Ga0207676_11047340 | 3300026095 | Bacteria | 805 |
| 277 | Ga0207676_11606843 | 3300026095 | Unclassified | 648 |
| 278 | Ga0207674_11772765 | 3300026116 | Unclassified | 585 |
| 279 | Ga0207675_100017209 | 3300026118 | Bacteria | 6751 |
| 280 | Ga0207675_100050699 | 3300026118 | Bacteria | 3873 |
| 281 | Ga0207675_100256068 | 3300026118 | Bacteria | 1695 |
| 282 | Ga0207675_100926428 | 3300026118 | Bacteria | 888 |
| 283 | Ga0207683_10034616 | 3300026121 | Bacteria | 4390 |
| 284 | Ga0207683_10125646 | 3300026121 | Bacteria | 2305 |
| 285 | Ga0207698_10260785 | 3300026142 | Bacteria | 1592 |
| 286 | Ga0209389_1000163 | 3300027296 | Bacteria | 55041 |
| 287 | Ga0209489_101100 | 3300027361 | Bacteria | 55041 |
| 288 | Ga0209700_100014 | 3300027363 | Bacteria | 299349 |
| 289 | Ga0268266_10085221 | 3300028379 | Bacteria | 2760 |
| 290 | Ga0268266_10632567 | 3300028379 | Bacteria | 1029 |
| 291 | Ga0268266_11615499 | 3300028379 | Bacteria | 624 |
| 292 | Ga0268265_10310652 | 3300028380 | Bacteria | 1423 |
| 293 | Ga0268264_10000084 | 3300028381 | Bacteria | 242128 |
| 294 | Ga0268264_10043258 | 3300028381 | Bacteria | 3731 |
| 295 | Ga0268264_11649250 | 3300028381 | Bacteria | 652 |
| 296 | Ga0265337_1001532 | 3300028556 | Bacteria | 11344 |
| 297 | Ga0265334_10003016 | 3300028573 | Bacteria | 7691 |
| 298 | Ga0265338_10005127 | 3300028800 | Bacteria | 17258 |
| 299 | Ga0265325_10094196 | 3300031241 | Bacteria | 1473 |
| 300 | Ga0265339_10113712 | 3300031249 | Bacteria | 1398 |
| 301 | Ga0265331_10325660 | 3300031250 | Bacteria | 688 |
| 302 | Ga0265316_10266742 | 3300031344 | Bacteria | 1254 |
| 303 | Ga0265316_10993832 | 3300031344 | Unclassified | 584 |
| 304 | Ga0307513_10516423 | 3300031456 | Bacteria | 910 |
| 305 | Ga0307509_10006030 | 3300031507 | Bacteria | 16526 |
| 306 | Ga0307408_101542547 | 3300031548 | Bacteria | 629 |
| 307 | Ga0265313_10026043 | 3300031595 | Bacteria | 3089 |
| 308 | Ga0265313_10161140 | 3300031595 | Unclassified | 953 |
| 309 | Ga0307407_10108655 | 3300031903 | Bacteria | 1737 |
| 310 | Ga0307409_101410659 | 3300031995 | Bacteria | 723 |
| 311 | Ga0307409_102264235 | 3300031995 | Bacteria | 573 |
| 312 | Ga0307409_102924112 | 3300031995 | Bacteria | 504 |
| 313 | Ga0307416_100314860 | 3300032002 | Bacteria | 1564 |
| 314 | Ga0307416_100477485 | 3300032002 | Bacteria | 1306 |
| 315 | Ga0307414_10457489 | 3300032004 | Bacteria | 1121 |
| 316 | Ga0307411_10848627 | 3300032005 | Bacteria | 808 |
| 317 | Ga0307415_100392443 | 3300032126 | Bacteria | 1182 |
| 318 | Ga0307415_100397924 | 3300032126 | Bacteria | 1175 |
| 319 | Ga0307507_10469415 | 3300033179 | Bacteria | 688 |
| 320 | Ga0307510_10112763 | 3300033180 | Bacteria | 2455 |
| 321 | Ga0307510_10460404 | 3300033180 | Bacteria | 713 |
| 322 | Ga0373926_0442699 | 3300035083 | Unclassified | 515 |
| 323 | Ga0373934_0308384 | 3300035086 | Unclassified | 657 |
| 324 | Ga0373944_0083672 | 3300035089 | Bacteria | 1058 |
| 325 | Ga0373923_0556123 | 3300035111 | Unclassified | 563 |
| 326 | Ga0373945_0474794 | 3300035116 | Unclassified | 555 |
| 327 | Ga0373953_0394982 | 3300035117 | Bacteria | 608 |
| 328 | Ga0373954_0427590 | 3300035118 | Unclassified | 655 |
| 329 | Ga0373943_0523167 | 3300035170 | Unclassified | 694 |
| 330 | Ga0373946_0286958 | 3300035171 | Bacteria | 811 |
| 331 | Ga0373946_0597814 | 3300035171 | Bacteria | 572 |
| 332 | Ga0373946_0605013 | 3300035171 | Unclassified | 568 |
| 333 | Ga0373955_0360446 | 3300035172 | Bacteria | 881 |
| 334 | Ga0373955_0436474 | 3300035172 | Unclassified | 797 |
| 335 | Ga0373961_0442948 | 3300035241 | Unclassified | 505 |
| 336 | Ga0373935_0146888 | 3300035692 | Bacteria | 1597 |
| 337 | Ga0373935_0580915 | 3300035692 | Bacteria | 818 |
| 338 | Ga0373927_0040261 | 3300035695 | Bacteria | 3032 |
| 339 | Ga0373927_0145017 | 3300035695 | Bacteria | 1554 |
| 340 | Ga0373927_0183799 | 3300035695 | Unclassified | 1371 |
| 341 | Ga0373933_0503343 | 3300035724 | Bacteria | 794 |
| 342 | Ga0373933_0626213 | 3300035724 | Bacteria | 707 |
| 343 | Ga0373947_0017017 | 3300035725 | Bacteria | 4179 |
| 344 | Ga0373947_0123023 | 3300035725 | Unclassified | 1650 |
| 345 | Ga0373937_0798541 | 3300036401 | Unclassified | 892 |
| 346 | Ga0373925_0041445 | 3300037068 | Bacteria | 3413 |
| 347 | Ga0373925_0227139 | 3300037068 | Bacteria | 1491 |
| 348 | Ga0373925_0277974 | 3300037068 | Bacteria | 1348 |
| 349 | Ga0373925_0608972 | 3300037068 | Bacteria | 900 |
| 350 | Ga0395899_0783190 | 3300037312 | Bacteria | 591 |
| 351 | Ga0436364_1421633 | 3300037853 | Bacteria | 1391 |
| 352 | Ga0436365_1309872 | 3300039437 | Bacteria | 831 |
| 353 | Ga0436365_1716550 | 3300039437 | Bacteria | 874 |
| 354 | Ga0436360_1046720 | 3300039438 | Bacteria | 3200 |
| 355 | Ga0436361_0674457 | 3300039447 | Bacteria | 796 |
| 356 | Ga0436363_0172666 | 3300039450 | Bacteria | 1372 |
| 357 | Ga0436363_1648471 | 3300039450 | Unclassified | 524 |
| 358 | Ga0436362_0642024 | 3300039453 | Bacteria | 2587 |
| 359 | Ga0451841_0104539 | 3300041498 | Bacteria | 962 |
| 360 | Ga0451841_1458524 | 3300041498 | Bacteria | 661 |
| 361 | Ga0451853_2443084 | 3300041512 | Bacteria | 767 |
| 362 | Ga0451853_3099811 | 3300041512 | Bacteria | 939 |
| 363 | Ga0439431_0191419 | 3300041997 | Bacteria | 594 |
| 364 | Ga0466972_0000871 | 3300044658 | Bacteria | 14493 |
| 365 | Ga0466966_0018882 | 3300044684 | Bacteria | 4543 |
| 366 | Ga0466966_0262046 | 3300044684 | Bacteria | 1041 |
| 367 | Ga0466961_0176177 | 3300044693 | Bacteria | 1329 |
| 368 | Ga0466961_0419577 | 3300044693 | Unclassified | 811 |
| 369 | Ga0466960_0722486 | 3300044901 | Bacteria | 599 |
| 370 | Ga0466959_0035456 | 3300045049 | Bacteria | 3689 |
| 371 | Ga0466958_0276593 | 3300045836 | Bacteria | 1076 |
| 372 | Ga0466967_0139284 | 3300045976 | Bacteria | 2259 |
| 373 | Ga0495617_103380 | 3300046452 | Bacteria | 925 |
| 374 | Ga0495617_219080 | 3300046452 | Bacteria | 592 |
| 375 | Ga0495592_0582116 | 3300046454 | Unclassified | 685 |
| 376 | Ga0495603_0177359 | 3300046455 | Unclassified | 1233 |
| 377 | Ga0495603_0650037 | 3300046455 | Unclassified | 603 |
| 378 | Ga0495629_0529375 | 3300046459 | Bacteria | 793 |
| 379 | Ga0495638_0004594 | 3300046460 | Bacteria | 10449 |
| 380 | Ga0495641_0581983 | 3300046461 | Unclassified | 512 |
| 381 | Ga0495651_0244190 | 3300046462 | Bacteria | 1230 |
| 382 | Ga0495653_0114524 | 3300046463 | Bacteria | 1932 |
| 383 | Ga0495653_0261187 | 3300046463 | Bacteria | 1145 |
| 384 | Ga0495653_0311048 | 3300046463 | Bacteria | 1024 |
| 385 | Ga0495580_0114661 | 3300046472 | Bacteria | 1872 |
| 386 | Ga0495582_0667227 | 3300046473 | Unclassified | 602 |
| 387 | Ga0495662_0354087 | 3300046476 | Bacteria | 722 |
| 388 | Ga0495662_0465451 | 3300046476 | Bacteria | 620 |
| 389 | Ga0495662_0595936 | 3300046476 | Unclassified | 540 |
| 390 | Ga0495662_0657183 | 3300046476 | Bacteria | 512 |
| 391 | Ga0495664_0834738 | 3300046477 | Bacteria | 541 |
| 392 | Ga0495594_0103147 | 3300046499 | Unclassified | 1605 |
| 393 | Ga0495583_0249995 | 3300046506 | Bacteria | 711 |
| 394 | Ga0495606_0116727 | 3300046507 | Bacteria | 1602 |
| 395 | Ga0495606_0126835 | 3300046507 | Bacteria | 1521 |
| 396 | Ga0495610_0133258 | 3300046512 | Bacteria | 1077 |
| 397 | Ga0495618_0611436 | 3300046514 | Bacteria | 648 |
| 398 | Ga0495630_1226776 | 3300046517 | Unclassified | 566 |
| 399 | Ga0495631_0111893 | 3300046518 | Bacteria | 1174 |
| 400 | Ga0495632_0308259 | 3300046519 | Bacteria | 701 |
| 401 | Ga0495643_0145894 | 3300046522 | Bacteria | 1176 |
| 402 | Ga0495648_0009414 | 3300046524 | Bacteria | 7578 |
| 403 | Ga0495648_0126300 | 3300046524 | Bacteria | 1366 |
| 404 | Ga0495666_0090511 | 3300046526 | Bacteria | 1444 |
| 405 | Ga0495666_0431102 | 3300046526 | Unclassified | 591 |
| 406 | Ga0495652_0502599 | 3300046529 | Unclassified | 840 |
