F470406

General Info

Members Datasets Scaffolds Average Seq Length
625 405 583 78

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0412965|Ga0501047_0412965_264_584
Length 106
Sequence MRSNNDILFKMYILEKSMRVAKWGNSLAVRLPKKLVEELGLKENDEIRLVPSPDRREVQIAQSGDARQARREAALKRLAELRWQLPADYEFDREEANARRGFSEPE

Samples

Sample ID Description Type Environment
1 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
2 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
3 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
4 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
5 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
6 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
7 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
8 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
9 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
10 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
11 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
12 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
13 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
14 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
15 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
16 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
17 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
18 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
19 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
20 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
21 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
22 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
23 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
24 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
25 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
26 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
129 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
130 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
131 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
132 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
133 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
135 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
137 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
188 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
189 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
194 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
197 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
198 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
201 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
204 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
211 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
212 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
213 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
214 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
217 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
218 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
219 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
220 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
230 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
233 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
236 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
237 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
238 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
239 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
240 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
241 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
242 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
243 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
244 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
245 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
246 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
251 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
252 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
253 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
254 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
255 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
256 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
257 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
258 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
259 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
260 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
261 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
262 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
263 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
264 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
265 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
266 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
267 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
268 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
269 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
270 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
271 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
272 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
273 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
274 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
275 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
276 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
277 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
278 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
279 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
280 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
281 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
282 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
283 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
284 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
285 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
286 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
290 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
291 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
292 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
293 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
294 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
295 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
296 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
297 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
298 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
299 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
300 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
301 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
318 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
319 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
320 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
321 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
330 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
331 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
332 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
333 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
334 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
335 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
336 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
337 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
340 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
341 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
342 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
343 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
344 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
345 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
346 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
347 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
348 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
349 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
350 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
351 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
352 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
353 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
354 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
355 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
356 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
357 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
358 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
359 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
360 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
361 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
362 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
363 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
364 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
365 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
366 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
367 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
368 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
369 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
370 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
371 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
372 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
373 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
374 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
375 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
376 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
377 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