| 407 | Ga0495665_0042920 | 3300046531 | Bacteria | 2406 |
| 408 | Ga0495665_0205698 | 3300046531 | Bacteria | 1020 |
| 409 | Ga0495640_0585669 | 3300046533 | Unclassified | 674 |
| 410 | Ga0495586_0551278 | 3300046535 | Unclassified | 666 |
| 411 | Ga0495587_0413401 | 3300046536 | Bacteria | 749 |
| 412 | Ga0495587_0577381 | 3300046536 | Unclassified | 620 |
| 413 | Ga0495622_0122451 | 3300046557 | Bacteria | 1187 |
| 414 | Ga0495667_0525845 | 3300046559 | Bacteria | 740 |
| 415 | Ga0495668_0189078 | 3300046616 | Bacteria | 1128 |
| 416 | Ga0495668_0326689 | 3300046616 | Bacteria | 841 |
| 417 | Ga0495634_0100221 | 3300046642 | Unclassified | 1872 |
| 418 | Ga0495634_0124360 | 3300046642 | Bacteria | 1649 |
| 419 | Ga0495634_0523034 | 3300046642 | Bacteria | 694 |
| 420 | Ga0495611_0174619 | 3300046648 | Bacteria | 1004 |
| 421 | Ga0495611_0349216 | 3300046648 | Bacteria | 679 |
| 422 | Ga0495625_0892379 | 3300046660 | Bacteria | 510 |
| 423 | Ga0495635_0108320 | 3300046663 | Bacteria | 1898 |
| 424 | Ga0495659_0094080 | 3300046664 | Unclassified | 1154 |
| 425 | Ga0495661_0277942 | 3300046665 | Bacteria | 845 |
| 426 | Ga0495661_0603370 | 3300046665 | Bacteria | 516 |
| 427 | Ga0495588_0115934 | 3300046674 | Bacteria | 1412 |
| 428 | Ga0495588_0725395 | 3300046674 | Unclassified | 520 |
| 429 | Ga0495599_0447820 | 3300046678 | Unclassified | 765 |
| 430 | Ga0495646_0383302 | 3300046680 | Unclassified | 733 |
| 431 | Ga0495647_0131906 | 3300046681 | Bacteria | 1059 |
| 432 | Ga0495647_0154729 | 3300046681 | Bacteria | 985 |
| 433 | Ga0495647_0404336 | 3300046681 | Unclassified | 627 |
| 434 | Ga0495613_0704324 | 3300046689 | Unclassified | 664 |
| 435 | Ga0495624_0741969 | 3300046690 | Bacteria | 582 |
| 436 | Ga0495649_0019237 | 3300046694 | Bacteria | 3837 |
| 437 | Ga0495649_0257446 | 3300046694 | Bacteria | 895 |
| 438 | Ga0495581_0115808 | 3300047315 | Bacteria | 1558 |
| 439 | Ga0495581_0404079 | 3300047315 | Bacteria | 797 |
| 440 | Ga0495581_0418648 | 3300047315 | Unclassified | 781 |
| 441 | Ga0495604_0352623 | 3300047317 | Unclassified | 977 |
| 442 | Ga0495674_0062120 | 3300047319 | Bacteria | 3253 |
| 443 | Ga0495674_0739714 | 3300047319 | Bacteria | 769 |
| 444 | Ga0495672_0177727 | 3300047320 | Bacteria | 1080 |
| 445 | Ga0495672_0245552 | 3300047320 | Bacteria | 872 |
| 446 | Ga0495676_0120638 | 3300047321 | Bacteria | 1908 |
| 447 | Ga0495680_0232889 | 3300047322 | Bacteria | 1311 |
| 448 | Ga0495683_0058140 | 3300047323 | Bacteria | 1921 |
| 449 | Ga0495684_0396084 | 3300047471 | Unclassified | 970 |
| 450 | Ga0495684_0616903 | 3300047471 | Bacteria | 730 |
| 451 | Ga0495686_0086401 | 3300047472 | Bacteria | 1909 |
| 452 | Ga0495686_0596580 | 3300047472 | Bacteria | 572 |
| 453 | Ga0495593_0459330 | 3300047673 | Unclassified | 637 |
| 454 | Ga0495602_0116927 | 3300048088 | Bacteria | 2154 |
| 455 | Ga0495614_0265744 | 3300048089 | Unclassified | 787 |
| 456 | Ga0496100_0006947 | 3300048903 | Bacteria | 6204 |
| 457 | Ga0496101_0002879 | 3300048904 | Bacteria | 10584 |
| 458 | Ga0496102_0013972 | 3300048905 | Bacteria | 6970 |
| 459 | Ga0496102_0470955 | 3300048905 | Bacteria | 1177 |
| 460 | Ga0496102_0530466 | 3300048905 | Bacteria | 1100 |
| 461 | Ga0496102_0896040 | 3300048905 | Bacteria | 809 |
| 462 | Ga0496102_1202409 | 3300048905 | Bacteria | 677 |
| 463 | Ga0496103_0086498 | 3300048906 | Bacteria | 1976 |
| 464 | Ga0496103_0104277 | 3300048906 | Bacteria | 1797 |
| 465 | Ga0496104_0011750 | 3300048907 | Bacteria | 7855 |
| 466 | Ga0496105_0771693 | 3300048908 | Bacteria | 733 |
| 467 | Ga0496106_0000376 | 3300048909 | Bacteria | 31754 |
| 468 | Ga0496107_0004183 | 3300048910 | Bacteria | 9748 |
| 469 | Ga0496107_0322613 | 3300048910 | Bacteria | 1149 |
| 470 | Ga0496108_0076434 | 3300048911 | Bacteria | 2830 |
| 471 | Ga0496108_0333237 | 3300048911 | Unclassified | 1323 |
| 472 | Ga0496108_0689498 | 3300048911 | Bacteria | 886 |
| 473 | Ga0496108_0915877 | 3300048911 | Bacteria | 752 |
| 474 | Ga0496108_0965761 | 3300048911 | Unclassified | 729 |
| 475 | Ga0496109_0048703 | 3300048912 | Bacteria | 3855 |
| 476 | Ga0496109_0461222 | 3300048912 | Bacteria | 1200 |
| 477 | Ga0496109_1797873 | 3300048912 | Bacteria | 546 |
| 478 | Ga0496110_0037229 | 3300048913 | Bacteria | 4228 |
| 479 | Ga0496110_0046555 | 3300048913 | Bacteria | 3795 |
| 480 | Ga0496110_0099450 | 3300048913 | Bacteria | 2607 |
| 481 | Ga0496110_0323344 | 3300048913 | Bacteria | 1405 |
| 482 | Ga0496111_0121568 | 3300048914 | Bacteria | 1928 |
| 483 | Ga0496111_0185919 | 3300048914 | Bacteria | 1545 |
| 484 | Ga0496112_0014918 | 3300048915 | Bacteria | 7230 |
| 485 | Ga0496112_0085760 | 3300048915 | Bacteria | 3115 |
| 486 | Ga0496112_0189748 | 3300048915 | Bacteria | 2017 |
| 487 | Ga0496113_0387147 | 3300048916 | Unclassified | 1122 |
| 488 | Ga0496113_1020911 | 3300048916 | Unclassified | 651 |
| 489 | Ga0496115_0047962 | 3300048918 | Bacteria | 3417 |
| 490 | Ga0496115_0334456 | 3300048918 | Bacteria | 1237 |
| 491 | Ga0496118_0047326 | 3300048921 | Bacteria | 3334 |
| 492 | Ga0496121_0575595 | 3300048924 | Bacteria | 700 |
| 493 | Ga0496121_0597350 | 3300048924 | Bacteria | 682 |
| 494 | Ga0496121_0641551 | 3300048924 | Unclassified | 648 |
| 495 | Ga0496125_0402554 | 3300048928 | Bacteria | 799 |
| 496 | Ga0496126_0279862 | 3300048929 | Bacteria | 1382 |
| 497 | Ga0496126_0295321 | 3300048929 | Bacteria | 1339 |
| 498 | Ga0496126_0409603 | 3300048929 | Bacteria | 1098 |
| 499 | Ga0501032_0197142 | 3300049569 | Unclassified | 1315 |
| 500 | Ga0501033_0357765 | 3300049570 | Unclassified | 1022 |
| 501 | Ga0501034_0015559 | 3300049571 | Bacteria | 7813 |
| 502 | Ga0501036_0158186 | 3300049572 | Bacteria | 1911 |
| 503 | Ga0501038_0222333 | 3300049574 | Bacteria | 1506 |
| 504 | Ga0501042_1222242 | 3300049578 | Unclassified | 548 |
| 505 | Ga0501046_0190509 | 3300049580 | Bacteria | 1530 |
| 506 | Ga0501047_0007395 | 3300049581 | Bacteria | 10330 |
| 507 | Ga0501047_0412965 | 3300049581 | Unclassified | 1182 |
| 508 | Ga0501070_0018451 | 3300049586 | Bacteria | 5853 |
| 509 | Ga0501071_0255503 | 3300049587 | Bacteria | 1323 |
| 510 | Ga0501073_0129007 | 3300049589 | Bacteria | 1753 |
| 511 | Ga0501227_171080 | 3300049665 | Bacteria | 607 |
| 512 | Ga0501235_215381 | 3300049669 | Bacteria | 525 |
| 513 | Ga0501079_0563253 | 3300049741 | Bacteria | 896 |
| 514 | Ga0501080_0461200 | 3300049742 | Bacteria | 1138 |
| 515 | Ga0501268_180761 | 3300049765 | Bacteria | 502 |
| 516 | Ga0501035_0006264 | 3300049822 | Bacteria | 11187 |
| 517 | Ga0501044_0105996 | 3300049823 | Bacteria | 2823 |
| 518 | Ga0501212_101705 | 3300049851 | Bacteria | 540 |
| 519 | nmdc:mga0yw44_667867_c1 | 3300050492 | Bacteria | 706 |
| 520 | nmdc:mga0yw44_76505_c1 | 3300050492 | Bacteria | 2089 |
| 521 | nmdc:mga05p37_88293_c1 | 3300050507 | Unclassified | 3822 |
| 522 | nmdc:mga09592_848283_c1 | 3300050508 | Unclassified | 770 |
| 523 | nmdc:mga08y16_462792_c1 | 3300050511 | Bacteria | 1292 |
| 524 | nmdc:mga0n895_1385432_c1 | 3300050512 | Unclassified | 672 |
| 525 | nmdc:mga0n895_1536794_c1 | 3300050512 | Unclassified | 631 |
| 526 | nmdc:mga0n895_719316_c1 | 3300050512 | Unclassified | 993 |
| 527 | nmdc:mga08x19_145275_c1 | 3300050514 | Bacteria | 1604 |
| 528 | nmdc:mga08x19_714136_c1 | 3300050514 | Unclassified | 711 |
| 529 | nmdc:mga0sz30_17131_c2 | 3300050516 | Bacteria | 2475 |
| 530 | Ga0495601_0168898 | 3300053077 | Bacteria | 1429 |
| 531 | Ga0495601_0317461 | 3300053077 | Bacteria | 1014 |
| 532 | Ga0495601_0891489 | 3300053077 | Viruses | 562 |
| 533 | Ga0495612_0059460 | 3300053078 | Bacteria | 1580 |
| 534 | Ga0495595_0005853 | 3300053084 | Bacteria | 4982 |
| 535 | Ga0495595_0386397 | 3300053084 | Unclassified | 708 |
| 536 | Ga0495595_0511772 | 3300053084 | Viruses | 612 |
| 537 | Ga0495619_0212889 | 3300053085 | Bacteria | 1338 |
| 538 | Ga0495619_0268015 | 3300053085 | Bacteria | 1183 |
| 539 | Ga0495619_0519996 | 3300053085 | Unclassified | 818 |
| 540 | Ga0495619_0536431 | 3300053085 | Unclassified | 803 |
| 541 | Ga0500578_0037573 | 3300053086 | Bacteria | 3110 |
| 542 | Ga0500578_0133699 | 3300053086 | Bacteria | 1554 |
| 543 | Ga0500578_0200861 | 3300053086 | Bacteria | 1220 |
| 544 | Ga0500643_000117 | 3300053087 | Bacteria | 82982 |
| 545 | Ga0500643_079356 | 3300053087 | Bacteria | 903 |
| 546 | Ga0500644_0074274 | 3300053088 | Bacteria | 1234 |
| 547 | Ga0500583_0243017 | 3300053092 | Bacteria | 889 |
| 548 | Ga0500651_0395506 | 3300053093 | Bacteria | 777 |
| 549 | Ga0500640_154992 | 3300053095 | Bacteria | 868 |
| 550 | Ga0500648_400472 | 3300053097 | Bacteria | 521 |
| 551 | Ga0500555_004649 | 3300053103 | Bacteria | 3897 |
| 552 | Ga0500556_0136352 | 3300053104 | Bacteria | 963 |
| 553 | Ga0500562_001270 | 3300053108 | Bacteria | 6232 |
| 554 | Ga0500582_160401 | 3300053114 | Bacteria | 774 |
| 555 | Ga0500594_0046298 | 3300053118 | Bacteria | 1210 |
| 556 | Ga0500595_067706 | 3300053119 | Bacteria | 1064 |
| 557 | Ga0500607_151715 | 3300053121 | Bacteria | 1072 |
| 558 | Ga0500614_029833 | 3300053123 | Bacteria | 1326 |
| 559 | Ga0500621_180353 | 3300053126 | Bacteria | 766 |
| 560 | Ga0500642_0039611 | 3300053130 | Bacteria | 2027 |
| 561 | Ga0500652_024604 | 3300053131 | Bacteria | 2300 |
| 562 | Ga0500655_018929 | 3300053133 | Bacteria | 1280 |
| 563 | Ga0500559_0185429 | 3300053136 | Bacteria | 980 |
| 564 | Ga0500564_193409 | 3300053138 | Bacteria | 840 |
| 565 | Ga0500568_0099849 | 3300053139 | Bacteria | 1089 |
| 566 | Ga0500577_0177854 | 3300053142 | Bacteria | 912 |
| 567 | Ga0500577_0291481 | 3300053142 | Bacteria | 712 |
| 568 | Ga0500577_0311559 | 3300053142 | Bacteria | 687 |
| 569 | Ga0500588_0158658 | 3300053146 | Bacteria | 822 |
| 570 | Ga0500604_0099021 | 3300053151 | Bacteria | 959 |
| 571 | Ga0500616_0023597 | 3300053153 | Bacteria | 3425 |
| 572 | Ga0500619_201997 | 3300053154 | Bacteria | 666 |
| 573 | Ga0500620_000713 | 3300053155 | Bacteria | 5682 |
| 574 | Ga0500622_0005729 | 3300053156 | Bacteria | 7381 |
| 575 | Ga0500627_0083982 | 3300053158 | Bacteria | 1421 |
| 576 | Ga0500633_0036000 | 3300053160 | Bacteria | 1634 |
| 577 | Ga0500634_0269590 | 3300053161 | Bacteria | 694 |
| 578 | Ga0500638_168308 | 3300053162 | Bacteria | 957 |
| 579 | Ga0500637_0208947 | 3300053178 | Bacteria | 1108 |
| 580 | Ga0500645_024777 | 3300053730 | Bacteria | 1833 |
| 581 | Ga0500609_020984 | 3300053731 | Bacteria | 891 |
| 582 | Ga0500599_076600 | 3300053736 | Bacteria | 562 |
| 583 | Ga0500661_012269 | 3300055283 | Bacteria | 1547 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031249 | Ga0265339_10113712 | Ga0265339_101137122 | 69 |
| 2 | iso_pu_bacteria | 2508501042 | 2508695884 | 72 |
| 3 | iso_pu_bacteria | 2775506901 | 2776262817 | 72 |
| 4 | iso_pu_bacteria | 2847930680 | 2847931342 | 72 |
| 5 | iso_pu_bacteria | 2879083081 | 2879087619 | 72 |
| 6 | iso_pu_bacteria | 2894232714 | 2894240924 | 72 |
| 7 | iso_pu_bacteria | 2906643746 | 2906651477 | 72 |
| 8 | iso_pu_bacteria | 2935608549 | 2935614677 | 72 |
| 9 | iso_pu_bacteria | 2935769743 | 2935774668 | 72 |
| 10 | iso_pu_bacteria | 2935777560 | 2935783755 | 72 |
| 11 | iso_pu_bacteria | 2935785616 | 2935789817 | 72 |
| 12 | iso_pu_bacteria | 2935793552 | 2935797815 | 72 |
| 13 | iso_pu_bacteria | 2935819856 | 2935826282 | 72 |
| 14 | iso_pu_bacteria | 2935847175 | 2935853778 | 72 |
| 15 | iso_pu_bacteria | 2935908558 | 2935910999 | 72 |
| 16 | iso_pu_bacteria | 2935916978 | 2935924160 | 72 |
| 17 | iso_pu_bacteria | 2935926038 | 2935932787 | 72 |
| 18 | iso_pu_bacteria | 2935934488 | 2935937350 | 72 |
| 19 | iso_pu_bacteria | 2935942939 | 2935949449 | 72 |
| 20 | iso_pu_bacteria | 2935951376 | 2935958152 | 72 |
| 21 | iso_pu_bacteria | 2935967501 | 2935971193 | 72 |
| 22 | iso_pu_bacteria | 2941531003 | 2941537971 | 72 |
| 23 | iso_pu_bacteria | 8005246636 | 8005247641 | 72 |
| 24 | iso_pu_bacteria | 8016522445 | 8016525814 | 72 |
| 25 | iso_pu_bacteria | 8016530956 | 8016539413 | 72 |
| 26 | iso_pu_bacteria | 8016539877 | 8016543705 | 72 |
| 27 | iso_pu_bacteria | 8016548790 | 8016549591 | 72 |
| 28 | iso_pu_bacteria | 8016557553 | 8016558010 | 72 |
| 29 | iso_pu_bacteria | 8016566248 | 8016569108 | 72 |
| 30 | iso_pu_bacteria | 8016575299 | 8016581742 | 72 |
| 31 | iso_pu_bacteria | 8016595262 | 8016596024 | 72 |
| 32 | iso_pu_bacteria | 8016613128 | 8016618807 | 72 |
| 33 | iso_pu_bacteria | 8019530166 | 8019530694 | 72 |
| 34 | iso_pu_bacteria | 8019648815 | 8019652102 | 72 |
| 35 | iso_pu_bacteria | 8019687851 | 8019695785 | 72 |
| 36 | iso_pu_bacteria | 2935959822 | 2935967241 | 73 |
| 37 | 3300021388 | Ga0213875_10090708 | Ga0213875_100907081 | 75 |
| 38 | 3300037853 | Ga0436364_1421633 | Ga0436364_1421633_773_1000 | 75 |
| 39 | 3300039450 | Ga0436363_0172666 | Ga0436363_0172666_700_927 | 75 |
| 40 | 3300039453 | Ga0436362_0642024 | Ga0436362_0642024_49_276 | 75 |
| 41 | 3300046535 | Ga0495586_0551278 | Ga0495586_0551278_125_376 | 75 |
| 42 | 3300005262 | Ga0065165_1001154 | Ga0065165_100115434 | 76 |
| 43 | 3300005295 | Ga0065707_10540224 | Ga0065707_105402241 | 76 |
| 44 | 3300005329 | Ga0070683_101060502 | Ga0070683_1010605022 | 76 |
| 45 | 3300005330 | Ga0070690_100434527 | Ga0070690_1004345272 | 76 |
| 46 | 3300005331 | Ga0070670_100264320 | Ga0070670_1002643203 | 76 |
| 47 | 3300005336 | Ga0070680_100034242 | Ga0070680_1000342422 | 76 |
| 48 | 3300005339 | Ga0070660_101137909 | Ga0070660_1011379092 | 76 |
| 49 | 3300005340 | Ga0070689_100071198 | Ga0070689_1000711982 | 76 |
| 50 | 3300005340 | Ga0070689_101031825 | Ga0070689_1010318252 | 76 |
| 51 | 3300005344 | Ga0070661_100805769 | Ga0070661_1008057692 | 76 |
| 52 | 3300005347 | Ga0070668_100007904 | Ga0070668_10000790410 | 76 |
| 53 | 3300005347 | Ga0070668_100228198 | Ga0070668_1002281983 | 76 |
| 54 | 3300005353 | Ga0070669_100079827 | Ga0070669_1000798272 | 76 |
| 55 | 3300005353 | Ga0070669_100793561 | Ga0070669_1007935612 | 76 |
| 56 | 3300005353 | Ga0070669_101354938 | Ga0070669_1013549381 | 76 |
| 57 | 3300005354 | Ga0070675_100219909 | Ga0070675_1002199092 | 76 |
| 58 | 3300005354 | Ga0070675_101498687 | Ga0070675_1014986871 | 76 |
| 59 | 3300005355 | Ga0070671_100019566 | Ga0070671_1000195663 | 76 |
| 60 | 3300005355 | Ga0070671_100157221 | Ga0070671_1001572213 | 76 |
| 61 | 3300005355 | Ga0070671_100699259 | Ga0070671_1006992592 | 76 |
| 62 | 3300005364 | Ga0070673_100012554 | Ga0070673_1000125543 | 76 |
| 63 | 3300005366 | Ga0070659_100198704 | Ga0070659_1001987043 | 76 |
| 64 | 3300005367 | Ga0070667_100024229 | Ga0070667_1000242296 | 76 |
| 65 | 3300005434 | Ga0070709_10042880 | Ga0070709_100428803 | 76 |
| 66 | 3300005435 | Ga0070714_100018965 | Ga0070714_1000189654 | 76 |
| 67 | 3300005435 | Ga0070714_100574540 | Ga0070714_1005745402 | 76 |
| 68 | 3300005436 | Ga0070713_100521626 | Ga0070713_1005216263 | 76 |
| 69 | 3300005436 | Ga0070713_101207546 | Ga0070713_1012075462 | 76 |
| 70 | 3300005437 | Ga0070710_10391777 | Ga0070710_103917773 | 76 |
| 71 | 3300005440 | Ga0070705_101292475 | Ga0070705_1012924752 | 76 |
| 72 | 3300005455 | Ga0070663_100931794 | Ga0070663_1009317942 | 76 |
| 73 | 3300005455 | Ga0070663_101208803 | Ga0070663_1012088032 | 76 |
| 74 | 3300005455 | Ga0070663_101247664 | Ga0070663_1012476642 | 76 |
| 75 | 3300005456 | Ga0070678_100654298 | Ga0070678_1006542982 | 76 |
| 76 | 3300005457 | Ga0070662_100061582 | Ga0070662_1000615822 | 76 |
| 77 | 3300005458 | Ga0070681_10031663 | Ga0070681_100316634 | 76 |
| 78 | 3300005459 | Ga0068867_100900431 | Ga0068867_1009004312 | 76 |
| 79 | 3300005530 | Ga0070679_100018245 | Ga0070679_1000182456 | 76 |
| 80 | 3300005535 | Ga0070684_100703808 | Ga0070684_1007038082 | 76 |