378 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
379 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
380 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
381 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
382 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
383 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
384 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
385 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
386 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
387 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
388 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
389 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
390 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
391 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
392 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
393 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
394 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
395 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
396 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
397 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
398 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
399 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
400 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
401 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
402 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
403 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
404 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
405 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.28
Metatranscriptomes 0
Isolates 6.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.96
Nodule 6.56
Rhizoplane 5.6
Rhizosphere 73.92
Stem 0
Stem Tuber 0
Unclassified 4.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1024865 3300002070 Bacteria 856
2 rootH2_10319174 3300003320 Bacteria 1216
3 Ga0055529_1009520 3300003763 Bacteria 1273
4 Ga0065165_1001154 3300005262 Bacteria 30829
5 Ga0065707_10540224 3300005295 Unclassified 728
6 Ga0070683_101060502 3300005329 Unclassified 778
7 Ga0070690_100112997 3300005330 Bacteria 1815
8 Ga0070690_100434527 3300005330 Bacteria 970
9 Ga0070670_100264320 3300005331 Bacteria 1500
10 Ga0070680_100034242 3300005336 Bacteria 4095
11 Ga0068868_100128888 3300005338 Bacteria 2069
12 Ga0070660_100877182 3300005339 Bacteria 756
13 Ga0070660_101137909 3300005339 Unclassified 661
14 Ga0070689_100071198 3300005340 Bacteria 2716
15 Ga0070689_100091672 3300005340 Bacteria 2396
16 Ga0070689_101031825 3300005340 Bacteria 733
17 Ga0070687_100115211 3300005343 Bacteria 1528
18 Ga0070661_100805769 3300005344 Unclassified 771
19 Ga0070661_101550811 3300005344 Bacteria 559
20 Ga0070668_100007904 3300005347 Bacteria 7896
21 Ga0070668_100228198 3300005347 Bacteria 1538
22 Ga0070669_100079827 3300005353 Bacteria 2434
23 Ga0070669_100793561 3300005353 Unclassified 804
24 Ga0070669_101354938 3300005353 Bacteria 617
25 Ga0070675_100219909 3300005354 Bacteria 1654
26 Ga0070675_101498687 3300005354 Bacteria 622
27 Ga0070671_100019566 3300005355 Bacteria 5512
28 Ga0070671_100157221 3300005355 Bacteria 1921
29 Ga0070671_100699259 3300005355 Unclassified 879
30 Ga0070674_100022315 3300005356 Bacteria 4081
31 Ga0070673_100012554 3300005364 Bacteria 5820
32 Ga0070688_100526967 3300005365 Bacteria 895
33 Ga0070659_100198704 3300005366 Bacteria 1650
34 Ga0070667_100024229 3300005367 Bacteria 5041
35 Ga0070709_10042880 3300005434 Bacteria 2796
36 Ga0070714_100018965 3300005435 Bacteria 5596
37 Ga0070714_100574540 3300005435 Bacteria 1081
38 Ga0070713_100521626 3300005436 Bacteria 1123
39 Ga0070713_101166851 3300005436 Bacteria 745
40 Ga0070713_101207546 3300005436 Unclassified 732
41 Ga0070710_10391777 3300005437 Bacteria 929
42 Ga0070705_101292475 3300005440 Unclassified 604
43 Ga0070700_100091204 3300005441 Bacteria 1989
44 Ga0070663_100020160 3300005455 Bacteria 4411
45 Ga0070663_100438238 3300005455 Bacteria 1075
46 Ga0070663_100931794 3300005455 Bacteria 752
47 Ga0070663_101208803 3300005455 Unclassified 664
48 Ga0070663_101247664 3300005455 Bacteria 654
49 Ga0070678_100125843 3300005456 Bacteria 2028
50 Ga0070678_100654298 3300005456 Bacteria 943
51 Ga0070662_100061582 3300005457 Bacteria 2740
52 Ga0070662_100351699 3300005457 Bacteria 1207
53 Ga0070681_10031663 3300005458 Bacteria 5310
54 Ga0068867_100018716 3300005459 Bacteria 4924
55 Ga0068867_100900431 3300005459 Bacteria 796
56 Ga0070679_100018245 3300005530 Bacteria 6805
57 Ga0070684_100703808 3300005535 Bacteria 942
58 Ga0070697_100158569 3300005536 Bacteria 1911
59 Ga0068853_101757833 3300005539 Unclassified 601
60 Ga0070672_100065589 3300005543 Bacteria 2873
61 Ga0070686_100154960 3300005544 Bacteria 1608
62 Ga0070686_100721307 3300005544 Unclassified 797
63 Ga0070686_101081700 3300005544 Unclassified 661
64 Ga0070693_100095437 3300005547 Bacteria 1801
65 Ga0070693_100178400 3300005547 Bacteria 1366
66 Ga0070693_100519685 3300005547 Bacteria 847
67 Ga0070665_100126888 3300005548 Bacteria 2554
68 Ga0070665_100276729 3300005548 Bacteria 1680
69 Ga0070665_101821754 3300005548 Bacteria 615
70 Ga0068855_100202260 3300005563 Bacteria 2235
71 Ga0070664_101062918 3300005564 Bacteria 762
72 Ga0070664_101222382 3300005564 Bacteria 709
73 Ga0068857_100761112 3300005577 Bacteria 923
74 Ga0068854_100764450 3300005578 Bacteria 839
75 Ga0068854_101249425 3300005578 Bacteria 667
76 Ga0068856_101121751 3300005614 Unclassified 804
77 Ga0068856_101291964 3300005614 Bacteria 745
78 Ga0068856_101497677 3300005614 Unclassified 689
79 Ga0070702_100076996 3300005615 Bacteria 1987
80 Ga0070702_101269170 3300005615 Unclassified 597
81 Ga0068852_100582866 3300005616 Bacteria 1121
82 Ga0068852_101666922 3300005616 Bacteria 660
83 Ga0068859_100029735 3300005617 Bacteria 5481
84 Ga0068859_100687559 3300005617 Bacteria 1114
85 Ga0068864_100083027 3300005618 Bacteria 2813
86 Ga0068864_100377388 3300005618 Bacteria 1343
87 Ga0068864_101616663 3300005618 Unclassified 652
88 Ga0068866_10163536 3300005718 Bacteria 1300
89 Ga0068861_100022727 3300005719 Bacteria 4522
90 Ga0068861_100033637 3300005719 Bacteria 3784
91 Ga0068861_100976646 3300005719 Bacteria 807
92 Ga0068851_10616160 3300005834 Bacteria 662
93 Ga0068858_101283057 3300005842 Bacteria 721
94 Ga0068860_100000268 3300005843 Bacteria 76328
95 Ga0068860_100016951 3300005843 Bacteria 7101
96 Ga0068860_101790294 3300005843 Bacteria 636
97 Ga0068860_102461346 3300005843 Bacteria 540
98 Ga0068862_100040308 3300005844 Bacteria 3970
99 Ga0068862_100057617 3300005844 Bacteria 3333
100 Ga0068862_101091892 3300005844 Unclassified 793
101 Ga0070717_10247006 3300006028 Bacteria 1575
102 Ga0070717_11088945 3300006028 Unclassified 728
103 Ga0075365_10130295 3300006038 Bacteria 1740
104 Ga0070715_10092266 3300006163 Bacteria 1396
105 Ga0070716_101666091 3300006173 Unclassified 525
106 Ga0070712_100931594 3300006175 Unclassified 750
107 Ga0075369_10016504 3300006186 Bacteria 2981
108 Ga0075369_10177128 3300006186 Bacteria 980
109 Ga0097621_100177153 3300006237 Bacteria 1841
110 Ga0097621_101663767 3300006237 Bacteria 607
111 Ga0068871_100047607 3300006358 Bacteria 3459
112 Ga0075428_100195559 3300006844 Unclassified 2187
113 Ga0075434_101256052 3300006871 Unclassified 752
114 Ga0075434_101951931 3300006871 Unclassified 593
115 Ga0075434_102127478 3300006871 Unclassified 566
116 Ga0068865_100030701 3300006881 Bacteria 3577
117 Ga0075436_100152759 3300006914 Bacteria 1625
118 Ga0075436_100391785 3300006914 Bacteria 1006
119 Ga0075436_101506194 3300006914 Unclassified 511
120 Ga0097620_100029735 3300006931 Bacteria 5481
121 Ga0097620_100687631 3300006931 Bacteria 1114
122 Ga0097620_101289292 3300006931 Unclassified 805
123 Ga0099823_1022011 3300006944 Bacteria 5921
124 Ga0075435_101662010 3300007076 Unclassified 560
125 Ga0099794_10157232 3300007265 Bacteria 1155
126 Ga0105244_10486580 3300009036 Bacteria 568
127 Ga0105240_10083631 3300009093 Bacteria 3916
128 Ga0105240_10989914 3300009093 Unclassified 900
129 Ga0105240_12637619 3300009093 Bacteria 519
130 Ga0111539_10079945 3300009094 Unclassified 3846
131 Ga0111539_10372851 3300009094 Bacteria 1661
132 Ga0111539_10388958 3300009094 Bacteria 1624
133 Ga0105245_10142087 3300009098 Bacteria 2262
134 Ga0105245_10292220 3300009098 Bacteria 1596
135 Ga0105245_11186593 3300009098 Bacteria 811
136 Ga0105247_10467834 3300009101 Bacteria 912
137 Ga0105247_10620167 3300009101 Bacteria 804
138 Ga0114129_10101757 3300009147 Unclassified 3975
139 Ga0105243_10161008 3300009148 Bacteria 1935
140 Ga0105243_10330818 3300009148 Bacteria 1391
141 Ga0105243_10652983 3300009148 Bacteria 1020
142 Ga0105241_10365962 3300009174 Bacteria 1256
143 Ga0105241_10408075 3300009174 Bacteria 1193
144 Ga0105241_12642981 3300009174 Unclassified 505
145 Ga0105242_11299373 3300009176 Bacteria 751
146 Ga0105248_10343146 3300009177 Bacteria 1681
147 Ga0105237_10230692 3300009545 Bacteria 1852
148 Ga0105237_10737447 3300009545 Bacteria 991
149 Ga0105237_11679179 3300009545 Unclassified 642
150 Ga0105237_12392469 3300009545 Bacteria 538
151 Ga0105238_10479338 3300009551 Bacteria 1243
152 Ga0105238_12095174 3300009551 Bacteria 600
153 Ga0105238_12172458 3300009551 Unclassified 590
154 Ga0105238_12876569 3300009551 Unclassified 518
155 Ga0105249_10210530 3300009553 Bacteria 1908
156 Ga0105239_10029546 3300010375 Bacteria 6026
157 Ga0105239_10164651 3300010375 Bacteria 2479
158 Ga0105239_10421145 3300010375 Bacteria 1513
159 Ga0105239_10505029 3300010375 Bacteria 1375