| 81 | 3300005544 | Ga0070686_101081700 | Ga0070686_1010817002 | 76 |
| 82 | 3300005547 | Ga0070693_100178400 | Ga0070693_1001784001 | 76 |
| 83 | 3300005547 | Ga0070693_100519685 | Ga0070693_1005196852 | 76 |
| 84 | 3300005548 | Ga0070665_100126888 | Ga0070665_1001268883 | 76 |
| 85 | 3300005548 | Ga0070665_101821754 | Ga0070665_1018217542 | 76 |
| 86 | 3300005563 | Ga0068855_100202260 | Ga0068855_1002022602 | 76 |
| 87 | 3300005564 | Ga0070664_101062918 | Ga0070664_1010629181 | 76 |
| 88 | 3300005577 | Ga0068857_100761112 | Ga0068857_1007611122 | 76 |
| 89 | 3300005578 | Ga0068854_100764450 | Ga0068854_1007644501 | 76 |
| 90 | 3300005578 | Ga0068854_101249425 | Ga0068854_1012494252 | 76 |
| 91 | 3300005614 | Ga0068856_101121751 | Ga0068856_1011217512 | 76 |
| 92 | 3300005614 | Ga0068856_101291964 | Ga0068856_1012919642 | 76 |
| 93 | 3300005614 | Ga0068856_101497677 | Ga0068856_1014976772 | 76 |
| 94 | 3300005615 | Ga0070702_101269170 | Ga0070702_1012691701 | 76 |
| 95 | 3300005616 | Ga0068852_101666922 | Ga0068852_1016669221 | 76 |
| 96 | 3300005617 | Ga0068859_100029735 | Ga0068859_1000297353 | 76 |
| 97 | 3300005617 | Ga0068859_100687559 | Ga0068859_1006875591 | 76 |
| 98 | 3300005618 | Ga0068864_100083027 | Ga0068864_1000830272 | 76 |
| 99 | 3300005618 | Ga0068864_100377388 | Ga0068864_1003773883 | 76 |
| 100 | 3300005618 | Ga0068864_101616663 | Ga0068864_1016166631 | 76 |
| 101 | 3300005719 | Ga0068861_100022727 | Ga0068861_1000227275 | 76 |
| 102 | 3300005719 | Ga0068861_100976646 | Ga0068861_1009766462 | 76 |
| 103 | 3300005842 | Ga0068858_101283057 | Ga0068858_1012830572 | 76 |
| 104 | 3300005843 | Ga0068860_100000268 | Ga0068860_10000026855 | 76 |
| 105 | 3300005843 | Ga0068860_100016951 | Ga0068860_1000169517 | 76 |
| 106 | 3300005843 | Ga0068860_101790294 | Ga0068860_1017902941 | 76 |
| 107 | 3300005843 | Ga0068860_102461346 | Ga0068860_1024613462 | 76 |
| 108 | 3300005844 | Ga0068862_100057617 | Ga0068862_1000576172 | 76 |
| 109 | 3300005844 | Ga0068862_101091892 | Ga0068862_1010918922 | 76 |
| 110 | 3300006028 | Ga0070717_10247006 | Ga0070717_102470063 | 76 |
| 111 | 3300006028 | Ga0070717_11088945 | Ga0070717_110889452 | 76 |
| 112 | 3300006163 | Ga0070715_10092266 | Ga0070715_100922662 | 76 |
| 113 | 3300006173 | Ga0070716_101666091 | Ga0070716_1016660911 | 76 |
| 114 | 3300006175 | Ga0070712_100931594 | Ga0070712_1009315942 | 76 |
| 115 | 3300006186 | Ga0075369_10016504 | Ga0075369_100165042 | 76 |
| 116 | 3300006237 | Ga0097621_101663767 | Ga0097621_1016637672 | 76 |
| 117 | 3300006358 | Ga0068871_100047607 | Ga0068871_1000476072 | 76 |
| 118 | 3300006844 | Ga0075428_100195559 | Ga0075428_1001955592 | 76 |
| 119 | 3300006871 | Ga0075434_101256052 | Ga0075434_1012560522 | 76 |
| 120 | 3300006871 | Ga0075434_101951931 | Ga0075434_1019519311 | 76 |
| 121 | 3300006871 | Ga0075434_102127478 | Ga0075434_1021274781 | 76 |
| 122 | 3300006914 | Ga0075436_100152759 | Ga0075436_1001527594 | 76 |
| 123 | 3300006914 | Ga0075436_100391785 | Ga0075436_1003917852 | 76 |
| 124 | 3300006914 | Ga0075436_101506194 | Ga0075436_1015061941 | 76 |
| 125 | 3300006931 | Ga0097620_100029735 | Ga0097620_1000297357 | 76 |
| 126 | 3300006931 | Ga0097620_100687631 | Ga0097620_1006876311 | 76 |
| 127 | 3300006931 | Ga0097620_101289292 | Ga0097620_1012892922 | 76 |
| 128 | 3300006944 | Ga0099823_1022011 | Ga0099823_10220115 | 76 |
| 129 | 3300007076 | Ga0075435_101662010 | Ga0075435_1016620102 | 76 |
| 130 | 3300009036 | Ga0105244_10486580 | Ga0105244_104865802 | 76 |
| 131 | 3300009093 | Ga0105240_10083631 | Ga0105240_100836315 | 76 |
| 132 | 3300009093 | Ga0105240_10989914 | Ga0105240_109899142 | 76 |
| 133 | 3300009093 | Ga0105240_12637619 | Ga0105240_126376192 | 76 |
| 134 | 3300009094 | Ga0111539_10079945 | Ga0111539_100799456 | 76 |
| 135 | 3300009094 | Ga0111539_10372851 | Ga0111539_103728511 | 76 |
| 136 | 3300009094 | Ga0111539_10388958 | Ga0111539_103889581 | 76 |
| 137 | 3300009098 | Ga0105245_10142087 | Ga0105245_101420873 | 76 |
| 138 | 3300009098 | Ga0105245_11186593 | Ga0105245_111865932 | 76 |
| 139 | 3300009101 | Ga0105247_10620167 | Ga0105247_106201672 | 76 |
| 140 | 3300009147 | Ga0114129_10101757 | Ga0114129_101017572 | 76 |
| 141 | 3300009148 | Ga0105243_10161008 | Ga0105243_101610083 | 76 |
| 142 | 3300009148 | Ga0105243_10330818 | Ga0105243_103308182 | 76 |
| 143 | 3300009148 | Ga0105243_10652983 | Ga0105243_106529832 | 76 |
| 144 | 3300009174 | Ga0105241_10365962 | Ga0105241_103659622 | 76 |
| 145 | 3300009174 | Ga0105241_10408075 | Ga0105241_104080752 | 76 |
| 146 | 3300009176 | Ga0105242_11299373 | Ga0105242_112993731 | 76 |
| 147 | 3300009177 | Ga0105248_10343146 | Ga0105248_103431462 | 76 |
| 148 | 3300009545 | Ga0105237_10230692 | Ga0105237_102306923 | 76 |
| 149 | 3300009545 | Ga0105237_10737447 | Ga0105237_107374472 | 76 |
| 150 | 3300009545 | Ga0105237_12392469 | Ga0105237_123924691 | 76 |
| 151 | 3300009551 | Ga0105238_10479338 | Ga0105238_104793382 | 76 |
| 152 | 3300009553 | Ga0105249_10210530 | Ga0105249_102105303 | 76 |
| 153 | 3300010375 | Ga0105239_10029546 | Ga0105239_100295466 | 76 |
| 154 | 3300010375 | Ga0105239_10164651 | Ga0105239_101646515 | 76 |
| 155 | 3300010375 | Ga0105239_10421145 | Ga0105239_104211453 | 76 |
| 156 | 3300011119 | Ga0105246_10067042 | Ga0105246_100670424 | 76 |
| 157 | 3300011119 | Ga0105246_10978190 | Ga0105246_109781902 | 76 |
| 158 | 3300011119 | Ga0105246_11903295 | Ga0105246_119032952 | 76 |
| 159 | 3300011119 | Ga0105246_11904209 | Ga0105246_119042091 | 76 |
| 160 | 3300013296 | Ga0157374_10517778 | Ga0157374_105177782 | 76 |
| 161 | 3300013296 | Ga0157374_10932818 | Ga0157374_109328181 | 76 |
| 162 | 3300013297 | Ga0157378_10395102 | Ga0157378_103951022 | 76 |
| 163 | 3300013297 | Ga0157378_10931766 | Ga0157378_109317662 | 76 |
| 164 | 3300013297 | Ga0157378_11122201 | Ga0157378_111222013 | 76 |
| 165 | 3300013297 | Ga0157378_11339907 | Ga0157378_113399072 | 76 |
| 166 | 3300013306 | Ga0163162_10601418 | Ga0163162_106014182 | 76 |
| 167 | 3300013306 | Ga0163162_11026732 | Ga0163162_110267323 | 76 |
| 168 | 3300013308 | Ga0157375_13613425 | Ga0157375_136134252 | 76 |
| 169 | 3300014325 | Ga0163163_10573307 | Ga0163163_105733073 | 76 |
| 170 | 3300014326 | Ga0157380_10007924 | Ga0157380_100079241 | 76 |
| 171 | 3300014326 | Ga0157380_10252991 | Ga0157380_102529912 | 76 |
| 172 | 3300014745 | Ga0157377_10279372 | Ga0157377_102793722 | 76 |
| 173 | 3300014745 | Ga0157377_10692885 | Ga0157377_106928852 | 76 |
| 174 | 3300014969 | Ga0157376_10050292 | Ga0157376_100502922 | 76 |
| 175 | 3300014969 | Ga0157376_10875651 | Ga0157376_108756512 | 76 |
| 176 | 3300014969 | Ga0157376_12954952 | Ga0157376_129549522 | 76 |
| 177 | 3300021377 | Ga0213874_10050250 | Ga0213874_100502505 | 76 |
| 178 | 3300021384 | Ga0213876_10009102 | Ga0213876_100091024 | 76 |
| 179 | 3300021384 | Ga0213876_10499196 | Ga0213876_104991962 | 76 |
| 180 | 3300021441 | Ga0213871_10164551 | Ga0213871_101645512 | 76 |
| 181 | 3300022732 | Ga0224569_101604 | Ga0224569_1016042 | 76 |
| 182 | 3300022734 | Ga0224571_102028 | Ga0224571_1020282 | 76 |
| 183 | 3300024225 | Ga0224572_1107773 | Ga0224572_11077732 | 76 |
| 184 | 3300024227 | Ga0228598_1009083 | Ga0228598_10090832 | 76 |
| 185 | 3300025302 | Ga0207426_1086606 | Ga0207426_10866062 | 76 |
| 186 | 3300025898 | Ga0207692_10624012 | Ga0207692_106240121 | 76 |
| 187 | 3300025901 | Ga0207688_10118753 | Ga0207688_101187531 | 76 |
| 188 | 3300025906 | Ga0207699_10063045 | Ga0207699_100630452 | 76 |
| 189 | 3300025908 | Ga0207643_10319237 | Ga0207643_103192372 | 76 |
| 190 | 3300025911 | Ga0207654_10475195 | Ga0207654_104751951 | 76 |
| 191 | 3300025912 | Ga0207707_10030602 | Ga0207707_100306025 | 76 |
| 192 | 3300025913 | Ga0207695_10124972 | Ga0207695_101249725 | 76 |
| 193 | 3300025914 | Ga0207671_10992947 | Ga0207671_109929471 | 76 |
| 194 | 3300025914 | Ga0207671_11044254 | Ga0207671_110442541 | 76 |
| 195 | 3300025915 | Ga0207693_10351953 | Ga0207693_103519533 | 76 |
| 196 | 3300025915 | Ga0207693_10645401 | Ga0207693_106454012 | 76 |
| 197 | 3300025916 | Ga0207663_10110496 | Ga0207663_101104962 | 76 |
| 198 | 3300025916 | Ga0207663_11261955 | Ga0207663_112619551 | 76 |
| 199 | 3300025917 | Ga0207660_10032900 | Ga0207660_100329002 | 76 |
| 200 | 3300025921 | Ga0207652_10062805 | Ga0207652_100628055 | 76 |
| 201 | 3300025923 | Ga0207681_10146919 | Ga0207681_101469191 | 76 |
| 202 | 3300025923 | Ga0207681_10579884 | Ga0207681_105798843 | 76 |
| 203 | 3300025924 | Ga0207694_10690124 | Ga0207694_106901242 | 76 |
| 204 | 3300025925 | Ga0207650_10119740 | Ga0207650_101197403 | 76 |
| 205 | 3300025925 | Ga0207650_10152749 | Ga0207650_101527493 | 76 |
| 206 | 3300025927 | Ga0207687_10030630 | Ga0207687_100306304 | 76 |
| 207 | 3300025928 | Ga0207700_10346389 | Ga0207700_103463892 | 76 |
| 208 | 3300025928 | Ga0207700_11213512 | Ga0207700_112135121 | 76 |
| 209 | 3300025931 | Ga0207644_10006764 | Ga0207644_100067646 | 76 |
| 210 | 3300025931 | Ga0207644_10111530 | Ga0207644_101115303 | 76 |
| 211 | 3300025933 | Ga0207706_10285462 | Ga0207706_102854621 | 76 |
| 212 | 3300025933 | Ga0207706_10633921 | Ga0207706_106339211 | 76 |
| 213 | 3300025934 | Ga0207686_11478431 | Ga0207686_114784311 | 76 |
| 214 | 3300025935 | Ga0207709_10179535 | Ga0207709_101795353 | 76 |
| 215 | 3300025935 | Ga0207709_10757538 | Ga0207709_107575382 | 76 |
| 216 | 3300025936 | Ga0207670_10027789 | Ga0207670_100277893 | 76 |
| 217 | 3300025938 | Ga0207704_11302956 | Ga0207704_113029562 | 76 |
| 218 | 3300025940 | Ga0207691_10135438 | Ga0207691_101354382 | 76 |
| 219 | 3300025941 | Ga0207711_10621994 | Ga0207711_106219942 | 76 |
| 220 | 3300025941 | Ga0207711_10968208 | Ga0207711_109682082 | 76 |
| 221 | 3300025945 | Ga0207679_10084497 | Ga0207679_100844973 | 76 |
| 222 | 3300025949 | Ga0207667_10120516 | Ga0207667_101205164 | 76 |
| 223 | 3300025960 | Ga0207651_10005889 | Ga0207651_100058895 | 76 |
| 224 | 3300025972 | Ga0207668_10018118 | Ga0207668_100181186 | 76 |
| 225 | 3300025972 | Ga0207668_10147330 | Ga0207668_101473302 | 76 |
| 226 | 3300025972 | Ga0207668_10489869 | Ga0207668_104898691 | 76 |
| 227 | 3300025981 | Ga0207640_10825610 | Ga0207640_108256102 | 76 |
| 228 | 3300025981 | Ga0207640_12110885 | Ga0207640_121108852 | 76 |
| 229 | 3300025986 | Ga0207658_10345394 | Ga0207658_103453942 | 76 |
| 230 | 3300026035 | Ga0207703_10983140 | Ga0207703_109831402 | 76 |
| 231 | 3300026035 | Ga0207703_11111933 | Ga0207703_111119332 | 76 |
| 232 | 3300026067 | Ga0207678_10976460 | Ga0207678_109764602 | 76 |
| 233 | 3300026067 | Ga0207678_11371221 | Ga0207678_113712212 | 76 |
| 234 | 3300026067 | Ga0207678_11581433 | Ga0207678_115814331 | 76 |
| 235 | 3300026078 | Ga0207702_11143497 | Ga0207702_111434971 | 76 |
| 236 | 3300026078 | Ga0207702_11749581 | Ga0207702_117495812 | 76 |
| 237 | 3300026089 | Ga0207648_12124193 | Ga0207648_121241931 | 76 |
| 238 | 3300026095 | Ga0207676_10147427 | Ga0207676_101474272 | 76 |
| 239 | 3300026095 | Ga0207676_11047340 | Ga0207676_110473402 | 76 |
| 240 | 3300026095 | Ga0207676_11606843 | Ga0207676_116068432 | 76 |
| 241 | 3300026116 | Ga0207674_11772765 | Ga0207674_117727651 | 76 |
| 242 | 3300026118 | Ga0207675_100017209 | Ga0207675_1000172096 | 76 |
| 243 | 3300026118 | Ga0207675_100256068 | Ga0207675_1002560681 | 76 |
| 244 | 3300026118 | Ga0207675_100926428 | Ga0207675_1009264283 | 76 |
| 245 | 3300026121 | Ga0207683_10125646 | Ga0207683_101256463 | 76 |
| 246 | 3300027296 | Ga0209389_1000163 | Ga0209389_100016313 | 76 |
| 247 | 3300027361 | Ga0209489_101100 | Ga0209489_10110013 | 76 |
| 248 | 3300027363 | Ga0209700_100014 | Ga0209700_100014226 | 76 |
| 249 | 3300028379 | Ga0268266_10085221 | Ga0268266_100852213 | 76 |
| 250 | 3300028379 | Ga0268266_11615499 | Ga0268266_116154991 | 76 |
| 251 | 3300028380 | Ga0268265_10310652 | Ga0268265_103106523 | 76 |
| 252 | 3300028381 | Ga0268264_10000084 | Ga0268264_10000084184 | 76 |
| 253 | 3300028381 | Ga0268264_10043258 | Ga0268264_100432586 | 76 |
| 254 | 3300028381 | Ga0268264_11649250 | Ga0268264_116492501 | 76 |
| 255 | 3300028556 | Ga0265337_1001532 | Ga0265337_10015325 | 76 |
| 256 | 3300028573 | Ga0265334_10003016 | Ga0265334_100030164 | 76 |
| 257 | 3300028800 | Ga0265338_10005127 | Ga0265338_1000512711 | 76 |
| 258 | 3300031241 | Ga0265325_10094196 | Ga0265325_100941962 | 76 |
| 259 | 3300031344 | Ga0265316_10266742 | Ga0265316_102667423 | 76 |
| 260 | 3300031344 | Ga0265316_10993832 | Ga0265316_109938321 | 76 |
| 261 | 3300031548 | Ga0307408_101542547 | Ga0307408_1015425471 | 76 |
| 262 | 3300031595 | Ga0265313_10026043 | Ga0265313_100260432 | 76 |
| 263 | 3300031595 | Ga0265313_10161140 | Ga0265313_101611402 | 76 |
| 264 | 3300031995 | Ga0307409_101410659 | Ga0307409_1014106592 | 76 |
| 265 | 3300031995 | Ga0307409_102264235 | Ga0307409_1022642352 | 76 |
| 266 | 3300032005 | Ga0307411_10848627 | Ga0307411_108486272 | 76 |
| 267 | 3300032126 | Ga0307415_100397924 | Ga0307415_1003979243 | 76 |
| 268 | 3300033180 | Ga0307510_10112763 | Ga0307510_101127633 | 76 |
| 269 | 3300033180 | Ga0307510_10460404 | Ga0307510_104604042 | 76 |
| 270 | 3300035083 | Ga0373926_0442699 | Ga0373926_0442699_210_443 | 76 |
| 271 | 3300035086 | Ga0373934_0308384 | Ga0373934_0308384_357_614 | 76 |
| 272 | 3300035089 | Ga0373944_0083672 | Ga0373944_0083672_317_550 | 76 |
| 273 | 3300035111 | Ga0373923_0556123 | Ga0373923_0556123_219_473 | 76 |
| 274 | 3300035116 | Ga0373945_0474794 | Ga0373945_0474794_121_354 | 76 |
| 275 | 3300035117 | Ga0373953_0394982 | Ga0373953_0394982_107_337 | 76 |
| 276 | 3300035118 | Ga0373954_0427590 | Ga0373954_0427590_365_598 | 76 |
| 277 | 3300035170 | Ga0373943_0523167 | Ga0373943_0523167_234_491 | 76 |
| 278 | 3300035171 | Ga0373946_0286958 | Ga0373946_0286958_517_750 | 76 |
| 279 | 3300035171 | Ga0373946_0597814 | Ga0373946_0597814_29_262 | 76 |
| 280 | 3300035171 | Ga0373946_0605013 | Ga0373946_0605013_194_451 | 76 |
| 281 | 3300035172 | Ga0373955_0360446 | Ga0373955_0360446_245_475 | 76 |
| 282 | 3300035172 | Ga0373955_0436474 | Ga0373955_0436474_459_692 | 76 |
| 283 | 3300035692 | Ga0373935_0146888 | Ga0373935_0146888_477_710 | 76 |
| 284 | 3300035692 | Ga0373935_0580915 | Ga0373935_0580915_573_806 | 76 |
| 285 | 3300035695 | Ga0373927_0040261 | Ga0373927_0040261_2141_2374 | 76 |
| 286 | 3300035695 | Ga0373927_0145017 | Ga0373927_0145017_651_893 | 76 |
| 287 | 3300035695 | Ga0373927_0183799 | Ga0373927_0183799_924_1181 | 76 |
| 288 | 3300035724 | Ga0373933_0503343 | Ga0373933_0503343_397_627 | 76 |
| 289 | 3300035724 | Ga0373933_0626213 | Ga0373933_0626213_433_666 | 76 |
| 290 | 3300035725 | Ga0373947_0017017 | Ga0373947_0017017_2799_3032 | 76 |
| 291 | 3300035725 | Ga0373947_0123023 | Ga0373947_0123023_125_358 | 76 |
| 292 | 3300036401 | Ga0373937_0798541 | Ga0373937_0798541_512_745 | 76 |
| 293 | 3300037068 | Ga0373925_0041445 | Ga0373925_0041445_2562_2804 | 76 |
| 294 | 3300037068 | Ga0373925_0227139 | Ga0373925_0227139_161_418 | 76 |
| 295 | 3300037068 | Ga0373925_0277974 | Ga0373925_0277974_643_876 | 76 |
| 296 | 3300037068 | Ga0373925_0608972 | Ga0373925_0608972_496_774 | 76 |
| 297 | 3300037312 | Ga0395899_0783190 | Ga0395899_0783190_193_423 | 76 |
| 298 | 3300039437 | Ga0436365_1309872 | Ga0436365_1309872_317_547 | 76 |
| 299 | 3300039437 | Ga0436365_1716550 | Ga0436365_1716550_399_632 | 76 |
| 300 | 3300039438 | Ga0436360_1046720 | Ga0436360_1046720_445_714 | 76 |
| 301 | 3300039447 | Ga0436361_0674457 | Ga0436361_0674457_279_548 | 76 |
| 302 | 3300039450 | Ga0436363_1648471 | Ga0436363_1648471_68_337 | 76 |
| 303 | 3300041498 | Ga0451841_1458524 | Ga0451841_1458524_299_550 | 76 |