160 Ga0105239_12983064 3300010375 Bacteria 552
161 Ga0105246_10067042 3300011119 Bacteria 2514
162 Ga0105246_10978190 3300011119 Bacteria 764
163 Ga0105246_11903295 3300011119 Bacteria 571
164 Ga0105246_11904209 3300011119 Unclassified 571
165 Ga0157369_10235971 3300013105 Bacteria 1911
166 Ga0157374_10517778 3300013296 Unclassified 1198
167 Ga0157374_10932818 3300013296 Bacteria 886
168 Ga0157378_10395102 3300013297 Bacteria 1361
169 Ga0157378_10931766 3300013297 Bacteria 901
170 Ga0157378_11122201 3300013297 Unclassified 824
171 Ga0157378_11339907 3300013297 Bacteria 758
172 Ga0163162_10316100 3300013306 Bacteria 1694
173 Ga0163162_10601418 3300013306 Bacteria 1226
174 Ga0163162_11026732 3300013306 Bacteria 933
175 Ga0157372_12014894 3300013307 Bacteria 663
176 Ga0157375_13613425 3300013308 Unclassified 514
177 Ga0163163_10573307 3300014325 Bacteria 1191
178 Ga0157380_10007924 3300014326 Bacteria 7561
179 Ga0157380_10167313 3300014326 Bacteria 1917
180 Ga0157380_10252991 3300014326 Unclassified 1595
181 Ga0157377_10279372 3300014745 Bacteria 1094
182 Ga0157377_10692885 3300014745 Unclassified 739
183 Ga0157376_10050292 3300014969 Bacteria 3457
184 Ga0157376_10875651 3300014969 Bacteria 915
185 Ga0157376_12954952 3300014969 Unclassified 515
186 Ga0163161_10023605 3300017792 Bacteria 4340
187 Ga0213874_10050250 3300021377 Bacteria 1277
188 Ga0213876_10009102 3300021384 Bacteria 5346
189 Ga0213876_10499196 3300021384 Unclassified 647
190 Ga0213875_10090708 3300021388 Bacteria 1426
191 Ga0213871_10164551 3300021441 Bacteria 680
192 Ga0224569_101604 3300022732 Bacteria 1884
193 Ga0224571_102028 3300022734 Bacteria 1283
194 Ga0224572_1107773 3300024225 Bacteria 515
195 Ga0228598_1009083 3300024227 Bacteria 1997
196 Ga0209148_1000743 3300025254 Bacteria 25189
197 Ga0209233_1011156 3300025261 Bacteria 2656
198 Ga0209455_1006185 3300025272 Bacteria 3574
199 Ga0209758_1134290 3300025297 Bacteria 650
200 Ga0207426_1086606 3300025302 Bacteria 838
201 Ga0207692_10624012 3300025898 Unclassified 695
202 Ga0207642_10151539 3300025899 Bacteria 1235
203 Ga0207688_10065013 3300025901 Bacteria 2061
204 Ga0207688_10118753 3300025901 Bacteria 1541
205 Ga0207699_10063045 3300025906 Bacteria 2237
206 Ga0207643_10319237 3300025908 Bacteria 970
207 Ga0207705_10671469 3300025909 Bacteria 806
208 Ga0207654_10475195 3300025911 Bacteria 880
209 Ga0207707_10030602 3300025912 Bacteria 4709
210 Ga0207695_10124972 3300025913 Bacteria 2536
211 Ga0207671_10992947 3300025914 Bacteria 662
212 Ga0207671_11044254 3300025914 Bacteria 643
213 Ga0207693_10351953 3300025915 Bacteria 1153
214 Ga0207693_10645401 3300025915 Unclassified 822
215 Ga0207663_10110496 3300025916 Bacteria 1864
216 Ga0207663_11261955 3300025916 Bacteria 595
217 Ga0207660_10032900 3300025917 Bacteria 3582
218 Ga0207657_10738076 3300025919 Bacteria 763
219 Ga0207652_10062805 3300025921 Bacteria 3210
220 Ga0207681_10146919 3300025923 Bacteria 1763
221 Ga0207681_10579884 3300025923 Bacteria 925
222 Ga0207694_10690124 3300025924 Bacteria 861
223 Ga0207694_11652217 3300025924 Bacteria 539
224 Ga0207650_10119740 3300025925 Bacteria 2048
225 Ga0207650_10152749 3300025925 Bacteria 1823
226 Ga0207687_10030630 3300025927 Bacteria 3628
227 Ga0207687_11354651 3300025927 Bacteria 612
228 Ga0207700_10346389 3300025928 Bacteria 1293
229 Ga0207700_10863242 3300025928 Bacteria 810
230 Ga0207700_11213512 3300025928 Unclassified 673
231 Ga0207644_10006764 3300025931 Bacteria 7473
232 Ga0207644_10111530 3300025931 Bacteria 2069
233 Ga0207690_11230578 3300025932 Bacteria 625
234 Ga0207706_10285462 3300025933 Bacteria 1439
235 Ga0207706_10633921 3300025933 Bacteria 916
236 Ga0207686_10528968 3300025934 Bacteria 919
237 Ga0207686_11478431 3300025934 Bacteria 560
238 Ga0207709_10056794 3300025935 Bacteria 2424
239 Ga0207709_10179535 3300025935 Bacteria 1494
240 Ga0207709_10757538 3300025935 Bacteria 781
241 Ga0207670_10027789 3300025936 Bacteria 3582
242 Ga0207669_10013041 3300025937 Bacteria 4112
243 Ga0207704_10045939 3300025938 Bacteria 2598
244 Ga0207704_11302956 3300025938 Unclassified 621
245 Ga0207691_10075934 3300025940 Bacteria 3029
246 Ga0207691_10135438 3300025940 Bacteria 2173
247 Ga0207711_10621994 3300025941 Bacteria 1008
248 Ga0207711_10968208 3300025941 Bacteria 790
249 Ga0207679_10084497 3300025945 Bacteria 2436
250 Ga0207667_10120516 3300025949 Bacteria 2703
251 Ga0207651_10005889 3300025960 Bacteria 6342
252 Ga0207712_10022637 3300025961 Bacteria 4140
253 Ga0207668_10018118 3300025972 Bacteria 4424
254 Ga0207668_10089108 3300025972 Bacteria 2261
255 Ga0207668_10147330 3300025972 Bacteria 1818
256 Ga0207668_10489869 3300025972 Bacteria 1056
257 Ga0207640_10825610 3300025981 Bacteria 805
258 Ga0207640_12110885 3300025981 Bacteria 511
259 Ga0207658_10345394 3300025986 Bacteria 1294
260 Ga0207677_11459398 3300026023 Bacteria 631
261 Ga0207703_10983140 3300026035 Bacteria 809
262 Ga0207703_11111933 3300026035 Unclassified 759
263 Ga0207703_11594689 3300026035 Bacteria 628
264 Ga0207639_10992261 3300026041 Bacteria 786
265 Ga0207678_10146041 3300026067 Bacteria 2019
266 Ga0207678_10407399 3300026067 Bacteria 1178
267 Ga0207678_10976460 3300026067 Bacteria 749
268 Ga0207678_11371221 3300026067 Bacteria 625
269 Ga0207678_11581433 3300026067 Bacteria 578
270 Ga0207708_10114806 3300026075 Bacteria 2093
271 Ga0207702_11143497 3300026078 Bacteria 772
272 Ga0207702_11749581 3300026078 Unclassified 614
273 Ga0207648_10020966 3300026089 Bacteria 5883
274 Ga0207648_12124193 3300026089 Bacteria 522
275 Ga0207676_10147427 3300026095 Bacteria 2022
276 Ga0207676_11047340 3300026095 Bacteria 805
277 Ga0207676_11606843 3300026095 Unclassified 648
278 Ga0207674_11772765 3300026116 Unclassified 585
279 Ga0207675_100017209 3300026118 Bacteria 6751
280 Ga0207675_100050699 3300026118 Bacteria 3873
281 Ga0207675_100256068 3300026118 Bacteria 1695
282 Ga0207675_100926428 3300026118 Bacteria 888
283 Ga0207683_10034616 3300026121 Bacteria 4390
284 Ga0207683_10125646 3300026121 Bacteria 2305
285 Ga0207698_10260785 3300026142 Bacteria 1592
286 Ga0209389_1000163 3300027296 Bacteria 55041
287 Ga0209489_101100 3300027361 Bacteria 55041
288 Ga0209700_100014 3300027363 Bacteria 299349
289 Ga0268266_10085221 3300028379 Bacteria 2760
290 Ga0268266_10632567 3300028379 Bacteria 1029
291 Ga0268266_11615499 3300028379 Bacteria 624
292 Ga0268265_10310652 3300028380 Bacteria 1423
293 Ga0268264_10000084 3300028381 Bacteria 242128
294 Ga0268264_10043258 3300028381 Bacteria 3731
295 Ga0268264_11649250 3300028381 Bacteria 652
296 Ga0265337_1001532 3300028556 Bacteria 11344
297 Ga0265334_10003016 3300028573 Bacteria 7691
298 Ga0265338_10005127 3300028800 Bacteria 17258
299 Ga0265325_10094196 3300031241 Bacteria 1473
300 Ga0265339_10113712 3300031249 Bacteria 1398
301 Ga0265331_10325660 3300031250 Bacteria 688
302 Ga0265316_10266742 3300031344 Bacteria 1254
303 Ga0265316_10993832 3300031344 Unclassified 584
304 Ga0307513_10516423 3300031456 Bacteria 910
305 Ga0307509_10006030 3300031507 Bacteria 16526
306 Ga0307408_101542547 3300031548 Bacteria 629
307 Ga0265313_10026043 3300031595 Bacteria 3089
308 Ga0265313_10161140 3300031595 Unclassified 953
309 Ga0307407_10108655 3300031903 Bacteria 1737
310 Ga0307409_101410659 3300031995 Bacteria 723
311 Ga0307409_102264235 3300031995 Bacteria 573
312 Ga0307409_102924112 3300031995 Bacteria 504
313 Ga0307416_100314860 3300032002 Bacteria 1564
314 Ga0307416_100477485 3300032002 Bacteria 1306
315 Ga0307414_10457489 3300032004 Bacteria 1121
316 Ga0307411_10848627 3300032005 Bacteria 808
317 Ga0307415_100392443 3300032126 Bacteria 1182
318 Ga0307415_100397924 3300032126 Bacteria 1175
319 Ga0307507_10469415 3300033179 Bacteria 688
320 Ga0307510_10112763 3300033180 Bacteria 2455
321 Ga0307510_10460404 3300033180 Bacteria 713
322 Ga0373926_0442699 3300035083 Unclassified 515
323 Ga0373934_0308384 3300035086 Unclassified 657
324 Ga0373944_0083672 3300035089 Bacteria 1058
325 Ga0373923_0556123 3300035111 Unclassified 563
326 Ga0373945_0474794 3300035116 Unclassified 555
327 Ga0373953_0394982 3300035117 Bacteria 608
328 Ga0373954_0427590 3300035118 Unclassified 655
329 Ga0373943_0523167 3300035170 Unclassified 694
330 Ga0373946_0286958 3300035171 Bacteria 811
331 Ga0373946_0597814 3300035171 Bacteria 572
332 Ga0373946_0605013 3300035171 Unclassified 568
333 Ga0373955_0360446 3300035172 Bacteria 881
334 Ga0373955_0436474 3300035172 Unclassified 797
335 Ga0373961_0442948 3300035241 Unclassified 505
336 Ga0373935_0146888 3300035692 Bacteria 1597
337 Ga0373935_0580915 3300035692 Bacteria 818
338 Ga0373927_0040261 3300035695 Bacteria 3032
339 Ga0373927_0145017 3300035695 Bacteria 1554
340 Ga0373927_0183799 3300035695 Unclassified 1371
341 Ga0373933_0503343 3300035724 Bacteria 794
342 Ga0373933_0626213 3300035724 Bacteria 707
343 Ga0373947_0017017 3300035725 Bacteria 4179
344 Ga0373947_0123023 3300035725 Unclassified 1650
345 Ga0373937_0798541 3300036401 Unclassified 892
346 Ga0373925_0041445 3300037068 Bacteria 3413
347 Ga0373925_0227139 3300037068 Bacteria 1491
348 Ga0373925_0277974 3300037068 Bacteria 1348
349 Ga0373925_0608972 3300037068 Bacteria 900
350 Ga0395899_0783190 3300037312 Bacteria 591
351 Ga0436364_1421633 3300037853 Bacteria 1391
352 Ga0436365_1309872 3300039437 Bacteria 831
353 Ga0436365_1716550 3300039437 Bacteria 874
354 Ga0436360_1046720 3300039438 Bacteria 3200
355 Ga0436361_0674457 3300039447 Bacteria 796
356 Ga0436363_0172666 3300039450 Bacteria 1372
357 Ga0436363_1648471 3300039450 Unclassified 524
358 Ga0436362_0642024 3300039453 Bacteria 2587