| 304 | 3300041512 | Ga0451853_2443084 | Ga0451853_2443084_422_664 | 76 |
| 305 | 3300044684 | Ga0466966_0018882 | Ga0466966_0018882_3803_4033 | 76 |
| 306 | 3300044684 | Ga0466966_0262046 | Ga0466966_0262046_751_981 | 76 |
| 307 | 3300044693 | Ga0466961_0176177 | Ga0466961_0176177_902_1132 | 76 |
| 308 | 3300044693 | Ga0466961_0419577 | Ga0466961_0419577_334_564 | 76 |
| 309 | 3300044901 | Ga0466960_0722486 | Ga0466960_0722486_115_366 | 76 |
| 310 | 3300045049 | Ga0466959_0035456 | Ga0466959_0035456_3066_3296 | 76 |
| 311 | 3300045836 | Ga0466958_0276593 | Ga0466958_0276593_249_479 | 76 |
| 312 | 3300045976 | Ga0466967_0139284 | Ga0466967_0139284_835_1071 | 76 |
| 313 | 3300046452 | Ga0495617_103380 | Ga0495617_103380_99_341 | 76 |
| 314 | 3300046452 | Ga0495617_219080 | Ga0495617_219080_212_445 | 76 |
| 315 | 3300046454 | Ga0495592_0582116 | Ga0495592_0582116_143_400 | 76 |
| 316 | 3300046455 | Ga0495603_0177359 | Ga0495603_0177359_211_444 | 76 |
| 317 | 3300046455 | Ga0495603_0650037 | Ga0495603_0650037_87_320 | 76 |
| 318 | 3300046459 | Ga0495629_0529375 | Ga0495629_0529375_30_263 | 76 |
| 319 | 3300046460 | Ga0495638_0004594 | Ga0495638_0004594_7102_7344 | 76 |
| 320 | 3300046461 | Ga0495641_0581983 | Ga0495641_0581983_42_275 | 76 |
| 321 | 3300046462 | Ga0495651_0244190 | Ga0495651_0244190_127_360 | 76 |
| 322 | 3300046463 | Ga0495653_0114524 | Ga0495653_0114524_534_875 | 76 |
| 323 | 3300046463 | Ga0495653_0261187 | Ga0495653_0261187_261_491 | 76 |
| 324 | 3300046463 | Ga0495653_0311048 | Ga0495653_0311048_131_388 | 76 |
| 325 | 3300046472 | Ga0495580_0114661 | Ga0495580_0114661_998_1231 | 76 |
| 326 | 3300046473 | Ga0495582_0667227 | Ga0495582_0667227_333_566 | 76 |
| 327 | 3300046476 | Ga0495662_0354087 | Ga0495662_0354087_146_379 | 76 |
| 328 | 3300046476 | Ga0495662_0595936 | Ga0495662_0595936_286_519 | 76 |
| 329 | 3300046476 | Ga0495662_0657183 | Ga0495662_0657183_143_376 | 76 |
| 330 | 3300046477 | Ga0495664_0834738 | Ga0495664_0834738_90_323 | 76 |
| 331 | 3300046499 | Ga0495594_0103147 | Ga0495594_0103147_75_308 | 76 |
| 332 | 3300046506 | Ga0495583_0249995 | Ga0495583_0249995_170_412 | 76 |
| 333 | 3300046507 | Ga0495606_0116727 | Ga0495606_0116727_1166_1396 | 76 |
| 334 | 3300046512 | Ga0495610_0133258 | Ga0495610_0133258_495_737 | 76 |
| 335 | 3300046514 | Ga0495618_0611436 | Ga0495618_0611436_209_442 | 76 |
| 336 | 3300046517 | Ga0495630_1226776 | Ga0495630_1226776_318_551 | 76 |
| 337 | 3300046518 | Ga0495631_0111893 | Ga0495631_0111893_541_783 | 76 |
| 338 | 3300046519 | Ga0495632_0308259 | Ga0495632_0308259_461_691 | 76 |
| 339 | 3300046522 | Ga0495643_0145894 | Ga0495643_0145894_297_527 | 76 |
| 340 | 3300046524 | Ga0495648_0009414 | Ga0495648_0009414_2457_2687 | 76 |
| 341 | 3300046524 | Ga0495648_0126300 | Ga0495648_0126300_409_651 | 76 |
| 342 | 3300046526 | Ga0495666_0090511 | Ga0495666_0090511_623_856 | 76 |
| 343 | 3300046526 | Ga0495666_0431102 | Ga0495666_0431102_14_247 | 76 |
| 344 | 3300046529 | Ga0495652_0502599 | Ga0495652_0502599_16_249 | 76 |
| 345 | 3300046531 | Ga0495665_0042920 | Ga0495665_0042920_1992_2249 | 76 |
| 346 | 3300046531 | Ga0495665_0205698 | Ga0495665_0205698_639_872 | 76 |
| 347 | 3300046533 | Ga0495640_0585669 | Ga0495640_0585669_332_589 | 76 |
| 348 | 3300046536 | Ga0495587_0413401 | Ga0495587_0413401_146_376 | 76 |
| 349 | 3300046536 | Ga0495587_0577381 | Ga0495587_0577381_332_565 | 76 |
| 350 | 3300046557 | Ga0495622_0122451 | Ga0495622_0122451_647_880 | 76 |
| 351 | 3300046559 | Ga0495667_0525845 | Ga0495667_0525845_158_391 | 76 |
| 352 | 3300046616 | Ga0495668_0189078 | Ga0495668_0189078_859_1089 | 76 |
| 353 | 3300046642 | Ga0495634_0100221 | Ga0495634_0100221_1190_1423 | 76 |
| 354 | 3300046642 | Ga0495634_0124360 | Ga0495634_0124360_1369_1626 | 76 |
| 355 | 3300046642 | Ga0495634_0523034 | Ga0495634_0523034_61_291 | 76 |
| 356 | 3300046648 | Ga0495611_0174619 | Ga0495611_0174619_736_978 | 76 |
| 357 | 3300046648 | Ga0495611_0349216 | Ga0495611_0349216_132_365 | 76 |
| 358 | 3300046660 | Ga0495625_0892379 | Ga0495625_0892379_67_309 | 76 |
| 359 | 3300046663 | Ga0495635_0108320 | Ga0495635_0108320_369_626 | 76 |
| 360 | 3300046664 | Ga0495659_0094080 | Ga0495659_0094080_852_1085 | 76 |
| 361 | 3300046665 | Ga0495661_0277942 | Ga0495661_0277942_95_337 | 76 |
| 362 | 3300046665 | Ga0495661_0603370 | Ga0495661_0603370_49_282 | 76 |
| 363 | 3300046674 | Ga0495588_0115934 | Ga0495588_0115934_134_388 | 76 |
| 364 | 3300046674 | Ga0495588_0725395 | Ga0495588_0725395_124_357 | 76 |
| 365 | 3300046678 | Ga0495599_0447820 | Ga0495599_0447820_42_275 | 76 |
| 366 | 3300046680 | Ga0495646_0383302 | Ga0495646_0383302_446_679 | 76 |
| 367 | 3300046681 | Ga0495647_0131906 | Ga0495647_0131906_724_957 | 76 |
| 368 | 3300046681 | Ga0495647_0154729 | Ga0495647_0154729_570_851 | 76 |
| 369 | 3300046681 | Ga0495647_0404336 | Ga0495647_0404336_44_277 | 76 |
| 370 | 3300046689 | Ga0495613_0704324 | Ga0495613_0704324_90_323 | 76 |
| 371 | 3300046690 | Ga0495624_0741969 | Ga0495624_0741969_91_387 | 76 |
| 372 | 3300046694 | Ga0495649_0019237 | Ga0495649_0019237_1068_1298 | 76 |
| 373 | 3300046694 | Ga0495649_0257446 | Ga0495649_0257446_17_259 | 76 |
| 374 | 3300047315 | Ga0495581_0115808 | Ga0495581_0115808_45_278 | 76 |
| 375 | 3300047315 | Ga0495581_0404079 | Ga0495581_0404079_268_549 | 76 |
| 376 | 3300047315 | Ga0495581_0418648 | Ga0495581_0418648_528_761 | 76 |
| 377 | 3300047317 | Ga0495604_0352623 | Ga0495604_0352623_444_698 | 76 |
| 378 | 3300047319 | Ga0495674_0062120 | Ga0495674_0062120_1787_2041 | 76 |
| 379 | 3300047319 | Ga0495674_0739714 | Ga0495674_0739714_112_342 | 76 |
| 380 | 3300047320 | Ga0495672_0177727 | Ga0495672_0177727_738_971 | 76 |
| 381 | 3300047320 | Ga0495672_0245552 | Ga0495672_0245552_587_829 | 76 |
| 382 | 3300047321 | Ga0495676_0120638 | Ga0495676_0120638_378_611 | 76 |
| 383 | 3300047322 | Ga0495680_0232889 | Ga0495680_0232889_906_1163 | 76 |
| 384 | 3300047323 | Ga0495683_0058140 | Ga0495683_0058140_752_982 | 76 |
| 385 | 3300047471 | Ga0495684_0396084 | Ga0495684_0396084_717_950 | 76 |
| 386 | 3300047471 | Ga0495684_0616903 | Ga0495684_0616903_88_318 | 76 |
| 387 | 3300047472 | Ga0495686_0596580 | Ga0495686_0596580_51_281 | 76 |
| 388 | 3300047673 | Ga0495593_0459330 | Ga0495593_0459330_162_395 | 76 |
| 389 | 3300048088 | Ga0495602_0116927 | Ga0495602_0116927_173_403 | 76 |
| 390 | 3300048089 | Ga0495614_0265744 | Ga0495614_0265744_176_409 | 76 |
| 391 | 3300048903 | Ga0496100_0006947 | Ga0496100_0006947_1647_1877 | 76 |
| 392 | 3300048904 | Ga0496101_0002879 | Ga0496101_0002879_10055_10285 | 76 |
| 393 | 3300048905 | Ga0496102_0013972 | Ga0496102_0013972_901_1131 | 76 |
| 394 | 3300048905 | Ga0496102_0470955 | Ga0496102_0470955_877_1110 | 76 |
| 395 | 3300048905 | Ga0496102_0530466 | Ga0496102_0530466_626_859 | 76 |
| 396 | 3300048905 | Ga0496102_0896040 | Ga0496102_0896040_199_441 | 76 |
| 397 | 3300048905 | Ga0496102_1202409 | Ga0496102_1202409_77_319 | 76 |
| 398 | 3300048906 | Ga0496103_0086498 | Ga0496103_0086498_1145_1378 | 76 |
| 399 | 3300048906 | Ga0496103_0104277 | Ga0496103_0104277_53_283 | 76 |
| 400 | 3300048907 | Ga0496104_0011750 | Ga0496104_0011750_406_636 | 76 |
| 401 | 3300048909 | Ga0496106_0000376 | Ga0496106_0000376_437_667 | 76 |
| 402 | 3300048910 | Ga0496107_0004183 | Ga0496107_0004183_6408_6638 | 76 |
| 403 | 3300048910 | Ga0496107_0322613 | Ga0496107_0322613_511_765 | 76 |
| 404 | 3300048911 | Ga0496108_0076434 | Ga0496108_0076434_1508_1762 | 76 |
| 405 | 3300048911 | Ga0496108_0333237 | Ga0496108_0333237_383_613 | 76 |
| 406 | 3300048911 | Ga0496108_0689498 | Ga0496108_0689498_412_645 | 76 |
| 407 | 3300048911 | Ga0496108_0965761 | Ga0496108_0965761_466_699 | 76 |
| 408 | 3300048912 | Ga0496109_0048703 | Ga0496109_0048703_3096_3326 | 76 |
| 409 | 3300048912 | Ga0496109_0461222 | Ga0496109_0461222_321_554 | 76 |
| 410 | 3300048913 | Ga0496110_0037229 | Ga0496110_0037229_796_1026 | 76 |
| 411 | 3300048913 | Ga0496110_0046555 | Ga0496110_0046555_3371_3604 | 76 |
| 412 | 3300048913 | Ga0496110_0099450 | Ga0496110_0099450_1601_1855 | 76 |
| 413 | 3300048913 | Ga0496110_0323344 | Ga0496110_0323344_907_1140 | 76 |
| 414 | 3300048914 | Ga0496111_0121568 | Ga0496111_0121568_1532_1786 | 76 |
| 415 | 3300048914 | Ga0496111_0185919 | Ga0496111_0185919_970_1203 | 76 |
| 416 | 3300048915 | Ga0496112_0014918 | Ga0496112_0014918_1724_1957 | 76 |
| 417 | 3300048915 | Ga0496112_0085760 | Ga0496112_0085760_448_702 | 76 |
| 418 | 3300048915 | Ga0496112_0189748 | Ga0496112_0189748_412_681 | 76 |
| 419 | 3300048916 | Ga0496113_0387147 | Ga0496113_0387147_454_708 | 76 |
| 420 | 3300048916 | Ga0496113_1020911 | Ga0496113_1020911_16_249 | 76 |
| 421 | 3300048918 | Ga0496115_0047962 | Ga0496115_0047962_1511_1741 | 76 |
| 422 | 3300048918 | Ga0496115_0334456 | Ga0496115_0334456_617_850 | 76 |
| 423 | 3300048921 | Ga0496118_0047326 | Ga0496118_0047326_1114_1347 | 76 |
| 424 | 3300048924 | Ga0496121_0597350 | Ga0496121_0597350_272_502 | 76 |
| 425 | 3300048924 | Ga0496121_0641551 | Ga0496121_0641551_260_490 | 76 |
| 426 | 3300048928 | Ga0496125_0402554 | Ga0496125_0402554_133_363 | 76 |
| 427 | 3300048929 | Ga0496126_0279862 | Ga0496126_0279862_363_593 | 76 |
| 428 | 3300049569 | Ga0501032_0197142 | Ga0501032_0197142_287_517 | 76 |
| 429 | 3300049570 | Ga0501033_0357765 | Ga0501033_0357765_482_712 | 76 |
| 430 | 3300049571 | Ga0501034_0015559 | Ga0501034_0015559_2948_3178 | 76 |
| 431 | 3300049572 | Ga0501036_0158186 | Ga0501036_0158186_1152_1382 | 76 |
| 432 | 3300049574 | Ga0501038_0222333 | Ga0501038_0222333_1119_1349 | 76 |
| 433 | 3300049578 | Ga0501042_1222242 | Ga0501042_1222242_25_258 | 76 |
| 434 | 3300049580 | Ga0501046_0190509 | Ga0501046_0190509_619_849 | 76 |
| 435 | 3300049581 | Ga0501047_0007395 | Ga0501047_0007395_1675_1905 | 76 |
| 436 | 3300049586 | Ga0501070_0018451 | Ga0501070_0018451_5201_5431 | 76 |
| 437 | 3300049587 | Ga0501071_0255503 | Ga0501071_0255503_420_653 | 76 |
| 438 | 3300049589 | Ga0501073_0129007 | Ga0501073_0129007_365_595 | 76 |
| 439 | 3300049665 | Ga0501227_171080 | Ga0501227_171080_157_387 | 76 |
| 440 | 3300049669 | Ga0501235_215381 | Ga0501235_215381_137_367 | 76 |
| 441 | 3300049741 | Ga0501079_0563253 | Ga0501079_0563253_582_815 | 76 |
| 442 | 3300049742 | Ga0501080_0461200 | Ga0501080_0461200_849_1079 | 76 |
| 443 | 3300049765 | Ga0501268_180761 | Ga0501268_180761_111_341 | 76 |
| 444 | 3300049822 | Ga0501035_0006264 | Ga0501035_0006264_5677_5907 | 76 |
| 445 | 3300049823 | Ga0501044_0105996 | Ga0501044_0105996_103_333 | 76 |
| 446 | 3300049851 | Ga0501212_101705 | Ga0501212_101705_11_253 | 76 |
| 447 | 3300050492 | nmdc:mga0yw44_667867_c1 | nmdc:mga0yw44_667867_c1_233_466 | 76 |
| 448 | 3300050507 | nmdc:mga05p37_88293_c1 | nmdc:mga05p37_88293_c1_392_625 | 76 |
| 449 | 3300050508 | nmdc:mga09592_848283_c1 | nmdc:mga09592_848283_c1_121_354 | 76 |
| 450 | 3300050511 | nmdc:mga08y16_462792_c1 | nmdc:mga08y16_462792_c1_995_1237 | 76 |
| 451 | 3300050512 | nmdc:mga0n895_1385432_c1 | nmdc:mga0n895_1385432_c1_44_274 | 76 |
| 452 | 3300050512 | nmdc:mga0n895_1536794_c1 | nmdc:mga0n895_1536794_c1_235_468 | 76 |
| 453 | 3300050512 | nmdc:mga0n895_719316_c1 | nmdc:mga0n895_719316_c1_494_748 | 76 |
| 454 | 3300050514 | nmdc:mga08x19_145275_c1 | nmdc:mga08x19_145275_c1_515_748 | 76 |
| 455 | 3300050514 | nmdc:mga08x19_714136_c1 | nmdc:mga08x19_714136_c1_292_546 | 76 |
| 456 | 3300050516 | nmdc:mga0sz30_17131_c2 | nmdc:mga0sz30_17131_c2_204_437 | 76 |
| 457 | 3300053077 | Ga0495601_0168898 | Ga0495601_0168898_65_346 | 76 |
| 458 | 3300053077 | Ga0495601_0317461 | Ga0495601_0317461_408_638 | 76 |
| 459 | 3300053077 | Ga0495601_0891489 | Ga0495601_0891489_46_279 | 76 |
| 460 | 3300053078 | Ga0495612_0059460 | Ga0495612_0059460_215_448 | 76 |
| 461 | 3300053084 | Ga0495595_0005853 | Ga0495595_0005853_1890_2120 | 76 |
| 462 | 3300053084 | Ga0495595_0386397 | Ga0495595_0386397_355_609 | 76 |
| 463 | 3300053084 | Ga0495595_0511772 | Ga0495595_0511772_89_322 | 76 |
| 464 | 3300053085 | Ga0495619_0212889 | Ga0495619_0212889_850_1080 | 76 |
| 465 | 3300053085 | Ga0495619_0268015 | Ga0495619_0268015_429_686 | 76 |
| 466 | 3300053085 | Ga0495619_0519996 | Ga0495619_0519996_471_704 | 76 |
| 467 | 3300053085 | Ga0495619_0536431 | Ga0495619_0536431_383_616 | 76 |
| 468 | 3300053086 | Ga0500578_0133699 | Ga0500578_0133699_834_1064 | 76 |
| 469 | 3300053086 | Ga0500578_0200861 | Ga0500578_0200861_898_1140 | 76 |
| 470 | 3300053087 | Ga0500643_000117 | Ga0500643_000117_63499_63741 | 76 |
| 471 | 3300053088 | Ga0500644_0074274 | Ga0500644_0074274_80_322 | 76 |
| 472 | 3300053092 | Ga0500583_0243017 | Ga0500583_0243017_465_707 | 76 |
| 473 | 3300053093 | Ga0500651_0395506 | Ga0500651_0395506_325_567 | 76 |
| 474 | 3300053095 | Ga0500640_154992 | Ga0500640_154992_158_388 | 76 |
| 475 | 3300053097 | Ga0500648_400472 | Ga0500648_400472_246_500 | 76 |
| 476 | 3300053103 | Ga0500555_004649 | Ga0500555_004649_3163_3405 | 76 |
| 477 | 3300053104 | Ga0500556_0136352 | Ga0500556_0136352_352_594 | 76 |
| 478 | 3300053108 | Ga0500562_001270 | Ga0500562_001270_1337_1579 | 76 |
| 479 | 3300053114 | Ga0500582_160401 | Ga0500582_160401_483_725 | 76 |
| 480 | 3300053118 | Ga0500594_0046298 | Ga0500594_0046298_218_460 | 76 |
| 481 | 3300053121 | Ga0500607_151715 | Ga0500607_151715_387_641 | 76 |
| 482 | 3300053123 | Ga0500614_029833 | Ga0500614_029833_654_908 | 76 |
| 483 | 3300053126 | Ga0500621_180353 | Ga0500621_180353_463_705 | 76 |
| 484 | 3300053130 | Ga0500642_0039611 | Ga0500642_0039611_1289_1531 | 76 |
| 485 | 3300053131 | Ga0500652_024604 | Ga0500652_024604_489_731 | 76 |
| 486 | 3300053133 | Ga0500655_018929 | Ga0500655_018929_503_745 | 76 |
| 487 | 3300053136 | Ga0500559_0185429 | Ga0500559_0185429_693_947 | 76 |
| 488 | 3300053138 | Ga0500564_193409 | Ga0500564_193409_55_285 | 76 |
| 489 | 3300053139 | Ga0500568_0099849 | Ga0500568_0099849_244_486 | 76 |
| 490 | 3300053142 | Ga0500577_0177854 | Ga0500577_0177854_44_286 | 76 |
| 491 | 3300053142 | Ga0500577_0291481 | Ga0500577_0291481_404_646 | 76 |
| 492 | 3300053142 | Ga0500577_0311559 | Ga0500577_0311559_194_436 | 76 |
| 493 | 3300053146 | Ga0500588_0158658 | Ga0500588_0158658_147_389 | 76 |
| 494 | 3300053151 | Ga0500604_0099021 | Ga0500604_0099021_165_407 | 76 |
| 495 | 3300053153 | Ga0500616_0023597 | Ga0500616_0023597_2575_2817 | 76 |
| 496 | 3300053154 | Ga0500619_201997 | Ga0500619_201997_164_418 | 76 |
| 497 | 3300053156 | Ga0500622_0005729 | Ga0500622_0005729_789_1031 | 76 |
| 498 | 3300053158 | Ga0500627_0083982 | Ga0500627_0083982_369_611 | 76 |
| 499 | 3300053160 | Ga0500633_0036000 | Ga0500633_0036000_234_491 | 76 |
| 500 | 3300053161 | Ga0500634_0269590 | Ga0500634_0269590_265_507 | 76 |
| 501 | 3300053162 | Ga0500638_168308 | Ga0500638_168308_304_558 | 76 |
| 502 | 3300053730 | Ga0500645_024777 | Ga0500645_024777_1167_1409 | 76 |
| 503 | 3300053731 | Ga0500609_020984 | Ga0500609_020984_488_730 | 76 |
| 504 | 3300053736 | Ga0500599_076600 | Ga0500599_076600_254_496 | 76 |
| 505 | iso_pu_bacteria | 2935984226 | 2935985352 | 76 |
| 506 | iso_pu_bacteria | 2936055302 | 2936056884 | 76 |
| 507 | iso_pu_bacteria | 8016603502 | 8016606899 | 76 |
| 508 | iso_pu_bacteria | 8016622563 | 8016622729 | 76 |
| 509 | iso_pu_bacteria | 8019538911 | 8019540888 | 76 |
| 510 | iso_pu_bacteria | 8019547302 | 8019549726 | 76 |
| 511 | 3300002070 | JGI24750J21931_1024865 | JGI24750J21931_10248651 | 77 |
| 512 | 3300003320 | rootH2_10319174 | rootH2_103191742 | 77 |
| 513 | 3300003763 | Ga0055529_1009520 | Ga0055529_10095202 | 77 |
| 514 | 3300005330 | Ga0070690_100112997 | Ga0070690_1001129972 | 77 |
| 515 | 3300005338 | Ga0068868_100128888 | Ga0068868_1001288883 | 77 |