359 Ga0451841_0104539 3300041498 Bacteria 962
360 Ga0451841_1458524 3300041498 Bacteria 661
361 Ga0451853_2443084 3300041512 Bacteria 767
362 Ga0451853_3099811 3300041512 Bacteria 939
363 Ga0439431_0191419 3300041997 Bacteria 594
364 Ga0466972_0000871 3300044658 Bacteria 14493
365 Ga0466966_0018882 3300044684 Bacteria 4543
366 Ga0466966_0262046 3300044684 Bacteria 1041
367 Ga0466961_0176177 3300044693 Bacteria 1329
368 Ga0466961_0419577 3300044693 Unclassified 811
369 Ga0466960_0722486 3300044901 Bacteria 599
370 Ga0466959_0035456 3300045049 Bacteria 3689
371 Ga0466958_0276593 3300045836 Bacteria 1076
372 Ga0466967_0139284 3300045976 Bacteria 2259
373 Ga0495617_103380 3300046452 Bacteria 925
374 Ga0495617_219080 3300046452 Bacteria 592
375 Ga0495592_0582116 3300046454 Unclassified 685
376 Ga0495603_0177359 3300046455 Unclassified 1233
377 Ga0495603_0650037 3300046455 Unclassified 603
378 Ga0495629_0529375 3300046459 Bacteria 793
379 Ga0495638_0004594 3300046460 Bacteria 10449
380 Ga0495641_0581983 3300046461 Unclassified 512
381 Ga0495651_0244190 3300046462 Bacteria 1230
382 Ga0495653_0114524 3300046463 Bacteria 1932
383 Ga0495653_0261187 3300046463 Bacteria 1145
384 Ga0495653_0311048 3300046463 Bacteria 1024
385 Ga0495580_0114661 3300046472 Bacteria 1872
386 Ga0495582_0667227 3300046473 Unclassified 602
387 Ga0495662_0354087 3300046476 Bacteria 722
388 Ga0495662_0465451 3300046476 Bacteria 620
389 Ga0495662_0595936 3300046476 Unclassified 540
390 Ga0495662_0657183 3300046476 Bacteria 512
391 Ga0495664_0834738 3300046477 Bacteria 541
392 Ga0495594_0103147 3300046499 Unclassified 1605
393 Ga0495583_0249995 3300046506 Bacteria 711
394 Ga0495606_0116727 3300046507 Bacteria 1602
395 Ga0495606_0126835 3300046507 Bacteria 1521
396 Ga0495610_0133258 3300046512 Bacteria 1077
397 Ga0495618_0611436 3300046514 Bacteria 648
398 Ga0495630_1226776 3300046517 Unclassified 566
399 Ga0495631_0111893 3300046518 Bacteria 1174
400 Ga0495632_0308259 3300046519 Bacteria 701
401 Ga0495643_0145894 3300046522 Bacteria 1176
402 Ga0495648_0009414 3300046524 Bacteria 7578
403 Ga0495648_0126300 3300046524 Bacteria 1366
404 Ga0495666_0090511 3300046526 Bacteria 1444
405 Ga0495666_0431102 3300046526 Unclassified 591
406 Ga0495652_0502599 3300046529 Unclassified 840
407 Ga0495665_0042920 3300046531 Bacteria 2406
408 Ga0495665_0205698 3300046531 Bacteria 1020
409 Ga0495640_0585669 3300046533 Unclassified 674
410 Ga0495586_0551278 3300046535 Unclassified 666
411 Ga0495587_0413401 3300046536 Bacteria 749
412 Ga0495587_0577381 3300046536 Unclassified 620
413 Ga0495622_0122451 3300046557 Bacteria 1187
414 Ga0495667_0525845 3300046559 Bacteria 740
415 Ga0495668_0189078 3300046616 Bacteria 1128
416 Ga0495668_0326689 3300046616 Bacteria 841
417 Ga0495634_0100221 3300046642 Unclassified 1872
418 Ga0495634_0124360 3300046642 Bacteria 1649
419 Ga0495634_0523034 3300046642 Bacteria 694
420 Ga0495611_0174619 3300046648 Bacteria 1004
421 Ga0495611_0349216 3300046648 Bacteria 679
422 Ga0495625_0892379 3300046660 Bacteria 510
423 Ga0495635_0108320 3300046663 Bacteria 1898
424 Ga0495659_0094080 3300046664 Unclassified 1154
425 Ga0495661_0277942 3300046665 Bacteria 845
426 Ga0495661_0603370 3300046665 Bacteria 516
427 Ga0495588_0115934 3300046674 Bacteria 1412
428 Ga0495588_0725395 3300046674 Unclassified 520
429 Ga0495599_0447820 3300046678 Unclassified 765
430 Ga0495646_0383302 3300046680 Unclassified 733
431 Ga0495647_0131906 3300046681 Bacteria 1059
432 Ga0495647_0154729 3300046681 Bacteria 985
433 Ga0495647_0404336 3300046681 Unclassified 627
434 Ga0495613_0704324 3300046689 Unclassified 664
435 Ga0495624_0741969 3300046690 Bacteria 582
436 Ga0495649_0019237 3300046694 Bacteria 3837
437 Ga0495649_0257446 3300046694 Bacteria 895
438 Ga0495581_0115808 3300047315 Bacteria 1558
439 Ga0495581_0404079 3300047315 Bacteria 797
440 Ga0495581_0418648 3300047315 Unclassified 781
441 Ga0495604_0352623 3300047317 Unclassified 977
442 Ga0495674_0062120 3300047319 Bacteria 3253
443 Ga0495674_0739714 3300047319 Bacteria 769
444 Ga0495672_0177727 3300047320 Bacteria 1080
445 Ga0495672_0245552 3300047320 Bacteria 872
446 Ga0495676_0120638 3300047321 Bacteria 1908
447 Ga0495680_0232889 3300047322 Bacteria 1311
448 Ga0495683_0058140 3300047323 Bacteria 1921
449 Ga0495684_0396084 3300047471 Unclassified 970
450 Ga0495684_0616903 3300047471 Bacteria 730
451 Ga0495686_0086401 3300047472 Bacteria 1909
452 Ga0495686_0596580 3300047472 Bacteria 572
453 Ga0495593_0459330 3300047673 Unclassified 637
454 Ga0495602_0116927 3300048088 Bacteria 2154
455 Ga0495614_0265744 3300048089 Unclassified 787
456 Ga0496100_0006947 3300048903 Bacteria 6204
457 Ga0496101_0002879 3300048904 Bacteria 10584
458 Ga0496102_0013972 3300048905 Bacteria 6970
459 Ga0496102_0470955 3300048905 Bacteria 1177
460 Ga0496102_0530466 3300048905 Bacteria 1100
461 Ga0496102_0896040 3300048905 Bacteria 809
462 Ga0496102_1202409 3300048905 Bacteria 677
463 Ga0496103_0086498 3300048906 Bacteria 1976
464 Ga0496103_0104277 3300048906 Bacteria 1797
465 Ga0496104_0011750 3300048907 Bacteria 7855
466 Ga0496105_0771693 3300048908 Bacteria 733
467 Ga0496106_0000376 3300048909 Bacteria 31754
468 Ga0496107_0004183 3300048910 Bacteria 9748
469 Ga0496107_0322613 3300048910 Bacteria 1149
470 Ga0496108_0076434 3300048911 Bacteria 2830
471 Ga0496108_0333237 3300048911 Unclassified 1323
472 Ga0496108_0689498 3300048911 Bacteria 886
473 Ga0496108_0915877 3300048911 Bacteria 752
474 Ga0496108_0965761 3300048911 Unclassified 729
475 Ga0496109_0048703 3300048912 Bacteria 3855
476 Ga0496109_0461222 3300048912 Bacteria 1200
477 Ga0496109_1797873 3300048912 Bacteria 546
478 Ga0496110_0037229 3300048913 Bacteria 4228
479 Ga0496110_0046555 3300048913 Bacteria 3795
480 Ga0496110_0099450 3300048913 Bacteria 2607
481 Ga0496110_0323344 3300048913 Bacteria 1405
482 Ga0496111_0121568 3300048914 Bacteria 1928
483 Ga0496111_0185919 3300048914 Bacteria 1545
484 Ga0496112_0014918 3300048915 Bacteria 7230
485 Ga0496112_0085760 3300048915 Bacteria 3115
486 Ga0496112_0189748 3300048915 Bacteria 2017
487 Ga0496113_0387147 3300048916 Unclassified 1122
488 Ga0496113_1020911 3300048916 Unclassified 651
489 Ga0496115_0047962 3300048918 Bacteria 3417
490 Ga0496115_0334456 3300048918 Bacteria 1237
491 Ga0496118_0047326 3300048921 Bacteria 3334
492 Ga0496121_0575595 3300048924 Bacteria 700
493 Ga0496121_0597350 3300048924 Bacteria 682
494 Ga0496121_0641551 3300048924 Unclassified 648
495 Ga0496125_0402554 3300048928 Bacteria 799
496 Ga0496126_0279862 3300048929 Bacteria 1382
497 Ga0496126_0295321 3300048929 Bacteria 1339
498 Ga0496126_0409603 3300048929 Bacteria 1098
499 Ga0501032_0197142 3300049569 Unclassified 1315
500 Ga0501033_0357765 3300049570 Unclassified 1022
501 Ga0501034_0015559 3300049571 Bacteria 7813
502 Ga0501036_0158186 3300049572 Bacteria 1911
503 Ga0501038_0222333 3300049574 Bacteria 1506
504 Ga0501042_1222242 3300049578 Unclassified 548
505 Ga0501046_0190509 3300049580 Bacteria 1530
506 Ga0501047_0007395 3300049581 Bacteria 10330
507 Ga0501047_0412965 3300049581 Unclassified 1182
508 Ga0501070_0018451 3300049586 Bacteria 5853
509 Ga0501071_0255503 3300049587 Bacteria 1323
510 Ga0501073_0129007 3300049589 Bacteria 1753
511 Ga0501227_171080 3300049665 Bacteria 607
512 Ga0501235_215381 3300049669 Bacteria 525
513 Ga0501079_0563253 3300049741 Bacteria 896
514 Ga0501080_0461200 3300049742 Bacteria 1138
515 Ga0501268_180761 3300049765 Bacteria 502
516 Ga0501035_0006264 3300049822 Bacteria 11187
517 Ga0501044_0105996 3300049823 Bacteria 2823
518 Ga0501212_101705 3300049851 Bacteria 540
519 nmdc:mga0yw44_667867_c1 3300050492 Bacteria 706
520 nmdc:mga0yw44_76505_c1 3300050492 Bacteria 2089
521 nmdc:mga05p37_88293_c1 3300050507 Unclassified 3822
522 nmdc:mga09592_848283_c1 3300050508 Unclassified 770
523 nmdc:mga08y16_462792_c1 3300050511 Bacteria 1292
524 nmdc:mga0n895_1385432_c1 3300050512 Unclassified 672
525 nmdc:mga0n895_1536794_c1 3300050512 Unclassified 631
526 nmdc:mga0n895_719316_c1 3300050512 Unclassified 993
527 nmdc:mga08x19_145275_c1 3300050514 Bacteria 1604
528 nmdc:mga08x19_714136_c1 3300050514 Unclassified 711
529 nmdc:mga0sz30_17131_c2 3300050516 Bacteria 2475
530 Ga0495601_0168898 3300053077 Bacteria 1429
531 Ga0495601_0317461 3300053077 Bacteria 1014
532 Ga0495601_0891489 3300053077 Viruses 562
533 Ga0495612_0059460 3300053078 Bacteria 1580
534 Ga0495595_0005853 3300053084 Bacteria 4982
535 Ga0495595_0386397 3300053084 Unclassified 708
536 Ga0495595_0511772 3300053084 Viruses 612
537 Ga0495619_0212889 3300053085 Bacteria 1338
538 Ga0495619_0268015 3300053085 Bacteria 1183
539 Ga0495619_0519996 3300053085 Unclassified 818
540 Ga0495619_0536431 3300053085 Unclassified 803
541 Ga0500578_0037573 3300053086 Bacteria 3110
542 Ga0500578_0133699 3300053086 Bacteria 1554
543 Ga0500578_0200861 3300053086 Bacteria 1220
544 Ga0500643_000117 3300053087 Bacteria 82982
545 Ga0500643_079356 3300053087 Bacteria 903
546 Ga0500644_0074274 3300053088 Bacteria 1234
547 Ga0500583_0243017 3300053092 Bacteria 889
548 Ga0500651_0395506 3300053093 Bacteria 777
549 Ga0500640_154992 3300053095 Bacteria 868
550 Ga0500648_400472 3300053097 Bacteria 521
551 Ga0500555_004649 3300053103 Bacteria 3897
552 Ga0500556_0136352 3300053104 Bacteria 963
553 Ga0500562_001270 3300053108 Bacteria 6232
554 Ga0500582_160401 3300053114 Bacteria 774
555 Ga0500594_0046298 3300053118 Bacteria 1210
556 Ga0500595_067706 3300053119 Bacteria 1064
557 Ga0500607_151715 3300053121 Bacteria 1072
558 Ga0500614_029833 3300053123 Bacteria 1326
559 Ga0500621_180353 3300053126 Bacteria 766
560 Ga0500642_0039611 3300053130 Bacteria 2027
561 Ga0500652_024604 3300053131 Bacteria 2300
562 Ga0500655_018929 3300053133 Bacteria 1280
563 Ga0500559_0185429 3300053136 Bacteria 980
564 Ga0500564_193409 3300053138 Bacteria 840
565 Ga0500568_0099849 3300053139 Bacteria 1089
566 Ga0500577_0177854 3300053142 Bacteria 912
567 Ga0500577_0291481 3300053142 Bacteria 712
568 Ga0500577_0311559 3300053142 Bacteria 687
569 Ga0500588_0158658 3300053146 Bacteria 822
570 Ga0500604_0099021 3300053151 Bacteria 959
571 Ga0500616_0023597 3300053153 Bacteria 3425
572 Ga0500619_201997 3300053154 Bacteria 666
573 Ga0500620_000713 3300053155 Bacteria 5682
574 Ga0500622_0005729 3300053156 Bacteria 7381
575 Ga0500627_0083982 3300053158 Bacteria 1421
576 Ga0500633_0036000 3300053160 Bacteria 1634
577 Ga0500634_0269590 3300053161 Bacteria 694
578 Ga0500638_168308 3300053162 Bacteria 957
579 Ga0500637_0208947 3300053178 Bacteria 1108
580 Ga0500645_024777 3300053730 Bacteria 1833
581 Ga0500609_020984 3300053731 Bacteria 891
582 Ga0500599_076600 3300053736 Bacteria 562
583 Ga0500661_012269 3300055283 Bacteria 1547

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031249 Ga0265339_10113712 Ga0265339_101137122 69
2 iso_pu_bacteria 2508501042 2508695884 72
3 iso_pu_bacteria 2775506901 2776262817 72
4 iso_pu_bacteria 2847930680 2847931342 72
5 iso_pu_bacteria 2879083081 2879087619 72
6 iso_pu_bacteria 2894232714 2894240924 72
7 iso_pu_bacteria 2906643746 2906651477 72
8 iso_pu_bacteria 2935608549 2935614677 72
9 iso_pu_bacteria 2935769743 2935774668 72
10 iso_pu_bacteria 2935777560 2935783755 72
11 iso_pu_bacteria 2935785616 2935789817 72
12 iso_pu_bacteria 2935793552 2935797815 72
13 iso_pu_bacteria 2935819856 2935826282 72
14 iso_pu_bacteria 2935847175 2935853778 72
15 iso_pu_bacteria 2935908558 2935910999 72
16 iso_pu_bacteria 2935916978 2935924160 72
17 iso_pu_bacteria 2935926038 2935932787 72
18 iso_pu_bacteria 2935934488 2935937350 72
19 iso_pu_bacteria 2935942939 2935949449 72
20 iso_pu_bacteria 2935951376 2935958152 72
21 iso_pu_bacteria 2935967501 2935971193 72
22 iso_pu_bacteria 2941531003 2941537971 72
23 iso_pu_bacteria 8005246636 8005247641 72
24 iso_pu_bacteria 8016522445 8016525814 72
25 iso_pu_bacteria 8016530956 8016539413 72
26 iso_pu_bacteria 8016539877 8016543705 72
27 iso_pu_bacteria 8016548790 8016549591 72
28 iso_pu_bacteria 8016557553 8016558010 72
29 iso_pu_bacteria 8016566248 8016569108 72
30 iso_pu_bacteria 8016575299 8016581742 72
31 iso_pu_bacteria 8016595262 8016596024 72
32 iso_pu_bacteria 8016613128 8016618807 72
33 iso_pu_bacteria 8019530166 8019530694 72
34 iso_pu_bacteria 8019648815 8019652102 72
35 iso_pu_bacteria 8019687851 8019695785 72
36 iso_pu_bacteria 2935959822 2935967241 73
37 3300021388 Ga0213875_10090708 Ga0213875_100907081 75
38 3300037853 Ga0436364_1421633 Ga0436364_1421633_773_1000 75
39 3300039450 Ga0436363_0172666 Ga0436363_0172666_700_927 75
40 3300039453 Ga0436362_0642024 Ga0436362_0642024_49_276 75
41 3300046535 Ga0495586_0551278 Ga0495586_0551278_125_376 75
42 3300005262 Ga0065165_1001154 Ga0065165_100115434 76
43 3300005295 Ga0065707_10540224 Ga0065707_105402241 76
44 3300005329 Ga0070683_101060502 Ga0070683_1010605022 76
45 3300005330 Ga0070690_100434527 Ga0070690_1004345272 76
46 3300005331 Ga0070670_100264320 Ga0070670_1002643203 76
47 3300005336 Ga0070680_100034242 Ga0070680_1000342422 76
48 3300005339 Ga0070660_101137909 Ga0070660_1011379092 76
49 3300005340 Ga0070689_100071198 Ga0070689_1000711982 76
50 3300005340 Ga0070689_101031825 Ga0070689_1010318252 76
51 3300005344 Ga0070661_100805769 Ga0070661_1008057692 76
52 3300005347 Ga0070668_100007904 Ga0070668_10000790410 76
53 3300005347 Ga0070668_100228198 Ga0070668_1002281983 76
54 3300005353 Ga0070669_100079827 Ga0070669_1000798272 76
55 3300005353 Ga0070669_100793561 Ga0070669_1007935612 76
56 3300005353 Ga0070669_101354938 Ga0070669_1013549381 76
57 3300005354 Ga0070675_100219909 Ga0070675_1002199092 76
58 3300005354 Ga0070675_101498687 Ga0070675_1014986871 76
59 3300005355 Ga0070671_100019566 Ga0070671_1000195663 76
60 3300005355 Ga0070671_100157221 Ga0070671_1001572213 76
61 3300005355 Ga0070671_100699259 Ga0070671_1006992592 76
62 3300005364 Ga0070673_100012554 Ga0070673_1000125543 76
63 3300005366 Ga0070659_100198704 Ga0070659_1001987043 76
64 3300005367 Ga0070667_100024229 Ga0070667_1000242296 76
65 3300005434 Ga0070709_10042880 Ga0070709_100428803 76
66 3300005435 Ga0070714_100018965 Ga0070714_1000189654 76
67 3300005435 Ga0070714_100574540 Ga0070714_1005745402 76
68 3300005436 Ga0070713_100521626 Ga0070713_1005216263 76
69 3300005436 Ga0070713_101207546 Ga0070713_1012075462 76
70 3300005437 Ga0070710_10391777 Ga0070710_103917773 76
71 3300005440 Ga0070705_101292475 Ga0070705_1012924752 76
72 3300005455 Ga0070663_100931794 Ga0070663_1009317942 76
73 3300005455 Ga0070663_101208803 Ga0070663_1012088032 76
74 3300005455 Ga0070663_101247664 Ga0070663_1012476642 76
75 3300005456 Ga0070678_100654298 Ga0070678_1006542982 76
76 3300005457 Ga0070662_100061582 Ga0070662_1000615822 76
77 3300005458 Ga0070681_10031663 Ga0070681_100316634 76
78 3300005459 Ga0068867_100900431 Ga0068867_1009004312 76
79 3300005530 Ga0070679_100018245 Ga0070679_1000182456 76
80 3300005535 Ga0070684_100703808 Ga0070684_1007038082 76
81 3300005544 Ga0070686_101081700 Ga0070686_1010817002 76
82 3300005547 Ga0070693_100178400 Ga0070693_1001784001 76
83 3300005547 Ga0070693_100519685 Ga0070693_1005196852 76
84 3300005548 Ga0070665_100126888 Ga0070665_1001268883 76
85 3300005548 Ga0070665_101821754 Ga0070665_1018217542 76
86 3300005563 Ga0068855_100202260 Ga0068855_1002022602 76
87 3300005564 Ga0070664_101062918 Ga0070664_1010629181 76
88 3300005577 Ga0068857_100761112 Ga0068857_1007611122 76
89 3300005578 Ga0068854_100764450 Ga0068854_1007644501 76
90 3300005578 Ga0068854_101249425 Ga0068854_1012494252 76
91 3300005614 Ga0068856_101121751 Ga0068856_1011217512 76
92 3300005614 Ga0068856_101291964 Ga0068856_1012919642 76
93 3300005614 Ga0068856_101497677 Ga0068856_1014976772 76
94 3300005615 Ga0070702_101269170 Ga0070702_1012691701 76
95 3300005616 Ga0068852_101666922 Ga0068852_1016669221 76
96 3300005617 Ga0068859_100029735 Ga0068859_1000297353 76
97 3300005617 Ga0068859_100687559 Ga0068859_1006875591 76
98 3300005618 Ga0068864_100083027 Ga0068864_1000830272 76
99 3300005618 Ga0068864_100377388 Ga0068864_1003773883 76
100 3300005618 Ga0068864_101616663 Ga0068864_1016166631 76
101 3300005719 Ga0068861_100022727 Ga0068861_1000227275 76
102 3300005719 Ga0068861_100976646 Ga0068861_1009766462 76
103 3300005842 Ga0068858_101283057 Ga0068858_1012830572 76
104 3300005843 Ga0068860_100000268 Ga0068860_10000026855 76
105 3300005843 Ga0068860_100016951 Ga0068860_1000169517 76
106 3300005843 Ga0068860_101790294 Ga0068860_1017902941 76
107 3300005843 Ga0068860_102461346 Ga0068860_1024613462 76
108 3300005844 Ga0068862_100057617 Ga0068862_1000576172 76
109 3300005844 Ga0068862_101091892 Ga0068862_1010918922 76
110 3300006028 Ga0070717_10247006 Ga0070717_102470063 76
111 3300006028 Ga0070717_11088945 Ga0070717_110889452 76
112 3300006163 Ga0070715_10092266 Ga0070715_100922662 76
113 3300006173 Ga0070716_101666091 Ga0070716_1016660911 76
114 3300006175 Ga0070712_100931594 Ga0070712_1009315942 76
115 3300006186 Ga0075369_10016504 Ga0075369_100165042 76
116 3300006237 Ga0097621_101663767 Ga0097621_1016637672 76
117 3300006358 Ga0068871_100047607 Ga0068871_1000476072 76
118 3300006844 Ga0075428_100195559 Ga0075428_1001955592 76
119 3300006871 Ga0075434_101256052 Ga0075434_1012560522 76
120 3300006871 Ga0075434_101951931 Ga0075434_1019519311 76
121 3300006871 Ga0075434_102127478 Ga0075434_1021274781 76
122 3300006914 Ga0075436_100152759 Ga0075436_1001527594 76
123 3300006914 Ga0075436_100391785 Ga0075436_1003917852 76
124 3300006914 Ga0075436_101506194 Ga0075436_1015061941 76
125 3300006931 Ga0097620_100029735 Ga0097620_1000297357 76
126 3300006931 Ga0097620_100687631 Ga0097620_1006876311 76
127 3300006931 Ga0097620_101289292 Ga0097620_1012892922 76
128 3300006944 Ga0099823_1022011 Ga0099823_10220115 76
129 3300007076 Ga0075435_101662010 Ga0075435_1016620102 76
130 3300009036 Ga0105244_10486580 Ga0105244_104865802 76
131 3300009093 Ga0105240_10083631 Ga0105240_100836315 76
132 3300009093 Ga0105240_10989914 Ga0105240_109899142 76
133 3300009093 Ga0105240_12637619 Ga0105240_126376192 76
134 3300009094 Ga0111539_10079945 Ga0111539_100799456 76
135 3300009094 Ga0111539_10372851 Ga0111539_103728511 76
136 3300009094 Ga0111539_10388958 Ga0111539_103889581 76
137 3300009098 Ga0105245_10142087 Ga0105245_101420873 76
138 3300009098 Ga0105245_11186593 Ga0105245_111865932 76
139 3300009101 Ga0105247_10620167 Ga0105247_106201672 76
140 3300009147 Ga0114129_10101757 Ga0114129_101017572 76
141 3300009148 Ga0105243_10161008 Ga0105243_101610083 76
142 3300009148 Ga0105243_10330818 Ga0105243_103308182 76
143 3300009148 Ga0105243_10652983 Ga0105243_106529832 76
144 3300009174 Ga0105241_10365962 Ga0105241_103659622 76
145 3300009174 Ga0105241_10408075 Ga0105241_104080752 76
146 3300009176 Ga0105242_11299373 Ga0105242_112993731 76
147 3300009177 Ga0105248_10343146 Ga0105248_103431462 76
148 3300009545 Ga0105237_10230692 Ga0105237_102306923 76
149 3300009545 Ga0105237_10737447 Ga0105237_107374472 76
150 3300009545 Ga0105237_12392469 Ga0105237_123924691 76
151 3300009551 Ga0105238_10479338 Ga0105238_104793382 76
152 3300009553 Ga0105249_10210530 Ga0105249_102105303 76
153 3300010375 Ga0105239_10029546 Ga0105239_100295466 76
154 3300010375 Ga0105239_10164651 Ga0105239_101646515 76
155 3300010375 Ga0105239_10421145 Ga0105239_104211453 76
156 3300011119 Ga0105246_10067042 Ga0105246_100670424 76
157 3300011119 Ga0105246_10978190 Ga0105246_109781902 76
158 3300011119 Ga0105246_11903295 Ga0105246_119032952 76
159 3300011119 Ga0105246_11904209 Ga0105246_119042091 76
160 3300013296 Ga0157374_10517778 Ga0157374_105177782 76
161 3300013296 Ga0157374_10932818 Ga0157374_109328181 76
162 3300013297 Ga0157378_10395102 Ga0157378_103951022 76
163 3300013297 Ga0157378_10931766 Ga0157378_109317662 76
164 3300013297 Ga0157378_11122201 Ga0157378_111222013 76
165 3300013297 Ga0157378_11339907 Ga0157378_113399072 76
166 3300013306 Ga0163162_10601418 Ga0163162_106014182 76
167 3300013306 Ga0163162_11026732 Ga0163162_110267323 76
168 3300013308 Ga0157375_13613425 Ga0157375_136134252 76
169 3300014325 Ga0163163_10573307 Ga0163163_105733073 76
170 3300014326 Ga0157380_10007924 Ga0157380_100079241 76
171 3300014326 Ga0157380_10252991 Ga0157380_102529912 76
172 3300014745 Ga0157377_10279372 Ga0157377_102793722 76
173 3300014745 Ga0157377_10692885 Ga0157377_106928852 76
174 3300014969 Ga0157376_10050292 Ga0157376_100502922 76
175 3300014969 Ga0157376_10875651 Ga0157376_108756512 76
176 3300014969 Ga0157376_12954952 Ga0157376_129549522 76
177 3300021377 Ga0213874_10050250 Ga0213874_100502505 76
178 3300021384 Ga0213876_10009102 Ga0213876_100091024 76
179 3300021384 Ga0213876_10499196 Ga0213876_104991962 76
180 3300021441 Ga0213871_10164551 Ga0213871_101645512 76
181 3300022732 Ga0224569_101604 Ga0224569_1016042 76
182 3300022734 Ga0224571_102028 Ga0224571_1020282 76
183 3300024225 Ga0224572_1107773 Ga0224572_11077732 76
184 3300024227 Ga0228598_1009083 Ga0228598_10090832 76
185 3300025302 Ga0207426_1086606 Ga0207426_10866062 76
186 3300025898 Ga0207692_10624012 Ga0207692_106240121 76
187 3300025901 Ga0207688_10118753 Ga0207688_101187531 76
188 3300025906 Ga0207699_10063045 Ga0207699_100630452 76
189 3300025908 Ga0207643_10319237 Ga0207643_103192372 76
190 3300025911 Ga0207654_10475195 Ga0207654_104751951 76
191 3300025912 Ga0207707_10030602 Ga0207707_100306025 76
192 3300025913 Ga0207695_10124972 Ga0207695_101249725 76
193 3300025914 Ga0207671_10992947 Ga0207671_109929471 76
194 3300025914 Ga0207671_11044254 Ga0207671_110442541 76
195 3300025915 Ga0207693_10351953 Ga0207693_103519533 76
196 3300025915 Ga0207693_10645401 Ga0207693_106454012 76
197 3300025916 Ga0207663_10110496 Ga0207663_101104962 76
198 3300025916 Ga0207663_11261955 Ga0207663_112619551 76
199 3300025917 Ga0207660_10032900 Ga0207660_100329002 76
200 3300025921 Ga0207652_10062805 Ga0207652_100628055 76
201 3300025923 Ga0207681_10146919 Ga0207681_101469191 76
202 3300025923 Ga0207681_10579884 Ga0207681_105798843 76
203 3300025924 Ga0207694_10690124 Ga0207694_106901242 76
204 3300025925 Ga0207650_10119740 Ga0207650_101197403 76
205 3300025925 Ga0207650_10152749 Ga0207650_101527493 76
206 3300025927 Ga0207687_10030630 Ga0207687_100306304 76
207 3300025928 Ga0207700_10346389 Ga0207700_103463892 76
208 3300025928 Ga0207700_11213512 Ga0207700_112135121 76
209 3300025931 Ga0207644_10006764 Ga0207644_100067646 76
210 3300025931 Ga0207644_10111530 Ga0207644_101115303 76
211 3300025933 Ga0207706_10285462 Ga0207706_102854621 76
212 3300025933 Ga0207706_10633921 Ga0207706_106339211 76
213 3300025934 Ga0207686_11478431 Ga0207686_114784311 76
214 3300025935 Ga0207709_10179535 Ga0207709_101795353 76
215 3300025935 Ga0207709_10757538 Ga0207709_107575382 76
216 3300025936 Ga0207670_10027789 Ga0207670_100277893 76
217 3300025938 Ga0207704_11302956 Ga0207704_113029562 76
218 3300025940 Ga0207691_10135438 Ga0207691_101354382 76
219 3300025941 Ga0207711_10621994 Ga0207711_106219942 76
220 3300025941 Ga0207711_10968208 Ga0207711_109682082 76
221 3300025945 Ga0207679_10084497 Ga0207679_100844973 76
222 3300025949 Ga0207667_10120516 Ga0207667_101205164 76
223 3300025960 Ga0207651_10005889 Ga0207651_100058895 76
224 3300025972 Ga0207668_10018118 Ga0207668_100181186 76
225 3300025972 Ga0207668_10147330 Ga0207668_101473302 76
226 3300025972 Ga0207668_10489869 Ga0207668_104898691 76
227 3300025981 Ga0207640_10825610 Ga0207640_108256102 76
228 3300025981 Ga0207640_12110885 Ga0207640_121108852 76
229 3300025986 Ga0207658_10345394 Ga0207658_103453942 76
230 3300026035 Ga0207703_10983140 Ga0207703_109831402 76
231 3300026035 Ga0207703_11111933 Ga0207703_111119332 76
232 3300026067 Ga0207678_10976460 Ga0207678_109764602 76
233 3300026067 Ga0207678_11371221 Ga0207678_113712212 76
234 3300026067 Ga0207678_11581433 Ga0207678_115814331 76
235 3300026078 Ga0207702_11143497 Ga0207702_111434971 76
236 3300026078 Ga0207702_11749581 Ga0207702_117495812 76
237 3300026089 Ga0207648_12124193 Ga0207648_121241931 76
238 3300026095 Ga0207676_10147427 Ga0207676_101474272 76
239 3300026095 Ga0207676_11047340 Ga0207676_110473402 76
240 3300026095 Ga0207676_11606843 Ga0207676_116068432 76
241 3300026116 Ga0207674_11772765 Ga0207674_117727651 76
242 3300026118 Ga0207675_100017209 Ga0207675_1000172096 76
243 3300026118 Ga0207675_100256068 Ga0207675_1002560681 76
244 3300026118 Ga0207675_100926428 Ga0207675_1009264283 76
245 3300026121 Ga0207683_10125646 Ga0207683_101256463 76
246 3300027296 Ga0209389_1000163 Ga0209389_100016313 76
247 3300027361 Ga0209489_101100 Ga0209489_10110013 76
248 3300027363 Ga0209700_100014 Ga0209700_100014226 76
249 3300028379 Ga0268266_10085221 Ga0268266_100852213 76
250 3300028379 Ga0268266_11615499 Ga0268266_116154991 76
251 3300028380 Ga0268265_10310652 Ga0268265_103106523 76
252 3300028381 Ga0268264_10000084 Ga0268264_10000084184 76
253 3300028381 Ga0268264_10043258 Ga0268264_100432586 76
254 3300028381 Ga0268264_11649250 Ga0268264_116492501 76
255 3300028556 Ga0265337_1001532 Ga0265337_10015325 76
256 3300028573 Ga0265334_10003016 Ga0265334_100030164 76
257 3300028800 Ga0265338_10005127 Ga0265338_1000512711 76
258 3300031241 Ga0265325_10094196 Ga0265325_100941962 76
259 3300031344 Ga0265316_10266742 Ga0265316_102667423 76
260 3300031344 Ga0265316_10993832 Ga0265316_109938321 76
261 3300031548 Ga0307408_101542547 Ga0307408_1015425471 76
262 3300031595 Ga0265313_10026043 Ga0265313_100260432 76
263 3300031595 Ga0265313_10161140 Ga0265313_101611402 76
264 3300031995 Ga0307409_101410659 Ga0307409_1014106592 76
265 3300031995 Ga0307409_102264235 Ga0307409_1022642352 76
266 3300032005 Ga0307411_10848627 Ga0307411_108486272 76
267 3300032126 Ga0307415_100397924 Ga0307415_1003979243 76
268 3300033180 Ga0307510_10112763 Ga0307510_101127633 76
269 3300033180 Ga0307510_10460404 Ga0307510_104604042 76
270 3300035083 Ga0373926_0442699 Ga0373926_0442699_210_443 76
271 3300035086 Ga0373934_0308384 Ga0373934_0308384_357_614 76
272 3300035089 Ga0373944_0083672 Ga0373944_0083672_317_550 76
273 3300035111 Ga0373923_0556123 Ga0373923_0556123_219_473 76
274 3300035116 Ga0373945_0474794 Ga0373945_0474794_121_354 76
275 3300035117 Ga0373953_0394982 Ga0373953_0394982_107_337 76
276 3300035118 Ga0373954_0427590 Ga0373954_0427590_365_598 76
277 3300035170 Ga0373943_0523167 Ga0373943_0523167_234_491 76
278 3300035171 Ga0373946_0286958 Ga0373946_0286958_517_750 76
279 3300035171 Ga0373946_0597814 Ga0373946_0597814_29_262 76
280 3300035171 Ga0373946_0605013 Ga0373946_0605013_194_451 76
281 3300035172 Ga0373955_0360446 Ga0373955_0360446_245_475 76
282 3300035172 Ga0373955_0436474 Ga0373955_0436474_459_692 76
283 3300035692 Ga0373935_0146888 Ga0373935_0146888_477_710 76
284 3300035692 Ga0373935_0580915 Ga0373935_0580915_573_806 76
285 3300035695 Ga0373927_0040261 Ga0373927_0040261_2141_2374 76
286 3300035695 Ga0373927_0145017 Ga0373927_0145017_651_893 76
287 3300035695 Ga0373927_0183799 Ga0373927_0183799_924_1181 76
288 3300035724 Ga0373933_0503343 Ga0373933_0503343_397_627 76
289 3300035724 Ga0373933_0626213 Ga0373933_0626213_433_666 76
290 3300035725 Ga0373947_0017017 Ga0373947_0017017_2799_3032 76
291 3300035725 Ga0373947_0123023 Ga0373947_0123023_125_358 76
292 3300036401 Ga0373937_0798541 Ga0373937_0798541_512_745 76
293 3300037068 Ga0373925_0041445 Ga0373925_0041445_2562_2804 76
294 3300037068 Ga0373925_0227139 Ga0373925_0227139_161_418 76
295 3300037068 Ga0373925_0277974 Ga0373925_0277974_643_876 76
296 3300037068 Ga0373925_0608972 Ga0373925_0608972_496_774 76
297 3300037312 Ga0395899_0783190 Ga0395899_0783190_193_423 76
298 3300039437 Ga0436365_1309872 Ga0436365_1309872_317_547 76
299 3300039437 Ga0436365_1716550 Ga0436365_1716550_399_632 76
300 3300039438 Ga0436360_1046720 Ga0436360_1046720_445_714 76
301 3300039447 Ga0436361_0674457 Ga0436361_0674457_279_548 76
302 3300039450 Ga0436363_1648471 Ga0436363_1648471_68_337 76
303 3300041498 Ga0451841_1458524 Ga0451841_1458524_299_550 76
304 3300041512 Ga0451853_2443084 Ga0451853_2443084_422_664 76
305 3300044684 Ga0466966_0018882 Ga0466966_0018882_3803_4033 76
306 3300044684 Ga0466966_0262046 Ga0466966_0262046_751_981 76
307 3300044693 Ga0466961_0176177 Ga0466961_0176177_902_1132 76
308 3300044693 Ga0466961_0419577 Ga0466961_0419577_334_564 76
309 3300044901 Ga0466960_0722486 Ga0466960_0722486_115_366 76
310 3300045049 Ga0466959_0035456 Ga0466959_0035456_3066_3296 76
311 3300045836 Ga0466958_0276593 Ga0466958_0276593_249_479 76
312 3300045976 Ga0466967_0139284 Ga0466967_0139284_835_1071 76
313 3300046452 Ga0495617_103380 Ga0495617_103380_99_341 76
314 3300046452 Ga0495617_219080 Ga0495617_219080_212_445 76
315 3300046454 Ga0495592_0582116 Ga0495592_0582116_143_400 76
316 3300046455 Ga0495603_0177359 Ga0495603_0177359_211_444 76
317 3300046455 Ga0495603_0650037 Ga0495603_0650037_87_320 76
318 3300046459 Ga0495629_0529375 Ga0495629_0529375_30_263 76
319 3300046460 Ga0495638_0004594 Ga0495638_0004594_7102_7344 76
320 3300046461 Ga0495641_0581983 Ga0495641_0581983_42_275 76
321 3300046462 Ga0495651_0244190 Ga0495651_0244190_127_360 76
322 3300046463 Ga0495653_0114524 Ga0495653_0114524_534_875 76
323 3300046463 Ga0495653_0261187 Ga0495653_0261187_261_491 76
324 3300046463 Ga0495653_0311048 Ga0495653_0311048_131_388 76
325 3300046472 Ga0495580_0114661 Ga0495580_0114661_998_1231 76
326 3300046473 Ga0495582_0667227 Ga0495582_0667227_333_566 76
327 3300046476 Ga0495662_0354087 Ga0495662_0354087_146_379 76
328 3300046476 Ga0495662_0595936 Ga0495662_0595936_286_519 76
329 3300046476 Ga0495662_0657183 Ga0495662_0657183_143_376 76
330 3300046477 Ga0495664_0834738 Ga0495664_0834738_90_323 76
331 3300046499 Ga0495594_0103147 Ga0495594_0103147_75_308 76
332 3300046506 Ga0495583_0249995 Ga0495583_0249995_170_412 76
333 3300046507 Ga0495606_0116727 Ga0495606_0116727_1166_1396 76
334 3300046512 Ga0495610_0133258 Ga0495610_0133258_495_737 76
335 3300046514 Ga0495618_0611436 Ga0495618_0611436_209_442 76
336 3300046517 Ga0495630_1226776 Ga0495630_1226776_318_551 76
337 3300046518 Ga0495631_0111893 Ga0495631_0111893_541_783 76
338 3300046519 Ga0495632_0308259 Ga0495632_0308259_461_691 76
339 3300046522 Ga0495643_0145894 Ga0495643_0145894_297_527 76
340 3300046524 Ga0495648_0009414 Ga0495648_0009414_2457_2687 76
341 3300046524 Ga0495648_0126300 Ga0495648_0126300_409_651 76
342 3300046526 Ga0495666_0090511 Ga0495666_0090511_623_856 76
343 3300046526 Ga0495666_0431102 Ga0495666_0431102_14_247 76
344 3300046529 Ga0495652_0502599 Ga0495652_0502599_16_249 76
345 3300046531 Ga0495665_0042920 Ga0495665_0042920_1992_2249 76
346 3300046531 Ga0495665_0205698 Ga0495665_0205698_639_872 76
347 3300046533 Ga0495640_0585669 Ga0495640_0585669_332_589 76
348 3300046536 Ga0495587_0413401 Ga0495587_0413401_146_376 76
349 3300046536 Ga0495587_0577381 Ga0495587_0577381_332_565 76
350 3300046557 Ga0495622_0122451 Ga0495622_0122451_647_880 76
351 3300046559 Ga0495667_0525845 Ga0495667_0525845_158_391 76
352 3300046616 Ga0495668_0189078 Ga0495668_0189078_859_1089 76
353 3300046642 Ga0495634_0100221 Ga0495634_0100221_1190_1423 76
354 3300046642 Ga0495634_0124360 Ga0495634_0124360_1369_1626 76
355 3300046642 Ga0495634_0523034 Ga0495634_0523034_61_291 76
356 3300046648 Ga0495611_0174619 Ga0495611_0174619_736_978 76
357 3300046648 Ga0495611_0349216 Ga0495611_0349216_132_365 76
358 3300046660 Ga0495625_0892379 Ga0495625_0892379_67_309 76
359 3300046663 Ga0495635_0108320 Ga0495635_0108320_369_626 76
360 3300046664 Ga0495659_0094080 Ga0495659_0094080_852_1085 76
361 3300046665 Ga0495661_0277942 Ga0495661_0277942_95_337 76
362 3300046665 Ga0495661_0603370 Ga0495661_0603370_49_282 76
363 3300046674 Ga0495588_0115934 Ga0495588_0115934_134_388 76
364 3300046674 Ga0495588_0725395 Ga0495588_0725395_124_357 76
365 3300046678 Ga0495599_0447820 Ga0495599_0447820_42_275 76
366 3300046680 Ga0495646_0383302 Ga0495646_0383302_446_679 76
367 3300046681 Ga0495647_0131906 Ga0495647_0131906_724_957 76
368 3300046681 Ga0495647_0154729 Ga0495647_0154729_570_851 76
369 3300046681 Ga0495647_0404336 Ga0495647_0404336_44_277 76
370 3300046689 Ga0495613_0704324 Ga0495613_0704324_90_323 76
371 3300046690 Ga0495624_0741969 Ga0495624_0741969_91_387 76
372 3300046694 Ga0495649_0019237 Ga0495649_0019237_1068_1298 76
373 3300046694 Ga0495649_0257446 Ga0495649_0257446_17_259 76
374 3300047315 Ga0495581_0115808 Ga0495581_0115808_45_278 76
375 3300047315 Ga0495581_0404079 Ga0495581_0404079_268_549 76
376 3300047315 Ga0495581_0418648 Ga0495581_0418648_528_761 76
377 3300047317 Ga0495604_0352623 Ga0495604_0352623_444_698 76
378 3300047319 Ga0495674_0062120 Ga0495674_0062120_1787_2041 76
379 3300047319 Ga0495674_0739714 Ga0495674_0739714_112_342 76
380 3300047320 Ga0495672_0177727 Ga0495672_0177727_738_971 76
381 3300047320 Ga0495672_0245552 Ga0495672_0245552_587_829 76
382 3300047321 Ga0495676_0120638 Ga0495676_0120638_378_611 76
383 3300047322 Ga0495680_0232889 Ga0495680_0232889_906_1163 76
384 3300047323 Ga0495683_0058140 Ga0495683_0058140_752_982 76
385 3300047471 Ga0495684_0396084 Ga0495684_0396084_717_950 76
386 3300047471 Ga0495684_0616903 Ga0495684_0616903_88_318 76
387 3300047472 Ga0495686_0596580 Ga0495686_0596580_51_281 76
388 3300047673 Ga0495593_0459330 Ga0495593_0459330_162_395 76
389 3300048088 Ga0495602_0116927 Ga0495602_0116927_173_403 76
390 3300048089 Ga0495614_0265744 Ga0495614_0265744_176_409 76
391 3300048903 Ga0496100_0006947 Ga0496100_0006947_1647_1877 76
392 3300048904 Ga0496101_0002879 Ga0496101_0002879_10055_10285 76
393 3300048905 Ga0496102_0013972 Ga0496102_0013972_901_1131 76
394 3300048905 Ga0496102_0470955 Ga0496102_0470955_877_1110 76
395 3300048905 Ga0496102_0530466 Ga0496102_0530466_626_859 76
396 3300048905 Ga0496102_0896040 Ga0496102_0896040_199_441 76
397 3300048905 Ga0496102_1202409 Ga0496102_1202409_77_319 76
398 3300048906 Ga0496103_0086498 Ga0496103_0086498_1145_1378 76
399 3300048906 Ga0496103_0104277 Ga0496103_0104277_53_283 76
400 3300048907 Ga0496104_0011750 Ga0496104_0011750_406_636 76
401 3300048909 Ga0496106_0000376 Ga0496106_0000376_437_667 76
402 3300048910 Ga0496107_0004183 Ga0496107_0004183_6408_6638 76
403 3300048910 Ga0496107_0322613 Ga0496107_0322613_511_765 76
404 3300048911 Ga0496108_0076434 Ga0496108_0076434_1508_1762 76
405 3300048911 Ga0496108_0333237 Ga0496108_0333237_383_613 76
406 3300048911 Ga0496108_0689498 Ga0496108_0689498_412_645 76
407 3300048911 Ga0496108_0965761 Ga0496108_0965761_466_699 76
408 3300048912 Ga0496109_0048703 Ga0496109_0048703_3096_3326 76
409 3300048912 Ga0496109_0461222 Ga0496109_0461222_321_554 76
410 3300048913 Ga0496110_0037229 Ga0496110_0037229_796_1026 76
411 3300048913 Ga0496110_0046555 Ga0496110_0046555_3371_3604 76
412 3300048913 Ga0496110_0099450 Ga0496110_0099450_1601_1855 76
413 3300048913 Ga0496110_0323344 Ga0496110_0323344_907_1140 76
414 3300048914 Ga0496111_0121568 Ga0496111_0121568_1532_1786 76
415 3300048914 Ga0496111_0185919 Ga0496111_0185919_970_1203 76
416 3300048915 Ga0496112_0014918 Ga0496112_0014918_1724_1957 76
417 3300048915 Ga0496112_0085760 Ga0496112_0085760_448_702 76
418 3300048915 Ga0496112_0189748 Ga0496112_0189748_412_681 76
419 3300048916 Ga0496113_0387147 Ga0496113_0387147_454_708 76
420 3300048916 Ga0496113_1020911 Ga0496113_1020911_16_249 76
421 3300048918 Ga0496115_0047962 Ga0496115_0047962_1511_1741 76
422 3300048918 Ga0496115_0334456 Ga0496115_0334456_617_850 76
423 3300048921 Ga0496118_0047326 Ga0496118_0047326_1114_1347 76
424 3300048924 Ga0496121_0597350 Ga0496121_0597350_272_502 76
425 3300048924 Ga0496121_0641551 Ga0496121_0641551_260_490 76
426 3300048928 Ga0496125_0402554 Ga0496125_0402554_133_363 76
427 3300048929 Ga0496126_0279862 Ga0496126_0279862_363_593 76
428 3300049569 Ga0501032_0197142 Ga0501032_0197142_287_517 76
429 3300049570 Ga0501033_0357765 Ga0501033_0357765_482_712 76
430 3300049571 Ga0501034_0015559 Ga0501034_0015559_2948_3178 76
431 3300049572 Ga0501036_0158186 Ga0501036_0158186_1152_1382 76
432 3300049574 Ga0501038_0222333 Ga0501038_0222333_1119_1349 76
433 3300049578 Ga0501042_1222242 Ga0501042_1222242_25_258 76
434 3300049580 Ga0501046_0190509 Ga0501046_0190509_619_849 76
435 3300049581 Ga0501047_0007395 Ga0501047_0007395_1675_1905 76
436 3300049586 Ga0501070_0018451 Ga0501070_0018451_5201_5431 76
437 3300049587 Ga0501071_0255503 Ga0501071_0255503_420_653 76
438 3300049589 Ga0501073_0129007 Ga0501073_0129007_365_595 76
439 3300049665 Ga0501227_171080 Ga0501227_171080_157_387 76
440 3300049669 Ga0501235_215381 Ga0501235_215381_137_367 76
441 3300049741 Ga0501079_0563253 Ga0501079_0563253_582_815 76
442 3300049742 Ga0501080_0461200 Ga0501080_0461200_849_1079 76
443 3300049765 Ga0501268_180761 Ga0501268_180761_111_341 76
444 3300049822 Ga0501035_0006264 Ga0501035_0006264_5677_5907 76
445 3300049823 Ga0501044_0105996 Ga0501044_0105996_103_333 76
446 3300049851 Ga0501212_101705 Ga0501212_101705_11_253 76
447 3300050492 nmdc:mga0yw44_667867_c1 nmdc:mga0yw44_667867_c1_233_466 76
448 3300050507 nmdc:mga05p37_88293_c1 nmdc:mga05p37_88293_c1_392_625 76
449 3300050508 nmdc:mga09592_848283_c1 nmdc:mga09592_848283_c1_121_354 76
450 3300050511 nmdc:mga08y16_462792_c1 nmdc:mga08y16_462792_c1_995_1237 76
451 3300050512 nmdc:mga0n895_1385432_c1 nmdc:mga0n895_1385432_c1_44_274 76
452 3300050512 nmdc:mga0n895_1536794_c1 nmdc:mga0n895_1536794_c1_235_468 76
453 3300050512 nmdc:mga0n895_719316_c1 nmdc:mga0n895_719316_c1_494_748 76
454 3300050514 nmdc:mga08x19_145275_c1 nmdc:mga08x19_145275_c1_515_748 76
455 3300050514 nmdc:mga08x19_714136_c1 nmdc:mga08x19_714136_c1_292_546 76
456 3300050516 nmdc:mga0sz30_17131_c2 nmdc:mga0sz30_17131_c2_204_437 76
457 3300053077 Ga0495601_0168898 Ga0495601_0168898_65_346 76
458 3300053077 Ga0495601_0317461 Ga0495601_0317461_408_638 76
459 3300053077 Ga0495601_0891489 Ga0495601_0891489_46_279 76
460 3300053078 Ga0495612_0059460 Ga0495612_0059460_215_448 76
461 3300053084 Ga0495595_0005853 Ga0495595_0005853_1890_2120 76
462 3300053084 Ga0495595_0386397 Ga0495595_0386397_355_609 76
463 3300053084 Ga0495595_0511772 Ga0495595_0511772_89_322 76
464 3300053085 Ga0495619_0212889 Ga0495619_0212889_850_1080 76
465 3300053085 Ga0495619_0268015 Ga0495619_0268015_429_686 76
466 3300053085 Ga0495619_0519996 Ga0495619_0519996_471_704 76
467 3300053085 Ga0495619_0536431 Ga0495619_0536431_383_616 76
468 3300053086 Ga0500578_0133699 Ga0500578_0133699_834_1064 76
469 3300053086 Ga0500578_0200861 Ga0500578_0200861_898_1140 76
470 3300053087 Ga0500643_000117 Ga0500643_000117_63499_63741 76
471 3300053088 Ga0500644_0074274 Ga0500644_0074274_80_322 76
472 3300053092 Ga0500583_0243017 Ga0500583_0243017_465_707 76
473 3300053093 Ga0500651_0395506 Ga0500651_0395506_325_567 76
474 3300053095 Ga0500640_154992 Ga0500640_154992_158_388 76
475 3300053097 Ga0500648_400472 Ga0500648_400472_246_500 76
476 3300053103 Ga0500555_004649 Ga0500555_004649_3163_3405 76
477 3300053104 Ga0500556_0136352 Ga0500556_0136352_352_594 76
478 3300053108 Ga0500562_001270 Ga0500562_001270_1337_1579 76
479 3300053114 Ga0500582_160401 Ga0500582_160401_483_725 76
480 3300053118 Ga0500594_0046298 Ga0500594_0046298_218_460 76
481 3300053121 Ga0500607_151715 Ga0500607_151715_387_641 76
482 3300053123 Ga0500614_029833 Ga0500614_029833_654_908 76
483 3300053126 Ga0500621_180353 Ga0500621_180353_463_705 76
484 3300053130 Ga0500642_0039611 Ga0500642_0039611_1289_1531 76
485 3300053131 Ga0500652_024604 Ga0500652_024604_489_731 76
486 3300053133 Ga0500655_018929 Ga0500655_018929_503_745 76
487 3300053136 Ga0500559_0185429 Ga0500559_0185429_693_947 76
488 3300053138 Ga0500564_193409 Ga0500564_193409_55_285 76
489 3300053139 Ga0500568_0099849 Ga0500568_0099849_244_486 76
490 3300053142 Ga0500577_0177854 Ga0500577_0177854_44_286 76
491 3300053142 Ga0500577_0291481 Ga0500577_0291481_404_646 76
492 3300053142 Ga0500577_0311559 Ga0500577_0311559_194_436 76
493 3300053146 Ga0500588_0158658 Ga0500588_0158658_147_389 76
494 3300053151 Ga0500604_0099021 Ga0500604_0099021_165_407 76
495 3300053153 Ga0500616_0023597 Ga0500616_0023597_2575_2817 76
496 3300053154 Ga0500619_201997 Ga0500619_201997_164_418 76
497 3300053156 Ga0500622_0005729 Ga0500622_0005729_789_1031 76
498 3300053158 Ga0500627_0083982 Ga0500627_0083982_369_611 76
499 3300053160 Ga0500633_0036000 Ga0500633_0036000_234_491 76
500 3300053161 Ga0500634_0269590 Ga0500634_0269590_265_507 76
501 3300053162 Ga0500638_168308 Ga0500638_168308_304_558 76
502 3300053730 Ga0500645_024777 Ga0500645_024777_1167_1409 76
503 3300053731 Ga0500609_020984 Ga0500609_020984_488_730 76
504 3300053736 Ga0500599_076600 Ga0500599_076600_254_496 76
505 iso_pu_bacteria 2935984226 2935985352 76
506 iso_pu_bacteria 2936055302 2936056884 76
507 iso_pu_bacteria 8016603502 8016606899 76
508 iso_pu_bacteria 8016622563 8016622729 76
509 iso_pu_bacteria 8019538911 8019540888 76
510 iso_pu_bacteria 8019547302 8019549726 76
511 3300002070 JGI24750J21931_1024865 JGI24750J21931_10248651 77
512 3300003320 rootH2_10319174 rootH2_103191742 77
513 3300003763 Ga0055529_1009520 Ga0055529_10095202 77
514 3300005330 Ga0070690_100112997 Ga0070690_1001129972 77
515 3300005338 Ga0068868_100128888 Ga0068868_1001288883 77
516 3300005339 Ga0070660_100877182 Ga0070660_1008771822 77
517 3300005340 Ga0070689_100091672 Ga0070689_1000916724 77
518 3300005343 Ga0070687_100115211 Ga0070687_1001152112 77
519 3300005344 Ga0070661_101550811 Ga0070661_1015508111 77
520 3300005356 Ga0070674_100022315 Ga0070674_1000223152 77
521 3300005365 Ga0070688_100526967 Ga0070688_1005269672 77
522 3300005436 Ga0070713_101166851 Ga0070713_1011668511 77
523 3300005441 Ga0070700_100091204 Ga0070700_1000912042 77
524 3300005455 Ga0070663_100020160 Ga0070663_1000201604 77
525 3300005455 Ga0070663_100438238 Ga0070663_1004382382 77
526 3300005456 Ga0070678_100125843 Ga0070678_1001258432 77
527 3300005457 Ga0070662_100351699 Ga0070662_1003516991 77
528 3300005459 Ga0068867_100018716 Ga0068867_1000187162 77
529 3300005536 Ga0070697_100158569 Ga0070697_1001585692 77
530 3300005539 Ga0068853_101757833 Ga0068853_1017578331 77
531 3300005543 Ga0070672_100065589 Ga0070672_1000655892 77
532 3300005544 Ga0070686_100154960 Ga0070686_1001549602 77
533 3300005544 Ga0070686_100721307 Ga0070686_1007213072 77
534 3300005547 Ga0070693_100095437 Ga0070693_1000954372 77
535 3300005548 Ga0070665_100276729 Ga0070665_1002767292 77
536 3300005564 Ga0070664_101222382 Ga0070664_1012223822 77
537 3300005615 Ga0070702_100076996 Ga0070702_1000769962 77
538 3300005616 Ga0068852_100582866 Ga0068852_1005828662 77
539 3300005718 Ga0068866_10163536 Ga0068866_101635363 77
540 3300005719 Ga0068861_100033637 Ga0068861_1000336372 77
541 3300005834 Ga0068851_10616160 Ga0068851_106161602 77
542 3300005844 Ga0068862_100040308 Ga0068862_1000403084 77
543 3300006038 Ga0075365_10130295 Ga0075365_101302953 77
544 3300006186 Ga0075369_10177128 Ga0075369_101771283 77
545 3300006237 Ga0097621_100177153 Ga0097621_1001771535 77
546 3300006881 Ga0068865_100030701 Ga0068865_1000307013 77
547 3300007265 Ga0099794_10157232 Ga0099794_101572322 77
548 3300009098 Ga0105245_10292220 Ga0105245_102922201 77
549 3300009101 Ga0105247_10467834 Ga0105247_104678342 77
550 3300009174 Ga0105241_12642981 Ga0105241_126429812 77
551 3300009545 Ga0105237_11679179 Ga0105237_116791792 77
552 3300009551 Ga0105238_12095174 Ga0105238_120951741 77
553 3300009551 Ga0105238_12172458 Ga0105238_121724582 77
554 3300009551 Ga0105238_12876569 Ga0105238_128765691 77
555 3300010375 Ga0105239_10505029 Ga0105239_105050292 77
556 3300010375 Ga0105239_12983064 Ga0105239_129830642 77
557 3300013105 Ga0157369_10235971 Ga0157369_102359712 77
558 3300013306 Ga0163162_10316100 Ga0163162_103161002 77
559 3300013307 Ga0157372_12014894 Ga0157372_120148942 77
560 3300014326 Ga0157380_10167313 Ga0157380_101673132 77
561 3300017792 Ga0163161_10023605 Ga0163161_100236054 77
562 3300025254 Ga0209148_1000743 Ga0209148_100074312 77
563 3300025261 Ga0209233_1011156 Ga0209233_10111563 77
564 3300025272 Ga0209455_1006185 Ga0209455_10061853 77
565 3300025297 Ga0209758_1134290 Ga0209758_11342901 77
566 3300025899 Ga0207642_10151539 Ga0207642_101515392 77
567 3300025901 Ga0207688_10065013 Ga0207688_100650134 77
568 3300025909 Ga0207705_10671469 Ga0207705_106714692 77
569 3300025919 Ga0207657_10738076 Ga0207657_107380761 77
570 3300025924 Ga0207694_11652217 Ga0207694_116522172 77
571 3300025927 Ga0207687_11354651 Ga0207687_113546511 77
572 3300025928 Ga0207700_10863242 Ga0207700_108632421 77
573 3300025932 Ga0207690_11230578 Ga0207690_112305781 77
574 3300025934 Ga0207686_10528968 Ga0207686_105289682 77
575 3300025935 Ga0207709_10056794 Ga0207709_100567944 77
576 3300025937 Ga0207669_10013041 Ga0207669_100130414 77
577 3300025938 Ga0207704_10045939 Ga0207704_100459392 77
578 3300025940 Ga0207691_10075934 Ga0207691_100759344 77
579 3300025961 Ga0207712_10022637 Ga0207712_100226372 77
580 3300025972 Ga0207668_10089108 Ga0207668_100891082 77
581 3300026023 Ga0207677_11459398 Ga0207677_114593981 77
582 3300026035 Ga0207703_11594689 Ga0207703_115946892 77
583 3300026041 Ga0207639_10992261 Ga0207639_109922612 77
584 3300026067 Ga0207678_10146041 Ga0207678_101460413 77
585 3300026067 Ga0207678_10407399 Ga0207678_104073992 77
586 3300026075 Ga0207708_10114806 Ga0207708_101148063 77
587 3300026089 Ga0207648_10020966 Ga0207648_100209664 77
588 3300026118 Ga0207675_100050699 Ga0207675_1000506992 77
589 3300026121 Ga0207683_10034616 Ga0207683_100346162 77
590 3300026142 Ga0207698_10260785 Ga0207698_102607852 77
591 3300028379 Ga0268266_10632567 Ga0268266_106325672 77
592 3300031250 Ga0265331_10325660 Ga0265331_103256602 77
593 3300031456 Ga0307513_10516423 Ga0307513_105164232 77
594 3300031507 Ga0307509_10006030 Ga0307509_1000603015 77
595 3300031903 Ga0307407_10108655 Ga0307407_101086552 77
596 3300031995 Ga0307409_102924112 Ga0307409_1029241121 77
597 3300032002 Ga0307416_100314860 Ga0307416_1003148604 77
598 3300032002 Ga0307416_100477485 Ga0307416_1004774853 77
599 3300032004 Ga0307414_10457489 Ga0307414_104574893 77
600 3300032126 Ga0307415_100392443 Ga0307415_1003924433 77
601 3300033179 Ga0307507_10469415 Ga0307507_104694152 77
602 3300035241 Ga0373961_0442948 Ga0373961_0442948_11_268 77
603 3300041498 Ga0451841_0104539 Ga0451841_0104539_692_928 77
604 3300041512 Ga0451853_3099811 Ga0451853_3099811_649_885 77
605 3300041997 Ga0439431_0191419 Ga0439431_0191419_215_448 77
606 3300044658 Ga0466972_0000871 Ga0466972_0000871_13466_13711 77
607 3300046476 Ga0495662_0465451 Ga0495662_0465451_169_426 77
608 3300046507 Ga0495606_0126835 Ga0495606_0126835_1130_1366 77
609 3300046616 Ga0495668_0326689 Ga0495668_0326689_277_513 77
610 3300047472 Ga0495686_0086401 Ga0495686_0086401_710_946 77
611 3300048908 Ga0496105_0771693 Ga0496105_0771693_67_312 77
612 3300048911 Ga0496108_0915877 Ga0496108_0915877_408_644 77
613 3300048912 Ga0496109_1797873 Ga0496109_1797873_82_318 77
614 3300048924 Ga0496121_0575595 Ga0496121_0575595_408_641 77
615 3300048929 Ga0496126_0295321 Ga0496126_0295321_11_247 77
616 3300048929 Ga0496126_0409603 Ga0496126_0409603_821_1054 77
617 3300049581 Ga0501047_0412965 Ga0501047_0412965_264_584 77
618 3300050492 nmdc:mga0yw44_76505_c1 nmdc:mga0yw44_76505_c1_772_1008 77
619 3300053086 Ga0500578_0037573 Ga0500578_0037573_195_443 77
620 3300053087 Ga0500643_079356 Ga0500643_079356_307_540 77
621 3300053119 Ga0500595_067706 Ga0500595_067706_448_684 77
622 3300053155 Ga0500620_000713 Ga0500620_000713_1641_1889 77
623 3300053178 Ga0500637_0208947 Ga0500637_0208947_551_805 77
624 3300055283 Ga0500661_012269 Ga0500661_012269_115_348 77
625 iso_pu_bacteria 2524023210 2524468108 77

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04014

MazE_antitoxin

Antidote-toxin recognition MazE, bacterial antitoxin

20

61

0.9

Feature Viewer

pLDDT pTM Quality
80.56 0.36 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map