| 516 | 3300005339 | Ga0070660_100877182 | Ga0070660_1008771822 | 77 |
| 517 | 3300005340 | Ga0070689_100091672 | Ga0070689_1000916724 | 77 |
| 518 | 3300005343 | Ga0070687_100115211 | Ga0070687_1001152112 | 77 |
| 519 | 3300005344 | Ga0070661_101550811 | Ga0070661_1015508111 | 77 |
| 520 | 3300005356 | Ga0070674_100022315 | Ga0070674_1000223152 | 77 |
| 521 | 3300005365 | Ga0070688_100526967 | Ga0070688_1005269672 | 77 |
| 522 | 3300005436 | Ga0070713_101166851 | Ga0070713_1011668511 | 77 |
| 523 | 3300005441 | Ga0070700_100091204 | Ga0070700_1000912042 | 77 |
| 524 | 3300005455 | Ga0070663_100020160 | Ga0070663_1000201604 | 77 |
| 525 | 3300005455 | Ga0070663_100438238 | Ga0070663_1004382382 | 77 |
| 526 | 3300005456 | Ga0070678_100125843 | Ga0070678_1001258432 | 77 |
| 527 | 3300005457 | Ga0070662_100351699 | Ga0070662_1003516991 | 77 |
| 528 | 3300005459 | Ga0068867_100018716 | Ga0068867_1000187162 | 77 |
| 529 | 3300005536 | Ga0070697_100158569 | Ga0070697_1001585692 | 77 |
| 530 | 3300005539 | Ga0068853_101757833 | Ga0068853_1017578331 | 77 |
| 531 | 3300005543 | Ga0070672_100065589 | Ga0070672_1000655892 | 77 |
| 532 | 3300005544 | Ga0070686_100154960 | Ga0070686_1001549602 | 77 |
| 533 | 3300005544 | Ga0070686_100721307 | Ga0070686_1007213072 | 77 |
| 534 | 3300005547 | Ga0070693_100095437 | Ga0070693_1000954372 | 77 |
| 535 | 3300005548 | Ga0070665_100276729 | Ga0070665_1002767292 | 77 |
| 536 | 3300005564 | Ga0070664_101222382 | Ga0070664_1012223822 | 77 |
| 537 | 3300005615 | Ga0070702_100076996 | Ga0070702_1000769962 | 77 |
| 538 | 3300005616 | Ga0068852_100582866 | Ga0068852_1005828662 | 77 |
| 539 | 3300005718 | Ga0068866_10163536 | Ga0068866_101635363 | 77 |
| 540 | 3300005719 | Ga0068861_100033637 | Ga0068861_1000336372 | 77 |
| 541 | 3300005834 | Ga0068851_10616160 | Ga0068851_106161602 | 77 |
| 542 | 3300005844 | Ga0068862_100040308 | Ga0068862_1000403084 | 77 |
| 543 | 3300006038 | Ga0075365_10130295 | Ga0075365_101302953 | 77 |
| 544 | 3300006186 | Ga0075369_10177128 | Ga0075369_101771283 | 77 |
| 545 | 3300006237 | Ga0097621_100177153 | Ga0097621_1001771535 | 77 |
| 546 | 3300006881 | Ga0068865_100030701 | Ga0068865_1000307013 | 77 |
| 547 | 3300007265 | Ga0099794_10157232 | Ga0099794_101572322 | 77 |
| 548 | 3300009098 | Ga0105245_10292220 | Ga0105245_102922201 | 77 |
| 549 | 3300009101 | Ga0105247_10467834 | Ga0105247_104678342 | 77 |
| 550 | 3300009174 | Ga0105241_12642981 | Ga0105241_126429812 | 77 |
| 551 | 3300009545 | Ga0105237_11679179 | Ga0105237_116791792 | 77 |
| 552 | 3300009551 | Ga0105238_12095174 | Ga0105238_120951741 | 77 |
| 553 | 3300009551 | Ga0105238_12172458 | Ga0105238_121724582 | 77 |
| 554 | 3300009551 | Ga0105238_12876569 | Ga0105238_128765691 | 77 |
| 555 | 3300010375 | Ga0105239_10505029 | Ga0105239_105050292 | 77 |
| 556 | 3300010375 | Ga0105239_12983064 | Ga0105239_129830642 | 77 |
| 557 | 3300013105 | Ga0157369_10235971 | Ga0157369_102359712 | 77 |
| 558 | 3300013306 | Ga0163162_10316100 | Ga0163162_103161002 | 77 |
| 559 | 3300013307 | Ga0157372_12014894 | Ga0157372_120148942 | 77 |
| 560 | 3300014326 | Ga0157380_10167313 | Ga0157380_101673132 | 77 |
| 561 | 3300017792 | Ga0163161_10023605 | Ga0163161_100236054 | 77 |
| 562 | 3300025254 | Ga0209148_1000743 | Ga0209148_100074312 | 77 |
| 563 | 3300025261 | Ga0209233_1011156 | Ga0209233_10111563 | 77 |
| 564 | 3300025272 | Ga0209455_1006185 | Ga0209455_10061853 | 77 |
| 565 | 3300025297 | Ga0209758_1134290 | Ga0209758_11342901 | 77 |
| 566 | 3300025899 | Ga0207642_10151539 | Ga0207642_101515392 | 77 |
| 567 | 3300025901 | Ga0207688_10065013 | Ga0207688_100650134 | 77 |
| 568 | 3300025909 | Ga0207705_10671469 | Ga0207705_106714692 | 77 |
| 569 | 3300025919 | Ga0207657_10738076 | Ga0207657_107380761 | 77 |
| 570 | 3300025924 | Ga0207694_11652217 | Ga0207694_116522172 | 77 |
| 571 | 3300025927 | Ga0207687_11354651 | Ga0207687_113546511 | 77 |
| 572 | 3300025928 | Ga0207700_10863242 | Ga0207700_108632421 | 77 |
| 573 | 3300025932 | Ga0207690_11230578 | Ga0207690_112305781 | 77 |
| 574 | 3300025934 | Ga0207686_10528968 | Ga0207686_105289682 | 77 |
| 575 | 3300025935 | Ga0207709_10056794 | Ga0207709_100567944 | 77 |
| 576 | 3300025937 | Ga0207669_10013041 | Ga0207669_100130414 | 77 |
| 577 | 3300025938 | Ga0207704_10045939 | Ga0207704_100459392 | 77 |
| 578 | 3300025940 | Ga0207691_10075934 | Ga0207691_100759344 | 77 |
| 579 | 3300025961 | Ga0207712_10022637 | Ga0207712_100226372 | 77 |
| 580 | 3300025972 | Ga0207668_10089108 | Ga0207668_100891082 | 77 |
| 581 | 3300026023 | Ga0207677_11459398 | Ga0207677_114593981 | 77 |
| 582 | 3300026035 | Ga0207703_11594689 | Ga0207703_115946892 | 77 |
| 583 | 3300026041 | Ga0207639_10992261 | Ga0207639_109922612 | 77 |
| 584 | 3300026067 | Ga0207678_10146041 | Ga0207678_101460413 | 77 |
| 585 | 3300026067 | Ga0207678_10407399 | Ga0207678_104073992 | 77 |
| 586 | 3300026075 | Ga0207708_10114806 | Ga0207708_101148063 | 77 |
| 587 | 3300026089 | Ga0207648_10020966 | Ga0207648_100209664 | 77 |
| 588 | 3300026118 | Ga0207675_100050699 | Ga0207675_1000506992 | 77 |
| 589 | 3300026121 | Ga0207683_10034616 | Ga0207683_100346162 | 77 |
| 590 | 3300026142 | Ga0207698_10260785 | Ga0207698_102607852 | 77 |
| 591 | 3300028379 | Ga0268266_10632567 | Ga0268266_106325672 | 77 |
| 592 | 3300031250 | Ga0265331_10325660 | Ga0265331_103256602 | 77 |
| 593 | 3300031456 | Ga0307513_10516423 | Ga0307513_105164232 | 77 |
| 594 | 3300031507 | Ga0307509_10006030 | Ga0307509_1000603015 | 77 |
| 595 | 3300031903 | Ga0307407_10108655 | Ga0307407_101086552 | 77 |
| 596 | 3300031995 | Ga0307409_102924112 | Ga0307409_1029241121 | 77 |
| 597 | 3300032002 | Ga0307416_100314860 | Ga0307416_1003148604 | 77 |
| 598 | 3300032002 | Ga0307416_100477485 | Ga0307416_1004774853 | 77 |
| 599 | 3300032004 | Ga0307414_10457489 | Ga0307414_104574893 | 77 |
| 600 | 3300032126 | Ga0307415_100392443 | Ga0307415_1003924433 | 77 |
| 601 | 3300033179 | Ga0307507_10469415 | Ga0307507_104694152 | 77 |
| 602 | 3300035241 | Ga0373961_0442948 | Ga0373961_0442948_11_268 | 77 |
| 603 | 3300041498 | Ga0451841_0104539 | Ga0451841_0104539_692_928 | 77 |
| 604 | 3300041512 | Ga0451853_3099811 | Ga0451853_3099811_649_885 | 77 |
| 605 | 3300041997 | Ga0439431_0191419 | Ga0439431_0191419_215_448 | 77 |
| 606 | 3300044658 | Ga0466972_0000871 | Ga0466972_0000871_13466_13711 | 77 |
| 607 | 3300046476 | Ga0495662_0465451 | Ga0495662_0465451_169_426 | 77 |
| 608 | 3300046507 | Ga0495606_0126835 | Ga0495606_0126835_1130_1366 | 77 |
| 609 | 3300046616 | Ga0495668_0326689 | Ga0495668_0326689_277_513 | 77 |
| 610 | 3300047472 | Ga0495686_0086401 | Ga0495686_0086401_710_946 | 77 |
| 611 | 3300048908 | Ga0496105_0771693 | Ga0496105_0771693_67_312 | 77 |
| 612 | 3300048911 | Ga0496108_0915877 | Ga0496108_0915877_408_644 | 77 |
| 613 | 3300048912 | Ga0496109_1797873 | Ga0496109_1797873_82_318 | 77 |
| 614 | 3300048924 | Ga0496121_0575595 | Ga0496121_0575595_408_641 | 77 |
| 615 | 3300048929 | Ga0496126_0295321 | Ga0496126_0295321_11_247 | 77 |
| 616 | 3300048929 | Ga0496126_0409603 | Ga0496126_0409603_821_1054 | 77 |
| 617 | 3300049581 | Ga0501047_0412965 | Ga0501047_0412965_264_584 | 77 |
| 618 | 3300050492 | nmdc:mga0yw44_76505_c1 | nmdc:mga0yw44_76505_c1_772_1008 | 77 |
| 619 | 3300053086 | Ga0500578_0037573 | Ga0500578_0037573_195_443 | 77 |
| 620 | 3300053087 | Ga0500643_079356 | Ga0500643_079356_307_540 | 77 |
| 621 | 3300053119 | Ga0500595_067706 | Ga0500595_067706_448_684 | 77 |
| 622 | 3300053155 | Ga0500620_000713 | Ga0500620_000713_1641_1889 | 77 |
| 623 | 3300053178 | Ga0500637_0208947 | Ga0500637_0208947_551_805 | 77 |
| 624 | 3300055283 | Ga0500661_012269 | Ga0500661_012269_115_348 | 77 |
| 625 | iso_pu_bacteria | 2524023210 | 2524468108 | 77 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar